WO2016036801A1 - Cytotoxic benzodiazepine derivatives - Google Patents

Cytotoxic benzodiazepine derivatives Download PDF

Info

Publication number
WO2016036801A1
WO2016036801A1 PCT/US2015/048059 US2015048059W WO2016036801A1 WO 2016036801 A1 WO2016036801 A1 WO 2016036801A1 US 2015048059 W US2015048059 W US 2015048059W WO 2016036801 A1 WO2016036801 A1 WO 2016036801A1
Authority
WO
WIPO (PCT)
Prior art keywords
conjugate
compound
antibody
ala
optionally substituted
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/048059
Other languages
English (en)
French (fr)
Inventor
Ravi V.J. Chari
Michael Louis Miller
Manami Shizuka
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Immunogen Inc
Original Assignee
Immunogen Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=54140691&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2016036801(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to LTEP15763739.8T priority Critical patent/LT3189056T/lt
Priority to KR1020247003505A priority patent/KR20240023671A/ko
Priority to PL15763739T priority patent/PL3189056T3/pl
Priority to TN2017000070A priority patent/TN2017000070A1/en
Priority to CN202210858832.1A priority patent/CN116514903A/zh
Priority to SG11201701455SA priority patent/SG11201701455SA/en
Priority to CR20170111A priority patent/CR20170111A/es
Priority to JP2017512775A priority patent/JP6606545B2/ja
Priority to CN201580047847.8A priority patent/CN106604927B/zh
Priority to EP20178715.7A priority patent/EP3778601A1/en
Priority to SI201531320T priority patent/SI3189056T1/sl
Priority to AU2015311987A priority patent/AU2015311987B2/en
Priority to CA2959630A priority patent/CA2959630A1/en
Priority to MA40413A priority patent/MA40413B1/fr
Priority to EA201790446A priority patent/EA034138B1/ru
Priority to MX2017002758A priority patent/MX2017002758A/es
Priority to SM20200449T priority patent/SMT202000449T1/it
Application filed by Immunogen Inc filed Critical Immunogen Inc
Priority to EP15763739.8A priority patent/EP3189056B1/en
Priority to RS20201000A priority patent/RS60751B1/sr
Priority to HRP20201293TT priority patent/HRP20201293T1/hr
Priority to DK15763739.8T priority patent/DK3189056T3/da
Priority to ES15763739T priority patent/ES2815353T3/es
Priority to KR1020177009021A priority patent/KR102632830B1/ko
Priority to BR112017002963A priority patent/BR112017002963A2/pt
Publication of WO2016036801A1 publication Critical patent/WO2016036801A1/en
Priority to IL250712A priority patent/IL250712B/en
Priority to PH12017500358A priority patent/PH12017500358A1/en
Anticipated expiration legal-status Critical
Priority to CONC2017/0003011A priority patent/CO2017003011A2/es
Priority to IL274114A priority patent/IL274114A/en
Priority to IL281317A priority patent/IL281317B/en
Priority to AU2020227006A priority patent/AU2020227006B2/en
Priority to CY20201100835T priority patent/CY1123325T1/el
Priority to IL291598A priority patent/IL291598A/en
Priority to AU2022202418A priority patent/AU2022202418B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/551Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
    • A61K31/55131,4-Benzodiazepines, e.g. diazepam or clozapine
    • A61K31/55171,4-Benzodiazepines, e.g. diazepam or clozapine condensed with five-membered rings having nitrogen as a ring hetero atom, e.g. imidazobenzodiazepines, triazolam
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/545Heterocyclic compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/08Drugs for disorders of the urinary system of the prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D487/00Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
    • C07D487/02Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
    • C07D487/04Ortho-condensed systems
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D519/00Heterocyclic compounds containing more than one system of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring system not provided for in groups C07D453/00 or C07D455/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/02Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing at least one abnormal peptide link
    • C07K5/0202Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing at least one abnormal peptide link containing the structure -NH-X-X-C(=0)-, X being an optionally substituted carbon atom or a heteroatom, e.g. beta-amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/06Dipeptides
    • C07K5/06008Dipeptides with the first amino acid being neutral
    • C07K5/06017Dipeptides with the first amino acid being neutral and aliphatic
    • C07K5/06026Dipeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atom, i.e. Gly or Ala
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/06Dipeptides
    • C07K5/06008Dipeptides with the first amino acid being neutral
    • C07K5/06017Dipeptides with the first amino acid being neutral and aliphatic
    • C07K5/06034Dipeptides with the first amino acid being neutral and aliphatic the side chain containing 2 to 4 carbon atoms
    • C07K5/06052Val-amino acid
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/08Tripeptides
    • C07K5/0802Tripeptides with the first amino acid being neutral
    • C07K5/0804Tripeptides with the first amino acid being neutral and aliphatic
    • C07K5/0806Tripeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atoms, i.e. Gly, Ala
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/08Tripeptides
    • C07K5/0819Tripeptides with the first amino acid being acidic
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1021Tetrapeptides with the first amino acid being acidic
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to novel cytotoxic compounds, and cytotoxic conjugates comprising these cytotoxic compounds and cell-binding agents. More specifically, this invention relates to novel benzodiazepine compounds, derivatives thereof, intermediates thereof, conjugates thereof, and pharmaceutically acceptable salts thereof, which are useful as medicaments, in particular as anti-proliferative agents.
  • Benzodiazepine derivatives are useful compounds for treating various disorders, and include medicaments such as, antiepileptics (imidazo [2,l-b] [l,3,5]
  • benzothiadiazepines U.S. Pat. No. 4,444,688; U.S. Pat. No. 4,062,852
  • antibacterials pyrimido[l,2-c] [l,3,5]benzothiadiazepines, GB 1476684
  • diuretics and hypotensives pyrrolo(l,2-b)[l,2,5]benzothiadiazepine 5,5 dioxide, U.S. Pat. No. 3,506,646)
  • hypolipidemics WO 03091232
  • anti-depressants U.S. Pat. No. 3,453,266);
  • benzodiazepine derivatives such as pyrrolobenzodiazepines (PBDs)
  • PBDs pyrrolobenzodiazepines
  • N-2-imidazolyl alkyl substituted 1,2,5-benzothiadiazepine- 1,1 -dioxide U.S. Pat. No. 6,156,746
  • benzo- pyrido or dipyrido thiadiazepine WO 2004/069843
  • tomaymycin derivatives e.g. , pyrrolo[l,4]benzodiazepines
  • tomaymycin derivatives e.g. , pyrrolo[l,4]benzodiazepines
  • Benzodiazepines are also known to affect cell growth and differentiation (Kamal A., et al, Bioorg Med Chem. 2008 Aug 15;16(16):7804-10 (and references cited therein); Kumar R, Mini Rev Med Chem. 2003 Jun; 3(4):323-39 (and references cited therein); Bednarski J J, et al, 2004; Sutter A. P, et al, 2002; Blatt N B, et al, 2002), Kamal A. et al, Current Med. Chem., 2002; 2; 215-254, Wang J-J., J.Med. Chem., 2206; 49: 1442-1449, Alley M.C. et al, Cancer Res. 2004; 64:6700-6706, Pepper C. J., Cancer Res 2004; 74:6750-6755, Thurston D.E. and Bose D.S., Chem Rev 1994;
  • PBDs General structure of PBDs is described in US Publication Number 20070072846.
  • the PBDs differ in the number, type and position of substituents, in both their aromatic A rings and pyrrolo C rings, and in the degree of saturation of the C ring. Their ability to form an adduct in the minor groove and crosslink DNA enables them to interfere with DNA processing, hence their potential for use as antiproliferative agents.
  • SJG-136 (NSC 694501) is a potent cytotoxic agent that causes DNA inter-strand crosslinks (S.G Gregson et al, 2001, J. Med. Chem., 44: 737-748; M.C. Alley et al, 2004, Cancer Res., 64: 6700-6706; J.A. Hartley et al, 2004, Cancer Res., 64: 6693-6699; C. Martin et al, 2005,
  • novel benzodiazepine compounds described herein and the conjugates thereof have surprisingly high potency againt various tumor cells.
  • One object of the invention is to provide a cytotoxic compound represented by any one of the following formulas:
  • P is an amino acid residue or a peptide containing between 2 to 20 amino acid residues
  • R x is an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms;
  • J is a moiety comprising a reactive group that is capable of covalently linking the cytotoxic compound to a cell-binding agent
  • Y is a leaving group selected from -OR, -OCOR' , -OCOOR',
  • R 1 is a linear or branched alkyl having 1 to 10 carbon atoms and is substituted with at least one substituent selected from -N(R J ) 2 , -C0 2 H, -S0 3 H, and -PO 3 H; R 1 can be further optionally substituted with a substituent for an alkyl described herein;
  • R j is a linear or branched alkyl having 1 to 6 carbon atoms;
  • R k is a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, aryl, heterocyclyl or heteroaryl;
  • P' is an amino acid residue or a polypeptide containing between 2 to 20 amino acid residues
  • R for each occurrence, is independently selected from the group consisting of -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , an optionally substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms independently selected from O, S, N and P;
  • R' and R' ' are each independently selected from -H, -OH, -OR, -NHR, -NR 2 , -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit
  • R c is -H or an optionally substituted linear or branched alkyl having 1 to 4 carbon atoms;
  • n is an integer from 1 to 24;
  • X' is selected from -H, an amine-protecting group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , an optionally substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18- membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, and an optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms independently selected from O, S, N and P;
  • Y' is selected from -H, an oxo group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, an optionally substituted 6- to 18-membered aryl, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, an optionally substituted 3- to 18- membered heterocyclic ring having 1 to 6 heteroatoms;
  • R 6 is -H, -R, -OR, -SR, -NR'R", -N0 2 , or halogen;
  • G is -CH- or -N-;
  • R5 for each occurrence is independently -H or an optionally substituted linear or branched alkyl having 1 to 10 carbon atoms.
  • G is -CH-.
  • a second object of the invention is to provide conjugates of cell binding agents with the novel benzodiazepine compounds or derivatives thereof of the present invention. These conjugates are useful as therapeutic agents, which are delivered specifically to target cells and are cytotoxic.
  • a conjugate of the invention may comprise: a cytotoxic compound and a cell-binding agent (CBA), wherein the cytotoxic compound is covalently linked to the CBA, and wherein said cytotoxic compound is represented by any one of the following formulas:
  • J' is a moiety comprising a linking group that is covalently linked to the cell- binding agent
  • G is -CH-.
  • the cell- binding agent is an anti-folate receptor antibody or an antibody fragment thereof. More specifically, the anti-folate receptor antibody is huMOV19 antibody.
  • the cell-binding agent is an anti-EGFR antibody or an antibody fragment thereof.
  • the anti-EGFR antibody is a non-antagonist antibody, including, for example, the antibodies described in WO2012058592, herein incorporated by reference.
  • the anti-EGFR antibody is a non-functional antibody, for example, humanized ML66. More specifically, the anti-EGFR antibody is huML66.
  • the present invention also includes a composition (e.g. , a pharmaceutical composition) comprising novel benzodiazepine compounds, derivatives thereof, or conjugates thereof, (and/or solvates, hydrates and/or salts thereof) and a carrier (a pharmaceutically acceptable carrier).
  • a composition e.g. , a pharmaceutical composition
  • novel benzodiazepine compounds, derivatives thereof, or conjugates thereof and a carrier (a pharmaceutically acceptable carrier)
  • a carrier a pharmaceutically acceptable carrier
  • the present compositions are useful for inhibiting abnormal cell growth or treating a proliferative disorder in a mammal (e.g. , human).
  • compositions are useful for treating conditions such as cancer, rheumatoid arthritis, multiple sclerosis, graft versus host disease (GVHD), transplant rejection, lupus, myositis, infection, immune deficiency such as AIDS, and inflammatory diseases in a mammal (e.g. , human).
  • conditions such as cancer, rheumatoid arthritis, multiple sclerosis, graft versus host disease (GVHD), transplant rejection, lupus, myositis, infection, immune deficiency such as AIDS, and inflammatory diseases in a mammal (e.g. , human).
  • the present invention includes a method of inhibiting abnormal cell growth or treating a proliferative disorder in a mammal (e.g. , human) comprising administering to said mammal a therapeutically effective amount of novel benzodiazepine compounds, derivatives thereof, or conjugates thereof, (and/or solvates and salts thereof) or a composition thereof, alone or in combination with a second therapeutic agent.
  • a mammal e.g. , human
  • the present invention includes a method of synthesizing and using novel benzodiazepine compounds, derivatives thereof, and conjugates thereof for in vitro, in situ, and in vivo diagnosis or treatment of mammalian cells, organisms, or associated pathological conditions.
  • the compounds of this invention, derivatives thereof, or conjugates thereof, and compositions comprising them, are useful for treating or lessening the severity of disorders, such as, characterized by abnormal growth of cells (e.g., cancer).
  • Other applications for compounds and conjugates of this invention include, but are not limited to, treating conditions such as cancer, rheumatoid arthritis, multiple sclerosis, graft versus host disease (GVHD), transplant rejection, lupus, myositis, infection, immune deficiency such as AIDS and inflammatory diseases in a mammal (e.g., human).
  • FIG. 1 shows binding affinity of huMOV19-14 conjugate as compared to unconjugated antibody huMOV19 on T47D cells.
  • FIG. 2 shows in vitro cytotoxicity and specificity of huMOV19-14 conjugate.
  • FIG. 3 shows that the huMOV19-14 conjugate exhibits weak bystander cytotoxic effect on the neighboring antigen-negative cells.
  • FIG. 4A, 4B and 4C show in vitro cytotoxicity of huMy9-6-14 conjugate against various cell lines.
  • FIG. 5A and 5B show that the huMy9-6-14 conjugate exhibits bystander cytotoxic effect on the neighboring antigen-negative cells.
  • FIG. 6 shows in vivo efficacy of huMOV19-80 and huMOV19-90 conjugates in NCI-H2110 bearing SCID mice.
  • FIG. 7A-7D show mass spectrometry profiles of representative conjugates of the present invention.
  • FIG. 8 shows mass spectrometry profile of huML66-90 conjugate.
  • FIG. 9 shows in vitro cytotoxicity and specificity of huML66-90 conjugate.
  • FIGs 10, 11 and 12 show in vitro cytotoxicity and specificity of huMOV19-90 conjugate.
  • FIG. 13 shows that the huMOV 19-90 conjugate exhibits strong bystander cytotoxic effect on the neighboring antigen-negative cells.
  • FIG. 14 shows in vivo efficacy of huMOV19-90 conjugate in NCI-H2110 bearing SCID mice.
  • FIGs. 15A and 15B shows binding affinity of huMOV19-90 conjugate as compared to unconjugated antibody huMOV19 on T47D cells.
  • FIG. 16 shows mass spectrometry profiles of a representative conjugates of the present invention.
  • FIG. 17 shows in vivo efficacy of huML66-90 conjugate in NCI-H1703 NSCLC bearing SCID mice.
  • FIG. 18 shows pharmacokinetics of huMOV19-90 in CD- 1 mice.
  • FIGs. 19A and 19B show the structure of huMOV19-90 conjugate (FIG. 19A), and a scheme for incubation, purification, and isolation of catabolites from huMOV19-
  • FIG. 20 shows binding affinity of huMOV19-107 conjugate as compared to unconjugated antibody huMOV19 on T47D cells.
  • FIG. 21 shows in vitro cytotoxicity and specificity of huMOV19-90 and
  • FIG. 22 shows in vivo efficacy of huMOV19-90 conjugate in bearing SCID mice bearing NCI-H2110 NSCLC xenografts.
  • FIG. 23 shows in vivo efficacy of huMOV19-90 conjugate in SCID mice bearing Hec-lb endometrial xenografts.
  • FIG. 24 shows in vivo efficacy of huMOV19-90 conjugate in SCID mice bearing Ishikawa endometrial xenografts.
  • FIG. 25 shows in vivo efficacy of huMOV19-107 conjugate in bearing SCID mice bearing NCI-H2110 NSCLC xenografts.
  • FIG. 26 shows binding affinity of huCD123-6Gv4.7S3-90 conjugate as compared to the unconjugated antibody on HNT-34 cells.
  • the term "cell-binding agent" or “CBA” refers to a compound that can bind a cell (e.g., on a cell-surface ligand) or bind a ligand associated with or proximate to the cell, preferably in a specific manner. In certain embodiments, binding to the cell or a ligand on or near the cell is specific.
  • the CBA may include peptides and non-peptides.
  • Linear or branched alkyl refers to a saturated linear or branched-chain monovalent hydrocarbon radical of one to twenty carbon atoms.
  • alkyl examples include, but are not limited to, methyl, ethyl, 1 -propyl, 2-propyl,
  • the alkyl has one to ten carbon atoms. More preferably, the alkyl has one to four carbon atoms.
  • the alkenyl has two to ten carbon atoms. More preferably, the alkyl has two to four carbon atoms.
  • Linear or branched alkynyl refers to a linear or branched monovalent hydrocarbon radical of two to twenty carbon atoms with at least one site of unsaturation, i.e., a carbon-carbon, triple bond. Examples include, but are not limited to, ethynyl, propynyl, 1-butynyl, 2-butynyl, 1-pentynyl, 2-pentynyl, 3-pentynyl, hexynyl, and the like.
  • the alkynyl has two to ten carbon atoms. More preferably, the alkynyl has two to four carbon atoms.
  • carrier refers to a monovalent non-aromatic, saturated or partially unsaturated ring having 3 to 12 carbon atoms as a monocyclic ring or 7 to 12 carbon atoms as a bicyclic ring.
  • Bicyclic carbocycles having 7 to 12 atoms can be arranged, for example, as a bicyclo [4,5], [5,5], [5,6], or [6,6] system, and bicyclic carbocycles having 9 or 10 ring atoms can be arranged as a bicyclo [5,6] or [6,6] system, or as bridged systems such as
  • bicyclo[2.2.1]heptane, bicyclo[2.2.2]octane and bicyclo[3.2.2]nonane examples include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, 1-cyclopent-l-enyl, l-cyclopent-2-enyl, l-cyclopent-3-enyl, cyclohexyl, 1-cyclohex-l-enyl, l-cyclohex-2-enyl, l-cyclohex-3-enyl, cyclohexadienyl, cycloheptyl, cyclooctyl, cyclononyl, cyclodecyl, cycloundecyl, cyclododecyl, and the like.
  • cyclic alkyl and “cycloalkyl” can be used interchangeably. They refer to a monovalent saturated carbocyclic ring radical. Preferably, the cyclic alkyl is 3 to 7 membered monocyclic ring radical. More preferably, the cyclic alkyl is cyclohexyl.
  • cyclic alkenyl refers to a carbocyclic ring radical having at least one double bond in the ring structure.
  • cyclic alkynyl refers to a carbocyclic ring radical having at least one triple bond in the ring structure.
  • Aryl means a monovalent aromatic hydrocarbon radical of 6-18 carbon atoms derived by the removal of one hydrogen atom from a single carbon atom of a parent aromatic ring system. Some aryl groups are represented in the exemplary structures as "AT.” Aryl includes bicyclic radicals comprising an aromatic ring fused to a saturated, partially unsaturated ring, or aromatic carbocyclic or heterocyclic ring.
  • Typical aryl groups include, but are not limited to, radicals derived from benzene (phenyl), substituted benzenes, naphthalene, anthracene, indenyl, indanyl, 1,2-dihydronapthalene, 1,2,3,4-tetrahydronapthyl, and the like.
  • aryl is phenyl group.
  • heterocycle refers to a saturated or a partially unsaturated (i.e., having one or more double and/or triple bonds within the ring) carbocyclic radical of 3 to 18 ring atoms in which at least one ring atom is a heteroatom selected from nitrogen, oxygen, phosphorus, and sulfur, the remaining ring atoms being C, where one or more ring atoms is optionally substituted independently with one or more substituents described below.
  • a heterocycle may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms and 1 to 4 heteroatoms selected from N, O, P, and S) or a bicycle having 7 to 10 ring members (4 to 9 carbon atoms and 1 to 6 heteroatoms selected from N, O, P, and S), for example: a bicyclo [4,5], [5,5], [5,6], or [6,6] system.
  • Heterocycles are described in Paquette, Leo A.; "Principles of Modern Heterocyclic Chemistry” (W. A. Benjamin, New York, 1968), particularly Chapters 1, 3, 4, 6, 7, and 9; "The Chemistry of
  • Heterocyclic Compounds A series of Monographs" (John Wiley & Sons, New York, 1950 to present), in particular Volumes 13, 14, 16, 19, and 28; and J. Am. Chem. Soc. (1960) 82:5566.
  • Heterocyclyl also includes radicals where heterocycle radicals are fused with a saturated, partially unsaturated ring, or aromatic carbocyclic or heterocyclic ring.
  • heterocyclic rings include, but are not limited to, pyrrolidinyl, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothienyl, tetrahydropyranyl, dihydropyranyl, tetrahydrothiopyranyl, piperidino, morpholino, thiomorpholino, thioxanyl, piperazinyl, homopiperazinyl, azetidinyl, oxetanyl, thietanyl, homopiperidinyl, oxepanyl, thiepanyl, oxazepinyl, diazepinyl, thiazepinyl, 2-pyrrolinyl, 3-pyrrolinyl, indolinyl, 2H-pyranyl, 4H-pyranyl, dioxanyl, 1,3-dioxolanyl, pyrazolinyl, dithianyl, dithiolan
  • azabicyclo[2.2.2]hexanyl Spiro moieties are also included within the scope of this definition.
  • heteroaryl refers to a monovalent aromatic radical of 5- or 6- membered rings, and includes fused ring systems (at least one of which is aromatic) of 5-18 atoms, containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur.
  • heteroaryl groups are pyridinyl (including, for example, 2-hydroxypyridinyl), imidazolyl, imidazopyridinyl, pyrimidinyl (including, for example, 4-hydroxypyrimidinyl), pyrazolyl, triazolyl, pyrazinyl, tetrazolyl, furyl, thienyl, isoxazolyl, thiazolyl, oxazolyl, isothiazolyl, pyrrolyl, quinolinyl, isoquinolinyl, indolyl, benzimidazolyl, benzofuranyl, cinnolinyl, indazolyl, indolizinyl, phthalazinyl, pyridazinyl, triazinyl, isoindolyl, pteridinyl, purinyl, oxadiazolyl, triazolyl, thiadiazolyl, furazanyl,
  • the heterocycle or heteroaryl groups may be carbon (carbon-linked) or nitrogen (nitrogen-linked) attached where such is possible.
  • carbon bonded heterocycles or heteroaryls are bonded at position 2, 3, 4, 5, or 6 of a pyridine, position 3, 4, 5, or 6 of a pyridazine, position 2, 4, 5, or 6 of a pyrimidine, position 2, 3, 5, or 6 of a pyrazine, position 2, 3, 4, or 5 of a furan, tetrahydrofuran, thiofuran, thiophene, pyrrole or tetrahydropyrrole, position 2, 4, or 5 of an oxazole, imidazole or thiazole, position 3, 4, or 5 of an isoxazole, pyrazole, or isothiazole, position 2 or 3 of an aziridine, position 2, 3, or 4 of an azetidine, position 2, 3, 4, 5, 6, 7, or 8 of a quinoline or position 1, 3, 4,
  • nitrogen bonded heterocycles or heteroaryls are bonded at position 1 of an aziridine, azetidine, pyrrole, pyrrolidine, 2-pyrroline, 3-pyrroline, imidazole, imidazolidine, 2-imidazoline, 3-imidazoline, pyrazole, pyrazoline, 2-pyrazoline, 3-pyrazoline, piperidine, piperazine, indole, indoline, lH-indazole, position 2 of a isoindole, or isoindoline, position 4 of a morpholine, and position 9 of a carbazole, or O-carboline.
  • heteroatoms present in heteroaryl or heterocyclcyl include the oxidized forms such as NO, SO, and S0 2 .
  • halo or halogen refers to F, CI, Br or I.
  • alkyl, alkenyl, alkynyl, cyclic alkyl, cyclic alkenyl, cyclic alkynyl, carbocyclyl, aryl, heterocyclyl and heteroaryl described above can be optionally substituted with one more (e.g. , 2, 3, 4, 5, 6 or more) substituents.
  • a substituent is described as being "substituted," a non-hydrogen substituent is in the place of a hydrogen substituent on a carbon, oxygen, sulfur or nitrogen of the substituent.
  • a substituted alkyl substituent is an alkyl substituent wherein at least one non-hydrogen substituent is in the place of a hydrogen substituent on the alkyl substituent.
  • monofluoroalkyl is alkyl substituted with a fluoro substituent
  • difluoroalkyl is alkyl substituted with two fluoro substituents. It should be recognized that if there is more than one substitution on a substituent, each non- hydrogen substituent may be identical or different (unless otherwise stated).
  • a substituent is described as being “optionally substituted,” the substituent may be either (1) not substituted, or (2) substituted. If a carbon of a substituent is described as being optionally substituted with one or more of a list of substituents, one or more of the hydrogens on the carbon (to the extent there are any) may separately and/or together be replaced with an independently selected optional substituent. If a nitrogen of a substituent is described as being optionally substituted with one or more of a list of substituents, one or more of the hydrogens on the nitrogen (to the extent there are any) may each be replaced with an independently selected optional substituent.
  • One exemplary substituent may be depicted as -NR'R", wherein R' and R" together with the nitrogen atom to which they are attached, may form a heterocyclic ring.
  • heterocyclic ring formed from R' and R" together with the nitrogen atom to which they are attached may be partially or fully saturated.
  • the heterocyclic ring consists of 3 to 7 atoms.
  • the heterocyclic ring is selected from the group consisting of pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, isoxazolyl, pyridyl and thiazolyl.
  • a group of substituents are collectively described as being optionally substituted by one or more of a list of substituents, the group may include: (1) unsubstitutable substituents, (2) substitutable substituents that are not substituted by the optional substituents, and/or (3) substitutable substituents that are substituted by one or more of the optional substituents.
  • a substituent is described as being optionally substituted with up to a particular number of non-hydrogen substituents, that substituent may be either (1) not substituted; or (2) substituted by up to that particular number of non-hydrogen substituents or by up to the maximum number of substitutable positions on the substituent, whichever is less.
  • a substituent is described as a heteroaryl optionally substituted with up to 3 non-hydrogen substituents, then any heteroaryl with less than 3
  • substitutable positions would be optionally substituted by up to only as many non- hydrogen substituents as the heteroaryl has substitutable positions.
  • R 101 , R 102 and R 103 are each independently selected from H, linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit (-CH 2 CH 2 0) n -R 104 , wherein n is an integer from 1 to 24, an aryl having from 6 to 10 carbon atoms, a heterocyclic ring having from 3 to 10 carbon atoms and a heteroaryl having 5 to 10 carbon atoms; and R 104 is H or a linear or branched alkyl having 1 to 4 carbon atoms, wherein the alkyl, alkenyl, alkynyl, aryl, heteroaryl and heterocyclyl in the groups represented by R 100 , R 101 , R 102 , R 103 and R 104 are optionally substituted with one or
  • substituents independently selected from halogen, -OH, -CN, -N0 2 and unsubstituted linear or branched alkyl having 1 to 4 carbon atoms.
  • substituents for the optionally substituted alkyl, alkenyl, alkynyl, cyclic alkyl, cyclic alkenyl, cyclic alkynyl, carbocyclyl, aryl, heterocyclyl and heteroaryl described above include halogen, -CN, -NR 102 R 103 , -CF 3 , -OR 101 , aryl, heteroaryl, heterocyclyl, -SR 101 , -SOR 101 , -S0 2 R 101 and -S0 3 M.
  • cytotoxic dimer compound are used interchangeably. They are intended to include compounds for which a structure or formula or any derivative thereof has been disclosed in the present invention or a structure or formula or any derivative thereof that has been incorporated by reference.
  • the term also includes, stereoisomers, geometric isomers, tautomers, solvates, metabolites, salts (e.g. , pharmaceutically acceptable salts) and prodrugs, and prodrug salts of a compound of all the formulae disclosed in the present invention.
  • the term also includes any solvates, hydrates, and polymorphs of any of the foregoing.
  • conjugate refers to a compound described herein or a derivative thereof that is linked to a cell binding agent.
  • linkable to a cell binding agent refers to the compounds described herein or derivates thereof comprising at least one linking group or a precursor thereof suitable to bond these compounds or derivatives thereof to a cell binding agent.
  • precursor of a given group refers to any group which may lead to that group by any deprotection, a chemical modification, or a coupling reaction.
  • linked to a cell binding agent refers to a conjugate molecule comprising at least one of the compounds described herein (e.g., compounds of formula (I)-(IV) and (VIII)-(XI) and drug-linker compounds describe herein), or derivative thereof bound to a cell binding agent via a suitable linking group or a precursor thereof.
  • stereoisomer refers to compounds which have identical chemical constitution and connectivity, but different orientations of their atoms in space that cannot be interconverted by rotation about single bonds.
  • Diastereomer refers to a stereoisomer with two or more centers of chirality and whose molecules are not mirror images of one another. Diastereomers have different physical properties, e.g. melting points, boiling points, spectral properties, and reactivities. Mixtures of diastereomers may separate under high resolution analytical procedures such as crystallization, electrophoresis and chromatography.
  • Enantiomers refer to two stereoisomers of a compound which are non- superimposable mirror images of one another.
  • the compounds of the invention may contain asymmetric or chiral centers, and therefore exist in different stereoisomeric forms. It is intended that all stereoisomeric forms of the compounds of the invention, including but not limited to, diastereomers, enantiomers and atropisomers, as well as mixtures thereof such as racemic mixtures, form part of the present invention.
  • Many organic compounds exist in optically active forms, i.e., they have the ability to rotate the plane of plane-polarized light. In describing an optically active compound, the prefixes D and L, or R and S, are used to denote the absolute configuration of the molecule about its chiral center(s).
  • d and 1 or (+) and (-) are employed to designate the sign of rotation of plane-polarized light by the compound, with (-) or 1 meaning that the compound is levorotatory.
  • a compound prefixed with (+) or d is dextrorotatory.
  • these stereoisomers are identical except that they are mirror images of one another.
  • a specific stereoisomer may also be referred to as an enantiomer, and a mixture of such isomers is often called an enantiomeric mixture.
  • a 50:50 mixture of enantiomers is referred to as a racemic mixture or a racemate, which may occur where there has been no stereoselection or stereospecificity in a chemical reaction or process.
  • racemic mixture and racemate refer to an equimolar mixture of two enantiomeric species, devoid of optical activity.
  • tautomer or "tautomeric form” refers to structural isomers of different energies which are interconvertible via a low energy barrier.
  • proton tautomers also known as prototropic tautomers
  • Valence tautomers include interconversions by reorganization of some of the bonding electrons.
  • prodrug refers to a precursor or derivative form of a compound of the invention that is capable of being enzymatically or hydrolytically activated or converted into the more active parent form. See, e.g., Wilman, "Prodrugs in Cancer Chemotherapy” Biochemical Society Transactions, 14, pp. 375-382, 615th Meeting Harbor (1986) and Stella et ah, "Prodrugs: A Chemical
  • the prodrugs of this invention include, but are not limited to, ester-containing prodrugs, phosphate-containing prodrugs, thiophosphate- containing prodrugs, sulfate-containing prodrugs, peptide-containing prodrugs, D-amino acid-modified prodrugs, glycosylated prodrugs, ⁇ -lactam-containing prodrugs, optionally substituted phenoxyacetamide-containing prodrugs, optionally substituted phenylacetamide-containing prodrugs, 5-fluorocytosine and other 5-fluorouridine prodrugs which can be converted into the more active cytotoxic free drug.
  • prodrug examples include, but are not limited to, compounds of the invention and chemotherapeutic agents such as described above.
  • prodrug is also meant to include a derivative of a compound that can hydrolyze, oxidize, or otherwise react under biological conditions (in vitro or in vivo) to provide a compound of this invention. Prodrugs may only become active upon such reaction under biological conditions, or they may have activity in their unreacted forms.
  • prodrugs contemplated in this invention include, but are not limited to, analogs or derivatives of compounds of any one of the formulae disclosed herein that comprise biohydrolyzable moieties such as biohydrolyzable amides, biohydrolyzable esters, biohydrolyzable carbamates, biohydrolyzable carbonates, biohydrolyzable ureides, and biohydrolyzable phosphate analogues.
  • Other examples of prodrugs include derivatives of compounds of any one of the formulae disclosed herein that comprise -NO, -NO 2 , -ONO, or -ONO 2 moieties.
  • Prodrugs can typically be prepared using well- known methods, such as those described by Burger's Medicinal Chemistry and Drug Discovery (1995) 172- 178, 949-982 (Manfred E. Wolff ed., 5th ed); see also Goodman and Gilman' s, The Pharmacological basis of Therapeutics, 8th ed., McGraw-Hill, Int. Ed. 1992, "Biotransformation of Drugs.”
  • prodrug of the invention includes compounds (with or without any linker groups) and conjugates of the invention comprising an adduct formed between an imine bond of the compounds / conjugates and an imine reactive reagent.
  • Another preferred form of prodrug of the invention includes compounds such as those of formula (I) - (IV), wherein when the double line ⁇ between N and C represents a single bond, X is H or an amine protecting group, and the compound becomes a prodrug.
  • a prodrug of the invention may contain one or both forms of prodrugs described herein (e.g. , containing an adduct formed between an imine bond of the compounds / conjugates and an imine reactive reagent, and/or containing a Y leaving group when X is -H).
  • imine reactive reagent refers to a reagent that is capable of reacting with an imine group.
  • imine reactive reagent includes, but is not limited to, sulfites (H 2 SO 3 , H 2 SO 2 or a salt of HS0 3 " , S0 3 2 ⁇ or HS0 2 " formed with a cation), metabisulfite (H 2 S 2 O 5 or a salt of S 2 O 5 " formed with a cation), mono, di, tri, and tetra- thiophosphates (P0 3 SH 3 , P0 2 S 2 H 3 , POS 3 H 3 , PS 4 H 3 or a salt of P0 3 S 3" , P0 2 S 2 3" , POS 3 3” or PS 4 3" formed with a cation), thio phosphate esters ((R i O) 2 PS(OR i ), PJSH, PJSOH, R 1 S0 2 H, R'S0 3
  • HOCH 2 SO 2 formed with a cation, such as HOCH 2 SO 2 Na + ), glycated nucleotide (such as GDP-mannose), fludarabine or a mixture thereof, wherein R 1 and R 1 are each independently a linear or branched alkyl having 1 to 10 carbon atoms and are substituted with at least one substituent selected from -N(R j ) 2 , -C0 2 H, -SO 3 H, and -PO 3 H; R' and R' can be further optionally substituted with a substituent for an alkyl described herein; R J is a linear or branched alkyl having 1 to 6 carbon atoms; and R k is a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, aryl, heterocyclyl or heteroaryl (preferably, R k is a linear or branched alkyl having 1 to 4 carbon atoms; more preferably
  • the cation is a monovalent cation, such as Na + or K + .
  • the imine reactive reagent is selected from sulfites, hydroxyl amine, urea and hydrazine. More preferably, the imine reactive reagent is NaHS0 3 or KHS0 3 .
  • biohydrolyzable amide As used herein and unless otherwise indicated, the terms “biohydrolyzable amide,” “biohydrolyzable ester,” “biohydrolyzable carbamate,” “biohydrolyzable carbonate,” “biohydrolyzable ureide” and “biohydrolyzable phosphate analogue” mean an amide, ester, carbamate, carbonate, ureide, or phosphate analogue, respectively, that either: 1) does not destroy the biological activity of the compound and confers upon that compound advantageous properties in vivo, such as uptake, duration of action, or onset of action; or 2) is itself biologically inactive but is converted in vivo to a biologically active compound.
  • biohydrolyzable amides include, but are not limited to, lower alkyl amides, a-amino acid amides, alkoxyacyl amides, and
  • alkylaminoalkylcarbonyl amides examples include, but are not limited to, lower alkyl esters, alkoxyacyloxy esters, alkyl acylamino alkyl esters, and choline esters.
  • biohydrolyzable carbamates include, but are not limited to, lower alkylamines, substituted ethylenediamines, amino acids, hydroxyalkylamines, heterocyclic and heteroaromatic amines, and polyether amines.
  • Particularly favored prodrugs and prodrug salts are those that increase the bioavailability of the compounds of this invention when such compounds are administered to a mammal.
  • salts refers to pharmaceutically acceptable organic or inorganic salts of a compound of the invention.
  • Exemplary salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucuronate, saccharate, formate, benzoate, glutamate, methanesulfonate "mesylate,” ethanesulfonate, benzenesulfonate, p-toluenesulfonate, pamoate (i.e.
  • a pharmaceutically acceptable salt may involve the inclusion of another molecule such as an acetate ion, a succinate ion or other counter ion.
  • the counter ion may be any organic or inorganic moiety that stabilizes the charge on the parent compound.
  • a pharmaceutically acceptable salt may have more than one charged atom in its structure. Instances where multiple charged atoms are part of the pharmaceutically acceptable salt can have multiple counter ions. Hence, a pharmaceutically acceptable salt can have one or more charged atoms and/or one or more counter ion.
  • the desired pharmaceutically acceptable salt may be prepared by any suitable method available in the art, for example, treatment of the free base with an inorganic acid, such as hydrochloric acid,
  • hydrobromic acid sulfuric acid, nitric acid, methanesulfonic acid, phosphoric acid and the like, or with an organic acid, such as acetic acid, maleic acid, succinic acid, mandelic acid, fumaric acid, malonic acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid, a pyranosidyl acid, such as glucuronic acid or galacturonic acid, an alpha hydroxy acid, such as citric acid or tartaric acid, an amino acid, such as aspartic acid or glutamic acid, an aromatic acid, such as benzoic acid or cinnamic acid, a sulfonic acid, such as p-toluenesulfonic acid or ethanesulfonic acid, or the like.
  • an organic acid such as acetic acid, maleic acid, succinic acid, mandelic acid, fumaric acid, malonic acid, pyruvic acid, oxalic acid
  • the desired pharmaceutically acceptable salt may be prepared by any suitable method, for example, treatment of the free acid with an inorganic or organic base, such as an amine (primary, secondary or tertiary), an alkali metal hydroxide or alkaline earth metal hydroxide, or the like.
  • an inorganic or organic base such as an amine (primary, secondary or tertiary), an alkali metal hydroxide or alkaline earth metal hydroxide, or the like.
  • suitable salts include, but are not limited to, organic salts derived from amino acids, such as glycine and arginine, ammonia, primary, secondary, and tertiary amines, and cyclic amines, such as piperidine, morpholine and piperazine, and inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
  • amino acids such as glycine and arginine
  • ammonia such as glycine and arginine
  • primary, secondary, and tertiary amines such as piperidine, morpholine and piperazine
  • inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
  • solvate means a compound which further includes a stoichiometric or non- stoichiometric amount of solvent such as water, isopropanol, acetone, ethanol, methanol, DMSO, ethyl acetate, acetic acid, and ethanolamine dichloromethane, 2-propanol, or the like, bound by non-covalent intermolecular forces.
  • Solvates or hydrates of the compounds are readily prepared by addition of at least one molar equivalent of a hydroxylic solvent such as methanol, ethanol, 1-propanol, 2-propanol or water to the compound to result in solvation or hydration of the imine moiety.
  • abnormal cell growth and “proliferative disorder” are used interchangeably in this application.
  • abnormal cell growth refers to cell growth that is independent of normal regulatory mechanisms (e.g. , loss of contact inhibition).
  • tumor cells tumor cells
  • tumors tumor cells
  • any tumors that proliferate by receptor tyrosine kinases any tumors that proliferate by aberrant serine/threonine kinase activation
  • benign and malignant cells of other proliferative diseases in which aberrant serine/threonine kinase activation benign and malignant cells of other proliferative diseases in which aberrant serine/threonine kinase activation occurs.
  • cancer and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
  • tumor comprises one or more cancerous cells, and/or benign or pre-cancerous cells.
  • a “therapeutic agent” encompasses both a biological agent such as an antibody, a peptide, a protein, an enzyme or a chemotherapeutic agent.
  • a "chemotherapeutic agent” is a chemical compound useful in the treatment of cancer.
  • a “metabolite” is a product produced through metabolism in the body of a specified compound, a derivative thereof, or a conjugate thereof, or salt thereof.
  • Metabolites of a compound, a derivative thereof, or a conjugate thereof may be identified using routine techniques known in the art and their activities determined using tests such as those described herein. Such products may result for example from the oxidation, hydroxylation, reduction, hydrolysis, amidation, deamidation, esterification, deesterification, enzymatic cleavage, and the like, of the administered compound.
  • the invention includes metabolites of compounds, a derivative thereof, or a conjugate thereof, of the invention, including compounds, a derivative thereof, or a conjugate thereof, produced by a process comprising contacting a compound, a derivative thereof, or a conjugate thereof, of this invention with a mammal for a period of time sufficient to yield a metabolic product thereof.
  • phrases "pharmaceutically acceptable” indicates that the substance or composition must be compatible chemically and/or toxicologically, with the other ingredients comprising a formulation, and/or the mammal being treated therewith.
  • protecting group refers to a substituent that is commonly employed to block or protect a particular functionality while reacting other functional groups on the compound, a derivative thereof, or a conjugate thereof.
  • an "amine-protecting group” or an “amino-protecting moiety” is a substituent attached to an amino group that blocks or protects the amino functionality in the compound.
  • Such groups are well known in the art (see for example P. Wuts and T. Greene, 2007, Protective Groups in Organic Synthesis, Chapter 7, J.
  • carbamates such as methyl and ethyl carbamate, FMOC, substituted ethyl carbamates, carbamates cleaved by l,6-P-elimination (also termed "self immolative"), ureas, amides, peptides, alkyl and aryl derivatives.
  • Suitable amino- protecting groups include acetyl, trifluoroacetyl, t-butoxycarbonyl (BOC),
  • leaving group refers to an group of charged or uncharged moiety that departs during a substitution or displacement.
  • leaving groups include, but not limited to, halogens, esters, alkoxy, hydroxyl, tosylates, triflates, mesylates, nitriles, azide, carbamate, disulfides, thioesters, thioethers and diazonium compounds.
  • crosslinking agents refers to modifying agents that possess two reactive groups; one of which is capable of reacting with a cell binding agent while the other one reacts with the cytotoxic compound to link the two moieties together.
  • bifunctional crosslinkers are well known in the art (see, for example, Isalm and Dent in
  • bifunctional crosslinking agents that enable linkage via a thioether bond include N-succinimidyl-4-(N-maleimidomethyl)-cyclohexane-l-carboxylate (SMCC) to introduce maleimido groups, or with N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB) to introduce iodoacetyl groups.
  • SMCC N-succinimidyl-4-(N-maleimidomethyl)-cyclohexane-l-carboxylate
  • SIAB N-succinimidyl-4-(iodoacetyl)-aminobenzoate
  • bifunctional crosslinking agents that introduce maleimido groups or haloacetyl groups on to a cell binding agent are well known in the art (see US Patent Applications 2008/0050310, 20050169933, available from Pierce Biotechnology Inc. P.O. Box 117, Rockland, IL 61105, USA) and include, but not limited to, bis-maleimidopolyethyleneglycol (BMPEO), BM(PEO) 2 , BM(PEO) 3 , N-( -maleimidopropyloxy)succinimide ester (BMPS), ⁇ -maleimidobutyric acid
  • BMPEO bis-maleimidopolyethyleneglycol
  • BM(PEO) 2 BM(PEO) 3
  • BMPS N-( -maleimidopropyloxy)succinimide ester
  • N-succinimidyl ester GMBS
  • EMCS ⁇ -maleimidocaproic acid N-hydroxysuccinimide ester
  • 5-maleimidovaleric acid NHS HBVS
  • N-succinimidyl-4-(N- maleimidomethyl)-cyclohexane-l-carboxy-(6-amidocaproate) which is a "long chain" analog of SMCC (LC-SMCC), m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), 4-(4-N-maleimidophenyl)-butyric acid hydrazide or HC1 salt (MPBH)
  • N-succinimidyl 3-(bromoacetamido)propionate SBAP
  • N-succinimidyl iodoacetate SIA
  • K-maleimidoundecanoic acid N-succinimidyl ester KMUA
  • N-succinimidyl 4-(p-maleimidophenyl)-butyrate SMPB
  • succinimidyl-6-( - maleimidopropionamido)hexanoate SMPH
  • succinimidyl-(4-vinylsulfonyl)benzoate SB
  • dithiobis-maleimidoethane DTME
  • 1,4-bis-maleimidobutane BMB
  • 1,4 bismaleimidyl-2,3-dihydroxybutane BMDB
  • BMH bis-maleimidohexane
  • BMOE bis- maleimidoethane
  • Heterobifunctional crosslinking agents are bifunctional crosslinking agents having two different reactive groups. Heterobifunctional crosslinking agents containing both an amine-reactive N-hydroxysuccinimide group (NHS group) and a carbonyl- reactive hydrazine group can also be used to link the cytotoxic compounds described herein with a cell-binding agent (e.g., antibody). Examples of such commercially available heterobifunctional cros slinking agents include succinimidyl
  • Conjugates bearing an acid-labile linkage can also be prepared using a hydrazine-bearing benzodiazepine derivative of the present invention.
  • bifunctional crosslinking agents include succinimidyl-p- formyl benzoate (SFB) and succinimidyl-p-formylphenoxyacetate (SFPA).
  • Bifunctional crosslinking agents that enable the linkage of cell binding agent with cytotoxic compounds via disulfide bonds are known in the art and include
  • N- succinimidyl-3- (2-pyridyldithio)propionate SPDP
  • N- succinimidyl-4- (2- pyridyldithio)pentanoate SPP
  • N- succinimidyl-4- (2-pyridyldithio)butanoate SPDB
  • N- succinimidyl-4- (2-pyridyldithio)2-sulfo butanoate sulfo-SPDB
  • crosslinking agents such as 2-iminothiolane, homocysteine thiolactone or S-acetylsuccinic anhydride that introduce thiol groups can also be used.
  • a “linker,” “linker moiety,” or “linking group” as defined herein refers to a moiety that connects two groups, such as a cell binding agent and a cytotoxic compound, together. Typically, the linker is substantially inert under conditions for which the two groups it is connecting are linked.
  • a bifunctional crosslinking agent may comprise two reactive groups, one at each ends of a linker moiety, such that one reactive group can be first reacted with the cytotoxic compound to provide a compound bearing the linker moiety and a second reactive group, which can then react with a cell binding agent.
  • one end of the bifunctional crosslinking agent can be first reacted with the cell binding agent to provide a cell binding agent bearing a linker moiety and a second reactive group, which can then react with a cytotoxic compound.
  • the linking moiety may contain a chemical bond that allows for the release of the cytotoxic moiety at a particular site.
  • Suitable chemical bonds are well known in the art and include disulfide bonds, thioether bonds, acid labile bonds, photolabile bonds, peptidase labile bonds and esterase labile bonds (see for example US Patents 5,208,020; 5,475,092; 6,441,163; 6,716,821; 6,913,748; 7,276,497; 7,276,499; 7,368,565; 7,388,026 and 7,414,073). Preferred are disulfide bonds, thioether and peptidase labile bonds.
  • Other linkers that can be used in the present invention include non-cleavable linkers, such as those described in are described in detail in U.S. publication number 20050169933, or charged linkers or hydrophilic linkers and are described in US 2009/0274713,
  • the linking group with a reactive group attached at one end is selected from the following:
  • n, p, q, m', n', t' are integer from 1 to 10, or are optionally 0;
  • t, m", n", and p are 0 or 1;
  • Y" is absent or is selected from O, S, S-S or NR 32 , wherein R 32 has the same definition as given above for R; or
  • X" is selected from a maleimido group, a haloacetyl group or SR 37 , wherein R 37 has the same definition as above;
  • A" is an amino acid residue or a polypeptide containing between 2 to 20 amino acid residues
  • R20, R21, R22, R23, R24, R25, R26, and R 27 are the same or different, and are -H or a linear or branched alkyl having from 1 to 5 carbon atoms;
  • R 29 and R 30 are the same or different, and are -H or alkyl from 1 to 5 carbon atoms;
  • R 33 is -H or linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 12 carbon atoms, a polyethylene glycol unit R-(OCH 2 CH 2 ) n -, or R 33 is -COR 34 , -CSR 34, -SOR 34 , or -SO 2 R 34 , wherein R 34 is H or linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 20 carbon atoms or, a polyethylene glycol unit -(OCH 2 CH 2 ) n ; and
  • R 4 o and R 4 i is optionally a negatively or positively charged functional group and the other is H or alkyl, alkenyl, alkynyl having 1 to 4 carbon atoms.
  • linking groups may be present in any of the compounds, drug- linker compounds, or conjugates of the invention, including replacing the linking groups of any of the formulas described herein.
  • amino acid refers to naturally occurring amino acids or non- naturally occurring amino acid.
  • the term "cation" refers to an ion with positive charge.
  • the cation can be monovalent (e.g., Na + , K + , etc.), bi-valent (e.g. , Ca 2+ , Mg 2+ , etc.) or multi-valent (e.g. , Al 3+ etc.).
  • the cation is monovalent.
  • terapéuticaally effective amount means that amount of active compound or conjugate that elicits the desired biological response in a subject. Such response includes alleviation of the symptoms of the disease or disorder being treated, prevention, inhibition or a delay in the recurrence of symptom of the disease or of the disease itself, an increase in the longevity of the subject compared with the absence of the treatment, or prevention, inhibition or delay in the progression of symptom of the disease or of the disease itself. Determination of the effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein. Toxicity and therapeutic efficacy of compound I can be determined by standard pharmaceutical procedures in cell cultures and in experimental animals.
  • the effective amount of compound or conjugate of the present invention or other therapeutic agent to be administered to a subject will depend on the stage, category and status of the multiple myeloma and characteristics of the subject, such as general health, age, sex, body weight and drug tolerance.
  • the effective amount of compound or conjugate of the present invention or other therapeutic agent to be administered will also depend on administration route and dosage form. Dosage amount and interval can be adjusted individually to provide plasma levels of the active compound that are sufficient to maintain desired therapeutic effects.
  • the present invention is directed to cytotoxic compounds described herein (e.g. , compounds of structural formula (I), (II), (III), (IV), (V) or (VI), or a pharmaceutically acceptable salt thereof).
  • the cytotoxic compound is represented by structural formula (I) or a pharmaceutically acceptable salt thereof.
  • L' , L" and L'" are independently -H, an linear or branched alkyl having from 1 to 6 carbon atoms, halogen, -OH, (Ci-C6)alkoxy, or -N0 2 .
  • one of L' , L" and L'" is represented by formula (A), and the others are -H.
  • L' is represented by formula (A) and L" and L'" are both -H; and the remaining variables are as described above in the first embodiment.
  • R x is a linear, branched or cyclic alkyl having 1 to 6 carbon atoms optionally substituted with halogen, -OH, (Ci-C 3 )alkyl, (Ci-C 3 )alkoxy, halo(Ci-C 3 )alkyl, or a charged substituent or an ionizable group Q; and the remaining variables are as described above in the first embodiment or the 1 st specific embodiment.
  • Q is i) -S0 3 H, -Z'-S0 3 H, -OP0 3 H 2 , -Z'-OP0 3 H 2 , -P0 3 H 2 , -Z'-P0 3 H 2 , -C0 2 H, -Z'-C0 2 H, -NRnR 12 , or -Z'-NRnR 12 , or a pharmaceutically acceptable salt thereof; or, ii) -N + Ri 4 Ri 5 Ri 6 X or -Z'-N + Ri 4 RisRi 6 X ; Z' is an optionally substituted alkylene, an optionally substituted cycloalkylene or an optionally substituted phenylene; Ri 4 to Ri 6 are each independently an optionally substituted alkyl; and X " is a pharmaceutically acceptable anion; and the remaining variables are as described above in the 2 nd specific embodiment. More specifically, Q is -S0 3 H or a pharmaceutically acceptable salt thereof.
  • J is a moiety comprising a reactive group selected from the group consisting of NHR cl , -COOH, and -COE, wherein -COE represents a reactive ester and R cl is -H or linear or branched alkyl having 1 to 4 carbon atoms optionally substituted with halogen, -OH or (Ci-C 3 )alkoxy; and the remaining variables are as described above in the first embodiment or the 1 st or 2 nd specific embodiment.
  • J is COE selected from N-hydroxysuccinimde ester, N-hydroxy sulfosuccinimide ester, nitrophenyl (e.g. , 2 or 4-nitrophenyl) ester, dinitrophenyl (e.g. , 2,4-dinitrophenyl) ester, sulfo-tetraflurophenyl (e.g. , 4-sulfo- 2,3,5,6-tetrafluorophenyl) ester, and pentafluorophenyl ester; and the remaining
  • COE is a N-hydroxysuccinimide ester.
  • L' is represented by the following formula:
  • R a and R b are each independently -H, (Ci-C 3 )alkyl or a charged substituent or an ionizable group Q;
  • n is an integer from 1 to 6;
  • n' is 0 or an integer from 1 to 6;
  • Cy is a cyclic alkyl having 5 or 6 ring carbon atoms optionally substituted with halogen, -OH, (Ci-C 3 )alkyl, (Ci-C 3 )alkoxy, or halo(Ci-C3)alkyl; and the remaining variables are as described above in the first embodiment or the 1 st , 2 nd or 3 rd specific embodiment.
  • R a and R b are both H; Cy for formulas (B2) and (C2) is cyclohexane; and R 5 is H or Me; and the remaining variables are as described above in the 4 th specific embodiment. More specifically, m' in formulas (B2) and (C2) is 0 or 1.
  • L' is represented by the following formula:
  • R a and R b are each independently -H, (Ci-C 3 )alkyl or a charged substituent or an ionizable group Q;
  • n is an integer from 1 to 6;
  • q is an integer fro 1 to 5;
  • n' is an integer from 2 to 6;
  • M is a cation (e.g. , H + , Na + or K + );
  • R d is a linear or branched alkyl having 1 to 6 carbon atoms or selected from phenyl, nitrophenyl (e.g. , 2 or 4-nitrophenyl), dinitrophenyl (e.g. , 2,4-dinitrophenyl), carboxynitrophenyl (e.g. , 3-carboxy-4-nitrophenyl), pyridyl or nitropyridyl (e.g., 4-nitropyridyl);
  • R dl is a linear or branched alkyl having 1 to 6 carbon atoms
  • Z s is -H. In another embodiment, Z s is -SMe or -SPy (Py a pyridyl).
  • Z s is selected from any one of the following formulas:
  • the charged substituent or an ionizable group Q is i) -SO 3 H, -Z'-S0 3 H, -OP0 3 H 2 , -Z'-OP0 3 H 2 , -P0 3 H 2 , -Z'-P0 3 H 2 , -C0 2 H, -Z'-C0 2 H, -NRiiRi 2 , or -Z'-NRnRi 2 , or a pharmaceutically acceptable salt thereof; or, ii) -N + Ri 4 Ri5Ri6X or -Z'-N + Ri 4 RisRi6X ; Z' is an optionally substituted alkylene, an optionally substituted cycloalkylene or an optionally substituted phenylene; Ri 4 to Ri 6 are each independently an optionally substituted alkyl; and X " is a pharmaceutically acceptable anion; and the remaining variables are as described above in the 5 specific embodiment. More specifically, Q is -SO 3 H, -Z'-
  • R a and R b are both -H and R5 is H or Me; and the remaining variables are as described above in the 5 th specific embodiment.
  • -(CR a R b ) m - is -(CH 2 ) m "-C(Me 2 )- and m" is an integer from 1 to 5; the remaining variables are as described above in the 5 th specific
  • P is a peptide containing 2 to 10 amino acid residues; and the remaining variables are as described above in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th or 5 th specific embodiment.
  • P is a peptide containing 2 to 5 amino acid residues; and the remaining variables are as described above in the 6 th specific embodiment.
  • P is selected from Gly-Gly-Gly, Ala-Val, Val-Ala, Val- Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Lle-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu- Ala-Leu, He- Ala-Leu, Val-Ala-Val, Ala-Leu-Ala-Leu, ⁇ -Ala-Leu- Ala-Leu and Gly-Phe- Leu-Gly, Val-Arg, Arg-Val, Arg-Arg, Val-D-Cit, Val-D-Lys, Val-D-Arg, D-Val-Cit, D-
  • P is Gly-Gly-Gly, Ala-Val, Ala- Ala, Ala-D-Ala, D- Ala- Ala, and D-Ala-D-Ala; and the remaining variables are as described above in the 6 th specific embodiment.
  • X is -H or an amine protecting group
  • Y is selected from -H, -OR, -OCOR', -SR, -NR'R," an optionally substituted 5- or 6-membered nitrogen-containing heterocycle, -SO 3 H, -S0 2 H and -OSO 3 H; ane the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th or 7 th specific embodiment.
  • Y is selected from -H, -SO 3 M, -OH, -OMe, -OEt or - NHOH, wherein M is -H, Na + or K + ; and the remaining variables are as described above in the 8 th specific embodiment. More specifically, Y is -H, -SO 3 M or -OH.
  • X' is selected from the group consisting of -H, -OH, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, and phenyl; and the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th or 8 th specific embodiment.
  • X' is -H, -OH, (Ci-C 3 )alkyl, halo(Ci-C 3 )alkyl, or phenyl; and the remaining variables are as described above in the 9 th specific embodiment. More specifically, X' is -H, -OH or -Me. Even more specifically, X' is -H.
  • Y' is -H, an oxo group, (Ci-C 3 )alkyl or halo(Ci-C 3 )alkyl; and the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th , 8 th or 9 th specific embodiment. More specifically, Y' is -H or oxo. Even more specifically, Y' is -H.
  • R 6 is -OMe; and the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th , 8 th , 9 th , 10 th or 11 th specific embodiment.
  • Ri, R 2 , R 3 , R4, Ri', R 2 ⁇ R 3 ' and R 4 ' are independently -H, halogen, -N0 2 , -OH, (Ci-C 3 )alkyl, halo(Ci-C 3 )alkyl or (Ci-C 3 )alkoxy; and the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th , 8 th , 9 th , 10 th , 11 th or 12 specific embodiment. More specifically, R l5 R 2 , R 3 , R4, Ri', R 2 ', R 3 ' and R 4 ' are all -H.
  • R, R', R" and R5 are each independently -H or (Ci-C 3 )alkyl; and the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th , 8 th , 9 th , 10 th , 11 th , 12 th or 13 th specific embodiment.
  • Ri, R 2 , R 3 , R4, Ri', R 2 ⁇ R 3 ' and R 4 ' are all -H;
  • R 6 is -OMe
  • X' and Y' are both -H;
  • a and A' are -0-;
  • M is H, Na + or K + ; and the remaining variables are as described in the first embodiment or or the 1 st , 2 nd , 3 rd , 4 th , 5 th or 6 th specific embodiment.
  • the cytotoxic compound of the present invention is selected from the followin formulas:
  • Y is -H, -OH or -S0 3 M
  • M is a pharmaceutically acceptable cation (e.g., H + , Na + or K + );
  • Z s is selected from formulas (al)-(al5) described above.
  • Z s is selectef from formulas (a7), (a8), (a9) and (al5). In a even more specific embodiment, Z s is represented by formual (a9).
  • Z s is represented by formual (a7).
  • Z s is -H.
  • Y is -S0 3 M.
  • Y is -OH.
  • cytotoxic compounds of the present invention can be prepared according to methods described in U.S. Patent No. 8,765,740 and U.S. Application Publication No. 2012/0238731.
  • Cell-binding agents can be of any kind presently known, or that become known, including peptides and non-peptides. Generally, these can be antibodies (such as polyclonal antibodies and monoclonal antibodies, especially monoclonal antibodies), lymphokines, hormones, growth factors, vitamins (such as folate etc., which can bind to a cell surface receptor thereof, e.g., a folate receptor), nutrient-transport molecules (such as transferrin), or any other cell-binding molecule or substance.
  • the appropriate cell-binding agent is a matter of choice that partly depends upon the particular cell population that is to be targeted, but in many (but not all) cases, human monoclonal antibodies are a good choice if an appropriate one is available.
  • the monoclonal antibody MY9 is a murine IgGi antibody that binds specifically to the CD33 Antigen (J.D. Griffin et ah, Leukemia Res., 8:521 (1984)), and can be used if the target cells express CD33 as in the disease of acute myelogenous leukemia (AML).
  • the cell-binding agent is not a protein.
  • the cell binding agent may be a vitamin that binds to a vitamin receptor, such as a cell- surface receptor.
  • vitamin A binds to retinol- binding protein (RBP) to form a complex, which complex in turn binds the STRA6 receptor with high affinity and increases vitamin A in-take.
  • RBP retinol- binding protein
  • folic acid / folate / vitamin Bg binds the cell-surface folate receptor (FR), for example, FRa, with high affinity.
  • Folic acid or antibodies that bind to FRa can be used to target the folate receptor expressed on ovarian and other tumors.
  • vitamin D and its analog bind to vitamin D receptor.
  • the cell-binding agent is a protein or a polypeptide, or a compound comprising a protein or polypeptide, including antibody, non-antibody protein, or polypeptide.
  • the protein or polypeptides comprise one or more Lys residues with side chain -NH 2 group.
  • the Lys side chain -NH 2 groups can be covalently linked to the bifunctional crosslinkers, which in turn are linked to the dimer compounds of the invention, thus conjugating the cell-binding agents to the dimer compounds of the invention.
  • Each protein-based cell-binding agents can contain multiple Lys side chain -NH 2 groups available for linking the compounds of the invention through the bifunctional crosslinkers.
  • GM-CSF a ligand / growth factor which binds to myeloid cells
  • IL-2 which binds to activated T-cells can be used for prevention of transplant graft rejection, for therapy and prevention of graft-versus-host disease, and for treatment of acute T-cell leukemia.
  • MSH which binds to melanocytes, can be used for the treatment of melanoma, as can antibodies directed towards melanomas.
  • Epidermal growth factor can be used to target squamous cancers, such as lung and head and neck. Somatostatin can be used to target neuroblastomas and other tumor types.
  • Estrogen or estrogen analogues
  • Androgen or androgen analogues
  • the cell-binding agent can be a lymphokine, a hormone, a growth factor, a colony stimulating factor, or a nutrient-transport molecule.
  • the cell-binding agent is an antibody mimetic, such as an ankyrin repeat protein, a Centyrin, or an adnectin / monobody.
  • the cell-binding agent is an antibody, a single chain antibody, an antibody fragment that specifically binds to the target cell, a monoclonal antibody, a single chain monoclonal antibody, a monoclonal antibody fragment (or
  • antigen-binding portion that specifically binds to a target cell, a chimeric antibody, a chimeric antibody fragment (or “antigen-binding portion") that specifically binds to the target cell, a domain antibody (e.g. , sdAb), or a domain antibody fragment that specifically binds to the target cell.
  • a chimeric antibody that specifically binds to a target cell
  • a chimeric antibody fragment that specifically binds to the target cell
  • domain antibody e.g. , sdAb
  • the cell-binding agent is a humanized antibody, a humanized single chain antibody, or a humanized antibody fragment (or "antigen- binding portion").
  • the humanized antibody is huMy9-6 or another related antibody, which is described in U.S. Pat. Nos. 7,342, 110 and 7,557, 189.
  • the humanized antibody is an anti-folate receptor antibody described in U.S. Provisional Application Nos. 61/307,797, 61/346,595, and 61/413,172 and U.S. Application No. 13/033,723 (published as US 2012/0009181 Al). The teachings of all these applications are incorporated herein by reference in its entirety.
  • the cell-binding agent is a resurfaced antibody, a resurfaced single chain antibody, a resurfaced antibody fragment (or "antigen-binding portion"), or a bispecific antibody.
  • the cell-binding agent is a minibody, an avibody, a diabody, a tribody, a tetrabody, a nanobody, a probody, a domain antibody, or an unibody.
  • an exemplary cell binding agent may include an antibody, a single chain antibody, an antibody fragment that specifically binds to the target cell, a monoclonal antibody, a single chain monoclonal antibody, a monoclonal antibody fragment that specifically binds to a target cell, a chimeric antibody, a chimeric antibody fragment that specifically binds to the target cell, a bispecific antibody, a domain antibody, a domain antibody fragment that specifically binds to the target cell, an interferon (e.g., a, ⁇ , ⁇ ), a lymphokine (e.g., IL-2, IL-3, IL-4, and IL-6), a hormone (e.g., insulin, thyrotropin releasing hormone (TRH), melanocyte- stimulating hormone (MSH), and a steroid hormone (e.g., androgen and estrogen)), a vitamin (e.g., folate), a growth factor (e.g., EGF, TGF-alpha
  • Centyrin a protein scaffold based on a consensus sequence of fibronectin type III (FN3) repeats; see U.S. Patent Publication 2010/0255056, 2010/0216708 and 2011/0274623 incorporated herein by reference
  • Ankyrin Repeat Protein e.g., a designed ankyrin repeat protein, known as DARPin; see U.S. Patent Publication Nos. 2004/0132028, 2009/0082274, 2011/0118146, and
  • Adnectin a fibronectin domain scaffold protein; see US Patent Publication Nos. 2007/0082365; 2008/0139791, incorporated herein by reference
  • Avibody including diabodies, triabodies, and tetrabodies; see U.S. Publication Nos. 2008/0152586 and 2012/0171115
  • DART dual receptor retargeting
  • the cell-binding agent may be a ligand that binds to a moiety on the target cell, such as a cell-surface receptor.
  • the ligand may be a growth factor or a fragment thereof that binds to a growth factor receptor; or may be a cytokine or a fragment thereof that binds to a cytokine receptor.
  • the growth factor receptor or cytokine receptor is a cell-surface receptor.
  • the CBA may bind to a ligand on the target cell, such as a cell-surface ligand, including cell- surface receptors.
  • Specific exemplary antigens or ligands may include renin; a growth hormone ⁇ e.g., human growth hormone and bovine growth hormone); a growth hormone releasing factor; a parathyroid hormone; a thyroid stimulating hormone; a lipoprotein; alpha- 1- antitrypsin; insulin A-chain; insulin B-chain; proinsulin; a follicle stimulating hormone; calcitonin; a luteinizing hormone; glucagon; a clotting factor ⁇ e.g., factor vmc, factor IX, tissue factor, and von Willebrands factor); an anti-clotting factor ⁇ e.g., Protein C); an atrial natriuretic factor; a lung surfactant; a plasminogen activator ⁇ e.g., a urokinase, a human urine or tissue-type plasminogen activator); bombesin; a thrombin; hemopoietic growth factor; tumor necrosis factor- alpha
  • gonadotropin-associated peptide a microbial protein (beta-lactamase); DNase; IgE; a cytotoxic T-lymphocyte associated antigen ⁇ e.g., CTLA-4); inhibin; activin; a vascular endothelial growth factor; a receptor for hormones or growth factors; protein A or D; a rheumatoid factor; a neurotrophic factor(e.g., bone-derived neurotrophic factor, neurotrophin-3, -4, -5, or -6), a nerve growth factor ⁇ e.g., NGF- ⁇ ); a platelet-derived growth factor; a fibroblast growth factor (e.g., aFGF and bFGF); fibroblast growth factor receptor 2; an epidermal growth factor; a transforming growth factor (e.g., TGF-alpha, TGF- ⁇ , TGF- 2, TGF- 3, TGF- 4, and TGF- 5); insulin-like growth factor-I and -II
  • melanotransferrin EpCAM; GD3; FLT3; PSMA; PSCA; MUC1 ; MUC16; STEAP; CEA; TENB2; an EphA receptor; an EphB receptor; a folate receptor; FOLR1 ;
  • CD proteins e.g. , CD2, CD3, CD4, CD5, CD6, CD8, CD11, CD14, CD19, CD20, CD21, CD22, CD25, CD26, CD28, CD30, CD33, CD36, CD37, CD38, CD40, CD44, CD52, CD55, CD56, CD59, CD70, CD79, CD80.
  • CD81, CD103, CD105, CD123, CD134, CD137, CD138, and CD152 one or more tumor- associated antigens or cell-surface receptors (see US Publication No. 2008/0171040 or US Publication No. 2008/0305044, incorporated in their entirety by reference); erythropoietin; an osteoinductive factor; an immunotoxin; a bone
  • morphogenetic protein e.g. , interferon- alpha, -beta, and -gamma
  • an interferon e.g. , interferon- alpha, -beta, and -gamma
  • a colony stimulating factor e.g. , M-CSF, GM-CSF, and G-CSF
  • interleukins e.g. , IL- 1 to IL-10
  • a superoxide dismutase e.g. , IL- 1 to IL-10
  • a superoxide dismutase e.g. , IL- 1 to IL-10
  • a superoxide dismutase e.g. , IL- 1 to IL-10
  • a superoxide dismutase e.g. , IL- 1 to IL-10
  • a superoxide dismutase e.g. , IL- 1 to IL-10
  • a tumor associated antigen e.g. , HER2, HER3 and HER4 receptor
  • endoglin e.g. , HER2, HER3 and HER4 receptor
  • endoglin e.g. , HER2, HER3 and HER4 receptor
  • endoglin e.g. , HER2, HER3 and HER4 receptor
  • endoglin e.g. , HER2, HER3 and HER4 receptor
  • endoglin e.g. , HER2, HER3 and HER4 receptor
  • endoglin e.g. , HER2, HER3 and HER4 receptor
  • endoglin e.g. , HER2, HER3 and HER4 receptor
  • endoglin e.g. , HER2, HER3 and HER4 receptor
  • endoglin e.g. , HER2, HER3 and HER4 receptor
  • endoglin e.g. ,
  • the term "antibody” includes immunoglobulin (Ig) molecules.
  • the antibody is a full-length antibody that comprises four polypeptide chains, namely two heavy chains (HC) and two light chains (LC) interconnected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable region (HCVR or VH) and a heavy chain constant region (CH).
  • the heavy chain constant region is comprised of three domains, CHI, CH2, and CH3.
  • Each light chain is comprised of a light chain variable region (LCVR or VL) and a light chain constant region, which is comprised of one domain, CL.
  • VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs). Interspersed with such regions are the more conserved framework regions (FRs).
  • CDRs complementarity determining regions
  • FRs framework regions
  • Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy- terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
  • the antibody is IgG, IgA, IgE, IgD, or IgM. In certain embodiments, the antibody is IgGl, IgG2, IgG3, or IgG4; or IgAl or IgA2.
  • the cell-binding agent is an "antigen-binding portion" of a monoclonal antibody, sharing sequences critical for antigen-binding with an antibody (such as huMy9-6 or its related antibodies described in U.S. Pat. Nos.
  • the term "antigen-binding portion" of an antibody include one or more fragments of an antibody that retain the ability to specifically bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by certain fragments of a full-length antibody.
  • binding fragments encompassed within the term "antigen-binding portion" of an antibody include (without limitation): (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains (e.g., an antibody digested by papain yields three fragments: two antigen-binding Fab fragments, and one Fc fragment that does not bind antigen); (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region (e.g., an antibody digested by pepsin yields two fragments: a bivalent antigen-binding F(ab') 2 fragment, and a pFc' fragment that does not bind antigen) and its related F(ab') monovalent unit; (iii) a Fd fragment consisting of the VH and CHI domains (i.e., that portion of the heavy chain which is included in the Fab); (ii
  • antigen-binding portion also include certain engineered or recombinant derivatives (or "derivative antibodies”) that also include one or more fragments of an antibody that retain the ability to specifically bind to an antigen, in addition to elements or sequences that may not be found in naturally existing antibodies.
  • VL and VH are coded for by separate genes, they can be joined, using standard recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see, e.g., Bird et al. Science 242:423-426, 1988: and Huston et al, Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988).
  • scFv single chain Fv
  • the N-terminum of an scFv may be a VH domain ⁇ i.e., N-VH-VL-C), or a VL domain ⁇ i.e., N-VL-VH-C).
  • Divalent (or bivalent) single-chain variable fragments can be engineered by linking two scFvs. This produces a single peptide chain with two VH and two VL regions, yielding a tandem scFvs (tascFv). More tandem repeats, such as tri-scFv, may be similarly produced by linking three or more scFv in a head- to-tail fashion.
  • scFvs may be linked through linker peptides that are too short (about five amino acids) for the two variable regions to fold together, forcing scFvs to dimerize, and form diabodies (see, e.g., Holliger et al., Proc. Natl. Acad. Sci. USA 90:6444-6448, 1993; Poljak et al., Structure 2: 1121-1123, 1994). Diabodies may be bi-specific or monospecific. Diabodies have been shown to have dissociation constants up to 40-fold lower than corresponding scFvs, i.e., having a much higher affinity to the target.
  • Still shorter linkers lead to the formation of trimers, or so-called triabodies or tribodies. Tetrabodies have also been produced similarly. They exhibit an even higher affinity to their targets than diabodies. Diabodies, triabodies, and tetrabodies are sometimes collectively called “AVIBODY " cell binding agents (or “AVIBODY” in short). That is, AVIBODY having two, three, or four Target Binding Regions (TBRs) are commonly known as Dia-, Tria- and Tetrabodies. See, for example, U.S. Publication Nos. 2008/0152586 and 2012/0171115 for details, the entire teachings of which are incorporated herein by reference.
  • TBRs Target Binding Regions
  • each scFv in the tandem scFv or diabody / triabody / tetrabody may have the same or different binding specificity, and each may
  • Single chain Fv (scFv) can also be fused to an Fc moiety, such as the human IgG Fc moiety to obtain IgG-like properties, but nevertheless they are still encoded by a single gene.
  • Fc moiety such as the human IgG Fc moiety to obtain IgG-like properties, but nevertheless they are still encoded by a single gene.
  • transient production of such scFv-Fc proteins in mammalians can easily achieve milligram amounts, this derivative antibody format is particularly suitable for many research applications.
  • Fcabs are antibody fragments engineered from the Fc constant region of an antibody. Fcabs can be expressed as soluble proteins, or they can be engineered back into a full-length antibody, such as IgG, to create mAb2.
  • a mAb2 is a full-length antibody with an Fcab in place of the normal Fc region. With these additional binding sites, mAb2 bispecific monoclonal antibodies can bind two different targets at the same time.
  • the engineered antibody derivatives have reduced size of the antigen-binding Ig-derived recombinant proteins ("miniaturized" full-size mAbs), produced by removing domains deemed non-essential for function.
  • miniaturized full-size mAbs
  • SMIP Small modular immunopharmaceutical
  • a Small modular immunopharmaceutical, or SMIP is an artificial protein largely built from parts of antibodies (immunoglobulins), and is intended for use as a pharmaceutical drug.
  • SMIPs have similar biological half-life as antibodies, but are smaller than antibodies and hence may have better tissue penetration properties.
  • SMIPs are single-chain proteins that comprise one binding region, one hinge region as a connector, and one effector domain.
  • the binding region comprises a modified single- chain variable fragment (scFv), and the rest of the protein can be constructed from the Fc (such as CH2, and CH3 as the effector domain) and the hinge region of an antibody, such as IgGl.
  • scFv modified single- chain variable fragment
  • genetically modified cells produce SMIPs as antibody- like dimers that are about 30% smaller than real antibodies.
  • FIG. 171 Another example of such engineered miniaturized antibody is "unibody,” in which the hinge region has been removed from IgG4 molecules.
  • IgG4 molecules are unstable and can exchange light-heavy chain heterodimers with one another. Deletion of the hinge region prevents heavy chain-heavy chain pairing entirely, leaving highly specific monovalent light / heavy heterodimers, while retaining the Fc region to ensure stability and half-life in vivo.
  • a single-domain antibody (sdAb, including but not limited to those called nanobody by Ablynx) is an antibody fragment consisting of a single monomeric variable antibody domain. Like a whole antibody, it is able to bind selectively to a specific antigen, but is much smaller due to its molecular weight of only 12-15 kDa.
  • the single-domain antibody is engineered from heavy-chain antibodies (he IgG). The first such sdAb was engineered based on an he IgG found in camelids, called V H H fragments.
  • the single-domain antibody is engineered from IgNAR ("immunoglobulin new antigen receptor," see below) using a V NAR fragment.
  • Cartilaginous fishes (such as shark) have such heavy-chain IgNAR antibodies.
  • the sdAb is engineered by splitting the dimeric variable domains from common immunoglobulin G (IgG), such as those from humans or mice, into monomers.
  • IgG immunoglobulin G
  • a nanobody is derived from a heavy chain variable domain.
  • a nanobody is derived from light chain variable domain.
  • the sdAb is obtained by screening libraries of single domain heavy chain sequences (e.g., human single domain HCs) for binders to a target antigen.
  • VNARS single variable new antigen receptor domain antibody fragments
  • IgNARs immunoglobulin new antigen receptor antibodies
  • IgNAR antibodies consist of homodimers of one variable new antigen receptor (V NAR ) domain and five constant new antigen receptor (C NAR ) domains. This molecule is highly stable, and possesses efficient binding characteristics. Its inherent stability can likely be attributed to both (i) the underlying Ig scaffold, which presents a considerable number of charged and hydrophilic surface exposed residues compared to the conventional antibody VH and VL domains found in murine antibodies; and (ii) stabilizing structural features in the complementary determining region (CDR) loops including inter-loop disulphide bridges, and patterns of intra-loop hydrogen bonds.
  • CDR complementary determining region
  • a minibody is an engineered antibody fragment comprising an scFv linked to a CH domain, such as the CH3yl (CH3 domain of IgGl) or CH4s (CH4 domain of IgE).
  • a CH domain such as the CH3yl (CH3 domain of IgGl) or CH4s (CH4 domain of IgE).
  • CEA carcinoembryonic antigen
  • the scFv may have a N-terminal VH or VL.
  • the linkage may be a short peptide (e.g., two amino acid linker, such as ValGlu) that resultes in a non- covalent, hingeless minibody.
  • the linkage may be an IgGl hinge and a GlySer linker peptide that produces a covalent, hinge-minibody.
  • Natural antibodies are mono-specific, but bivalent, in that they express two identical antigen-binding domains.
  • certain engineered antibody derivatives are bi- or multi- specific molecules possess two or more different antigen-binding domains, each with different target specificity.
  • Bispecific antibodies can be generated by fusing two antibody-producing cells, each with distinct specificity. These "quadromas" produced multiple molecular species, as the two distinct light chains and two distinct heavy chains were free to recombine in the quadromas in multiple configurations. Since then, bispecific Fabs, scFvs and full-size mAbs have been generated using a variety of technologies (see above).
  • the dual variable domain immunoglobulin (DVD-Ig) protein is a type of dual- specific IgG that simultaneously target two antigens / epitopes (DiGiammarino et al., Methods Mol Biol. 899: 145-56, 2012).
  • the molecule contains an Fc region and constant regions in a configuration similar to a conventional IgG.
  • the DVD-Ig protein is unique in that each arm of the molecule contains two variable domains (VDs). The VDs within an arm are linked in tandem and can possess different binding specificities.
  • Trispecific antibody derivative molecules can also been generated by, for example, expressing bispecific antibodies with two distinct Fabs and an Fc.
  • One exmaple is a mouse IgG2a anti-Ep-CAM, rat IgG2b anti-CD3 quadroma, called BiUII, which is thought to permit the co-localization of tumor cells expressing Ep-CAM, T cells expressing CD3, and macrophages expressing FCyRI, thus potentiating the costimulatory and anti-tumor functions of the immune cells.
  • Probodies are fully recombinant, masked monoclonal antibodies that remain inert in healthy tissue, but are activated specifically in the disease microenvironment (e.g., through protease cleavage by a protease enriched or specific in a disease microenvironment). See Desnoyers et al., Sci Transl Med 5:207ral44, 2013. Similar masking techniques can be used for any of the antibodies or antigen-binding portions thereof described herein.
  • An intrabody is an antibody that has been modified for intracellular localization, for working within the cell to bind to an intracellular antigen.
  • the intrabody may remain in the cytoplasm, or may have a nuclear localization signal, or may have a KDEL sequence for ER targeting.
  • the intrabody may be a single-chain antibody (scFv), nodified immunoglobulin VL domains with hyperstability, selected antibody resistant to the more reducing intracellular environment, or expressed as a fusion protein with maltose binding protein or other stable intracellular proteins.
  • the antigen-binding portions or derivative antibodies of the invention may have substantially the same or identical (1) light chain and/or heavy chain CDR3 regions; (2) light chain and/or heavy chain CDR1, CDR2, and CDR3 regions; or (3) light chain and/or heavy chain regions, compared to an antibody from which they are derived / engineered. Sequences within these regions may contain conservative amino acid substitutions, including substitutions within the CDR regions. In certain embodiments, there is no more than 1, 2, 3, 4, or 5 conservative substitutions. In an alternative, the antigen-binding portions or derivative antibodies have a light chain region and/or a heavy chain region that is at least about 90%, 95%, 99% or 100% identical to an antibody from which they are derived / engineered.
  • antigen-binding portions or derivative antibodies may have substantially the same binding specificity and/or affinity to the target antigen compared to the antibody.
  • the K d and/or Rvalues of the antigen-binding portions or derivative antibodies are within 10-fold (either higher or lower), 5-fold (either higher or lower), 3-fold (either higher or lower), or 2-fold (either higher or lower) of an antibody described herein.
  • the antigen-binding portions or derivative antibodies may be derived / engineered from fully human antibodies, humanized antibodies, or chimeric antibodies, and may be produced according to any art-recognized methods.
  • Monoclonal antibody techniques allow for the production of extremely specific cell-binding agents in the form of specific monoclonal antibodies.
  • Particularly well known in the art are techniques for creating monoclonal antibodies produced by immunizing mice, rats, hamsters or any other mammal with the antigen of interest such as the intact target cell, antigens isolated from the target cell, whole virus, attenuated whole virus, and viral proteins such as viral coat proteins.
  • Sensitized human cells can also be used.
  • Another method of creating monoclonal antibodies is the use of phage libraries of scFv (single chain variable region), specifically human scFv (see e.g., Griffiths et al, U.S. Patent Nos. 5,885,793 and 5,969,108; McCafferty et al,
  • resurfaced antibodies disclosed in U.S. Patent No. 5,639,641 may also be used, as may chimeric antibodies and humanized antibodies.
  • Cell-binding agent can also be peptides derived from phage display (see, for example, Wang et al, Proc. Natl. Acad. Sci. USA (2011) 108(17), 6909-6914) or peptide library techniques (see, for example, Dane et al, Mol. Cancer. Ther. (2009) 8(5): 1312- 1318).
  • the CBA of the invention also includes an antibody mimetic, such as a DARPin, an affibody, an affilin, an affitin, an anticalin, an avimer, a Fynomer, a Kunitz domain peptide, a monobody, or a nanofitin.
  • an antibody mimetic such as a DARPin, an affibody, an affilin, an affitin, an anticalin, an avimer, a Fynomer, a Kunitz domain peptide, a monobody, or a nanofitin.
  • DARPin and "(designed) ankyrin repeat protein” are used interchangeably to refer to certain genetically engineered antibody mimetic proteins typically exhibiting preferential (sometimes specific) target binding.
  • the target may be protein, carbohydrate, or other chemical entities, and the binding affinity can be quite high.
  • the DARPins may be derived from natural ankyrin repeat-containing proteins, and preferably consist of at least three, usually four or five ankyrin repeat motifs (typically about 33 residues in each ankyrin repeat motif) of these proteins.
  • a DARPin contains about four- or five -repeats, and may have a molecular mass of about 14 or 18 kDa, respectively.
  • Libraries of DARPins with randomized potential target interaction residues with diversities of over 10 12 variants can be generated at the DNA level, for use in selecting DARPins that bind desired targets (e.g., acting as receptor agonists or antagonists, inverse agonists, enzyme inhibitors, or simple target protein binders) with picomolar affinity and specificity, using a variety of technologies such as ribosome display or signal recognition particle (SRP) phage display.
  • desired targets e.g., acting as receptor agonists or antagonists, inverse agonists, enzyme inhibitors, or simple target protein binders
  • SRP signal recognition particle
  • Affibody molecules are small proteins engineered to bind to a large number of target proteins or peptides with high affinity, thus imitating monoclonal antibodies.
  • An Affibody consists of three alpha helices with 58 amino acids and has a molar mass of about 6 kDa. They have been shown to withstand high temperatures (90 °C) or acidic and alkaline conditions (pH 2.5 or pH 11), and binders with an affinity of down to sub-nanomolar range have been obtained from naive library selections, and binders with picomolar affinity have been obtained following affinity maturation.
  • affibodies are conjugated to weak electrophiles for binding to targets covalently.
  • Monobodies are genetically engineered antibody mimetic proteins capable of binding to antigens.
  • monobodies consist of 94 amino acids and have a molecular mass of about 10 kDa. They are based on the structure of human fibronectin, more specifically on its tenth extracellular type III domain, which has a structure similar to antibody variable domains, with seven beta sheets forming a barrel and three exposed loops on each side corresponding to the three complementarity determining regions.
  • Monobodies with specificity for different proteins can be tailored by modifying the loops BC (between the second and third beta sheets) and FG (between the sixth and seventh sheets).
  • a tribody is a self-assembly antibody mimetic designed based on the C-terminal coiled-coil region of mouse and human cartilage matrix protein (CMP), which self- assembles into a parallel trimeric complex. It is a highly stable trimeric targeting ligand created by fusing a specific target-binding moiety with the trimerization domain derived from CMP. The resulting fusion proteins can efficiently self-assemble into a well- defined parallel homotrimer with high stability.
  • SPR Surface plasmon resonance
  • a Centyrin is another antibody mimetic that can be obtained using a library built upon the framework of a consensus FN3 domain sequence (Diem et ah, Protein Eng Des SeL, 2014). This library employs diversified positions within the C-strand, CD-loop, F-strand and FG-loop of the FN3 domain, and high-affinity Centyrin variants can be selected against specific targets.
  • the cell-binding agent is an anti-folate receptor antibody.
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds a human folate receptor 1 (also known as folate receptor alpha (FR-a)).
  • human folate receptor 1 also known as folate receptor alpha (FR-a)
  • FR-a folate receptor alpha
  • human folate receptor 1 also known as folate receptor alpha (FR-a)
  • FOLR1 human folate receptor 1
  • FOLR1, or “folate receptor alpha (FR-a)
  • FOLR1 encompasses "full- length,” unprocessed FOLR1 as well as any form of FOLR1 that results from processing within the cell .
  • the FOLR1 antibody comprises: (a) a heavy chain CDR1 comprising GYFMN (SEQ ID NO: 1); a heavy chain CDR2 comprising
  • RfflPYDGDTFYNQXaaiFXaa 2 Xaa 3 (SEQ ID NO: 2); and a heavy chain CDR3 comprising YDGSRAMDY (SEQ ID NO: 3); and (b) a light chain CDR1 comprising KASQSVSFAGTSLMH (SEQ ID NO: 4); a light chain CDR2 comprising RASNLEA (SEQ ID NO: 5); and a light chain CDR3 comprising QQSREYPYT (SEQ ID NO: 6); wherein Xaai is selected from K, Q, H, and R; Xaa 2 is selected from Q, H, N, and R; and Xaa 3 is selected from G, E, T, S, A, and V.
  • the heavy chain CDR2 sequence comprises RIHPYDGDTFYNQKFQG (SEQ ID NO: 7).
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1 comprising the heavy chain having the amino acid sequence of
  • the anti-folate antibody receptor is a humanized antibody or antigen binding fragment thereof encoded by the plasmid DNA deposited with the ATCC on April 7, 2010 and having ATCC deposit nos. PTA-10772 and PTA- 10773 or 10774.
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1 comprising the light chain having the amino acid sequence of
  • DrVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYR ASNLEAGVPDRFSGSGSKTDFTLNISPVEAEDAATYYCQQSREYPYTFGGGTKL EIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGN SQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG EC (SEQ ID NO: 9); or
  • DrVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYR ASNLEAGVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTFGGGTKL
  • SQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG EC SEQ ID NO: 10).
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1 comprising the heavy chain having the amino acid sequence of SEQ ID NO: 8, and the light chain having the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 10.
  • the antibody comprises the heavy chain having the amino acid sequence of SEQ ID NO: 8 and the light chain having the amino acid sequence of SEQ ID NO: 10 (hu FOLR1).
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof encoded by the plasmid DNA deposited with the ATCC on April 7, 2010 and having ATCC deposit nos. PTA-10772 and PTA- 10773 or 10774.
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1, and comprising a heavy chain variable domain at least about 90%, 95%, 99% or 100% identical to
  • the anti-folated receptor antibody is huMovl9 or M9346A (see, for example, U.S. Patent 8,709,432, U.S. Patent No. 8,557,966, and WO2011106528, all incorporated herein by reference).
  • the cell-binding agent is an anti-EGFR antibody or an antibody fragment thereof.
  • the anti-EGFR antibody is a non- antagonist antibody, including, for example, the antibodies described in
  • the anti- EGFR antibody is a non-functional antibody, for example, humanized ML66 or EGFR- 8. More specifically, the anti-EGFR antibody is huML66.
  • the anti-EGFR antibody comprising the heavy chain having the amino acid sequence of SEQ ID NO: 14, and the light chain having the amino acid sequence of SEQ ID NO: 15.
  • double underlined sequences represent the variable regions (i.e., heavy chain variable region or HCVR, and light chain variable region or LCVR) of the heavy or light chain sequences, while bold sequences represent the CDR regions (i.e., from N-terminal to C-terminal, CDR1, CDR2, and CDR3, respectively, of the heavy chain or light chain sequences).
  • the anti-EGFR antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 14, and/or the light chain CDR1-CDR3 of SEQ ID NO: 15, and preferrably specifically binds EGFR.
  • the anti-EGFR antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 14, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 15, and preferrably specifically binds EGFR.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the anti-EGFR antibody are antibodies described in 8,790,649 and WO 2012/058588, herein incorporated by reference. In one embodiment, the anti-EGFR antibody is huEGFR-7R antiboby.
  • the anti-EGFR antibody comprises an immunoglobulin heavy chain region having the amino acid sequence of
  • SVMHEALHNHYTQKSLSLSPG SEQ ID NO: 16
  • an immunoglobulin light chain region having the amino acid sequence of
  • the anti-EGFR antibody comprises an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 16 and an immunoglobulin light chain region having the amino acid sequence set forth in SEQ ID NO: 17.
  • the anti-EGFR antibody comprises an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 16 and an immunoglobulin light chain region having the amino acid sequence set forth in SEQ ID NO: 18.
  • the anti-EGFR antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 16, and/or the light chain CDR1-CDR3 of SEQ ID NO: 17 or 18, and preferrably specifically binds EGFR.
  • the anti-EGFR antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 16, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 17 or 18, and preferrably specifically binds EGFR.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the cell-binding agent is an anti-CD 19 antibody, such as those described in U.S. Patent No. 8,435,528 and WO2004/103272, hereinin
  • the anti-CD 19 antibody comprises an immunoglobulin heavy chain region having the amino acid sequence of
  • the anti-CD 19 antibody is huB4 antibody.
  • the anti-CD 19 antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 19, and/or the light chain CDR1-CDR3 of SEQ ID NO: 20, and preferrably specifically binds CD19.
  • the anti-CD 19 antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 19, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 20, and preferrably specifically binds CD 19.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the cell-binding agent is an anti-Mucl antibody, such as those described in U.S. Patent No. 7,834,155, WO 2005/009369 and WO
  • the anti-Mucl antibody comprises an immunoglobulin heavy chain region having the amino acid sequence of
  • the anti-Mucl antibody is huDS6 antibody.
  • the anti-Mucl antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 21, and/or the light chain CDR1-CDR3 of SEQ ID NO: 22, and preferrably specifically binds Mucl.
  • the anti-Mucl antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 21, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 22, and preferrably specifically binds Mucl.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the cell-binding agent is an anti-CD33 antibody or fragement thereof, such as the antibodies or fragements thereof described in U.S. Patent Nos. 7,557,189, 7,342,110, 8,119,787 and 8,337,855 and WO2004/043344, herein incorporated by reference.
  • the anti-CD33 antibody is huMy9-6 antibody.
  • the anti-CD33 antibody comprises an immunoglobulin heavy chain region having the amino acid sequence of
  • the anti-CD33 antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 23, and/or the light chain CDR1-CDR3 of SEQ ID NO: 24, and preferrably specifically binds CD33.
  • the anti-CD33 antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 23, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 24, and preferrably specifically binds CD33.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the cell-binding agent is an anti-CD37 antibody or an antibody fragment thereof, such as those described in US Patent No. 8,765,917 and WO 2011/112978 , herein incorporated by reference.
  • the anti-CD37 antibody is huCD37-3 antibody.
  • the anti-CD37 antibody comprises an immunoglobulin light chain region having the amino acid sequence of
  • the anti-CD37 antibody comprises an immunoglobulin light chain region having the amino acid sequcence set forth in SEQ ID NO:25 and an immunoglobulin heavy chain region having the amino acid sequcence set forth in SEQ ID NO:26.
  • the anti-CD37 antibody comprises an
  • immunoglobulin light chain region having the amino acid sequcence set forth in SEQ ID NO:25 and an immunoglobulin heavy chain region having the amino acid sequcence set forth in SEQ ID NO:27.
  • the anti-CD37 antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 26 or 27, and/or the light chain CDR1-CDR3 of SEQ ID NO: 25, and preferrably specifically binds CD37.
  • the anti-CD37 antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 26 or 27, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 25, and preferrably specifically binds CD37.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the anti-CD37 antibody comprises an
  • immunoglobulin light chain region having the amino acid sequence of
  • VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO:28
  • an immunoglobulin heavy chain region having the amino acid sequence of
  • the anti-CD37 antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 29, and/or the light chain CDR1-CDR3 of SEQ ID NO: 28, and preferrably specifically binds CD37.
  • the anti-CD37 antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 29, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 28, and preferrably specifically binds CD37.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the anti-CD37 antibody is huCD37-50 antibody.
  • the present invention also provides cell-binding agent-drug conjugates comprising a cell-binding agent linked to one or more cytotoxic compounds of the present invention via a variety of linkers, including, but not limited to, disulfide linkers, thioether linkers, amide bonded linkers, peptidase-labile linkers, acid-labile linkers, esterase-labile linkers.
  • linkers including, but not limited to, disulfide linkers, thioether linkers, amide bonded linkers, peptidase-labile linkers, acid-labile linkers, esterase-labile linkers.
  • the invention provides a conjugate comprising: a cytotoxic compound and a cell binding agent (CBA), wherein the cytotoxic compound is covalently covalently linked to the CBA, and wherein the cytotoxic compound is represented by structural formulas ( ⁇ ), (IP), (IIP), (IV), (V) or (VP), wherein the variables are as described above.
  • CBA cell binding agent
  • the cytotoxic compound is represented by structural formulas ( ⁇ ), (IP), (IIP), (IV), (V) or (VP), wherein the variables are as described above.
  • the cytotoxic compound is represented by structural formula ( ⁇ ) or a pharmaceutically acceptable salt thereof.
  • -Z P-Z 2 -R x -J' ( ⁇ '), and the others are -H, an linear or branched alkyl having from 1 to 6 carbon atoms, halogen, -OH, (Ci-C6)alkoxy, or -N0 2 .
  • one of L', L" and L'" is represented by formula ( ⁇ '), and the others are -H.
  • L' is represented by formula ( ⁇ ') and L" and L'" are both -H; and the remaining variables are as described above in the first embodiment.
  • R x is a linear, branched or cyclic alkyl having 1 to 6 carbon atoms optionally substituted with halogen, -OH, (Ci-C 3 )alkyl, (Ci-C 3 )alkoxy, halo(Ci-C 3 )alkyl, or a charged substituent or an ionizable group Q; and the remaining variables are as described above in the first embodiment or the 1 st specific embodiment.
  • Q is i) -S0 3 H, -Z'-S0 3 H, -OP0 3 H 2 , -Z'-OP0 3 H 2 , -P0 3 H 2 , -Z'-P0 3 H 2 , -C0 2 H, -Z'-C0 2 H, -NRnRi 2 , or -Z'-NRnRi 2 , or a pharmaceutically acceptable salt thereof; or, ii) -N + Ri 4 Ri 5 Ri6X or -Z'-N + Ri 4 RisRi6X ; Z' is an optionally substituted alkylene, an optionally substituted cycloalkylene or an optionally substituted phenylene; R 14 to Ri 6 are each independently an optionally substituted alkyl; and X " is a pharmaceutically acceptable anion; and the remaining variables are as described above in the 2 nd specific embodiment. More specifically, Q is -S0 3 H or a pharmaceutically acceptable salt thereof
  • L' is represented by the following formula:
  • R a and R b are each independently -H, (Ci-C 3 )alkyl or a charged substituent or an ionizable group Q;
  • n is an integer from 1 to 6;
  • n' is 0 or an integer from 1 to 6;
  • Cy is a cyclic alkyl having 5 or 6 ring carbon atoms optionally substituted with halogen, -OH, (Ci-C 3 )alkyl, (Ci-C 3 )alkoxy, or halo(Ci-C 3 )alkyl; and the remaining variables are as described above in the first embodiment or the 1 st , 2 nd or 3 rd specific embodiment.
  • R a and R are both H; Cy for formulas ( ⁇ 2') and (C2') is cyclohexane; and R5 is H or Me; and the remaining variables are as described above in the 4 th specific embodiment. More specifically, m' in formulas ( ⁇ 2') and (C2') is 0 or 1.
  • L' is represented by the following formula:
  • R a and R b are each independently -H, (Ci-C3)alkyl, or a charged substituent or an ionizable group Q;
  • n is an integer from 1 to 6;
  • Z sl is selected from any one of the following formulas:
  • q is an integer fro 1 to 5; n' is an integer from 2 to 6; U is -H or S0 3 M; M is a pharmaceutically acceptable cation (e.g. , H + , Na + or K + ); and the remaining variables are as described above in the first embodiment or the 1 st , 2 nd , 3 rd or 4 th specific embodiment.
  • the charged substituent or an ionizable group Q is i) -SO 3 H, -Z'-S0 3 H, -OP0 3 H 2 , -Z'-OP0 3 H 2 , -P0 3 H 2 , -Z'-P0 3 H 2 , -C0 2 H, -Z'-C0 2 H, -NRiiRi 2 , or -Z'-NRnRi 2 , or a pharmaceutically acceptable salt thereof; or, ii)
  • Z' is an optionally substituted alkylene, an optionally substituted cycloalkylene or an optionally substituted phenylene;
  • Ri 4 to Ri 6 are each independently an optionally substituted alkyl;
  • X " is a pharmaceutically acceptable anion; and the remaining variables are as described above in the 5 th specific embodiment. More specifically, Q is -S0 3 H or a pharmaceutically acceptable salt thereof.
  • R a and R are both -H and R5 is H or Me; and the remaining variables are as described above in the 5 th specific embodiment.
  • -(CR a R b ) m - is -(CH 2 ) m —C(Me 2 )- and m" is an integer from 1 to 5; the remaining variables are as described above in the 5 th specific
  • P is a peptide containing 2 to 10 amino acid residues; and the remaining variables are as described above in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th or 5 th specific embodiment.
  • P is a peptide containing 2 to 5 amino acid residues; and the remaining variables are as described above in the 6 th specific embodiment.
  • P is selected from Gly-Gly-Gly, Ala-Val, Val-Ala, Val- Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Lle-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu- Ala-Leu, He- Ala-Leu, Val-Ala-Val, Ala-Leu-Ala-Leu, ⁇ -Ala-Leu- Ala-Leu and Gly-Phe- Leu-Gly, Val-Arg, Arg-Val, Arg-Arg, Val-D-Cit, Val-D-Lys, Val-D-Arg, D-Val-Cit, D
  • P is Gly-Gly-Gly, Ala-Val, Ala- Ala, Ala-D-Ala, D-Ala- Ala, and D-Ala-D-Ala; and the remaining variables are as described above in the 6 th specific embodiment.
  • the double line— between N and C represents a double bond; and the remaining variabes are as described above in the first embodiment, or the 1 st , 2 nd , 3 rd , 4 th , 5 th or 6 th specific embodiment.
  • X is -H or an amine protecting group
  • Y is selected from -H, -OR, -OCOR', -SR, -NR'R," an optionally substituted 5- or 6-membered nitrogen-containing heterocycle, -SO 3 H, -S0 2 H and -OSO 3 H; ane the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th or 7 th specific embodiment.
  • Y is selected from -H, -SO 3 M, -OH, -OMe, -OEt or - NHOH, wherein M is -H, Na + or K + ; and the remaining variables are as described above in the 8 th specific embodiment. More specifically, Y is -H, -SO 3 M or -OH.
  • X' is selected from the group consisting of -H, -OH, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, and phenyl; and the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th or 8 th specific embodiment.
  • X' is -H, -OH, (Ci-C 3 )alkyl, halo(Ci-C 3 )alkyl, or phenyl; and the remaining variables are as described above in the 9 th specific
  • X' is -H, -OH or -Me. Even more specifically, X' is -H.
  • Y' is -H, an oxo group, (Ci-C 3 )alkyl or halo(Ci-C 3 )alkyl; and the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th , 8 th or 9 th specific embodiment. More specifically, Y' is -H or oxo. Even more specifically, Y' is -H.
  • R 6 is -OMe; and the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th , 8 th , 9 th , 10 th or 11 th specific embodiment.
  • Ri, R 2 , R 3 , R*, Ri', R 2 ', R 3 ' and R4' are independently -H, halogen, -N0 2 , -OH, (Ci-C 3 )alkyl, halo(Ci-C 3 )alkyl or (Ci-C 3 )alkoxy; and the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th , 8 th , 9 th , 10 th , 11 th or 12 th specific embodiment. More specifically, Ri, R 2 , R 3 , R4, Ri', R 2 ', R 3 ' and R 4 ' are all -H.
  • R, R', R" and R 5 are each independently -H or (C C 3 )alkyl; and the remaining variables are as described in the first embodiment or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th , 8 th , 9 th , 10 th , 11 th , 12 th or 13 th specific embodiment.
  • the double line— between N and C represents a single bond or double bond, provided that when it is a double bond X is absent and Y is -H, and when it is a single bond, X is -H, Y is -OH or -S0 3 M;
  • Ri, R 2 , R 3 , R4, Ri', R 2 ', R 3 ' and R 4 ' are all -H;
  • R 6 is -OMe
  • X' and Y' are both -H;
  • a and A' are -0-;
  • M is H, Na + or K + ; and the remaining variables are as described in the first embodiment orthe 1 st , 2 nd , 3 rd , 4 th , 5 th or 6 th specific embodiment.
  • r is an integer from 1 to 10;
  • Y is -H, -OH or -S0 3 M
  • M is a pharmaceutically acceptable cation (e.g., H + , Na + or K + )
  • Y is -S0 3 M.
  • Y is -OH.
  • the conjugates described herein may comprise 1-10 cytotoxic compounds, 2-9 cytotoxic compounds, 3-8 cytotoxic compounds, 4-7 cytotoxic compounds, or 5-6 cytotoxic compounds, each cytotoxic compound comprising the linking group linking the cytotoxic compound to the CBA, and each cytotoxic compound on the conjugate is the same.
  • the cell-binding agent may bind to target cells selected from tumor cells, virus infected cells, microorganism infected cells, parasite infected cells, autoimmune cells, activated cells, myeloid cells, activated T-cells, B cells, or melanocytes; cells expressing the CD4, CD6, CD 19, CD20, CD22, CD30, CD33, CD37, CD38, CD40, CD44, CD56, EpCAM, CanAg, CALLA, or Her-2 antigens; Her-3 antigens; or cells expressing insulin growth factor receptor, epidermal growth factor receptor, and folate receptor.
  • target cells selected from tumor cells, virus infected cells, microorganism infected cells, parasite infected cells, autoimmune cells, activated cells, myeloid cells, activated T-cells, B cells, or melanocytes
  • the cell-binding agent may be an antibody, a single chain antibody, an antibody fragment that specifically binds to the target cell, a monoclonal antibody, a single chain monoclonal antibody, or a monoclonal antibody fragment that specifically binds to a target cell, a chimeric antibody, a chimeric antibody fragment that specifically binds to the target cell, a domain antibody, a domain antibody fragment that specifically binds to the target cell, a lymphokine, a hormone, a vitamin, a growth factor, a colony stimulating factor, or a nutrient-transport molecule.
  • the antibody may be a resurfaced antibody, a resurfaced single chain antibody, or a resurfaced antibody fragment.
  • the antibody may be a monoclonal antibody, a single chain monoclonal antibody, or a monoclonal antibody fragment thereof.
  • the antibody may be a humanized antibody, a humanized single chain antibody, or a humanized antibody fragment.
  • the cell-binding agent may be an anti-folate receptor antibody or an antibody fragment thereof. More specifically, the anti-folate receptor antibody is huMOV19 antibody.
  • the cell-binding agent may be an anti-EGFR antibody or an antibody fragment thereof.
  • the anti- EGFR antibody is a non-antagonist antibody, including, for example, the antibodies described in WO2012058592, herein incorporated by reference.
  • the anti-EGFR antibody is a non-functional antibody, for example, humanized ML66. More specifically, the anti-EGFR antibody is huML66.
  • the invention further provides a pharmaceutical composition comprising any of the conjugates described herein, and a pharmaceutically acceptable carrier.
  • the invention additional provides a conjugate comprising any of the subject compounds linked to a cell-binding agent.
  • the invention further provides a method of inhibiting abnormal cell growth or treating a proliferative disorder, an autoimmune disorder, destructive bone disorder, infectious disease, viral disease, fibrotic disease, neurodegenerative disorder, pancreatitis or kidney disease in a mammal comprising administering to the mammal a therapeutically effective amount of any of the compounds (with or without any linker group) or conjugates of the invention, and, optionally, a second chemotherapeutic agent.
  • the second chemotherapeutic agent is administered to the mammal sequentially or consecutively.
  • the method is for treating a condition selected from cancer, rheumatoid arthritis, multiple sclerosis, graft versus host disease (GVHD), transplant rejection, lupus, myositis, infection, and immune deficiency.
  • a condition selected from cancer, rheumatoid arthritis, multiple sclerosis, graft versus host disease (GVHD), transplant rejection, lupus, myositis, infection, and immune deficiency.
  • the method or conjugate is for treating a cancer.
  • the cancer is a hematological cancer or a solid tumor. More specifically, the cancer is ovarian cancer, pancreatic cancer, cervical cancer, melanoma, lung cancer (e.g., non small-cell lung cancer (NSCLC)), breast cancer, squamous cell carcinoma of the head and neck, prostate cancer, endometrial cancer, lymphoma (e.g., non-Hodgkin lymphoma), myelodysplasia syndrome (MDS), peritoneal cancer, or leukemia (e.g.
  • NSCLC non small-cell lung cancer
  • MDS myelodysplasia syndrome
  • leukemia e.g.
  • AML acute myeloid leukemia
  • AML acute monocytic leukemia
  • promyelocytic leukemia eosinophilic leukaemia
  • acute lymphoblastic leukemia e.g. , B-ALL
  • chronic lymphocytic leukemia CLL
  • chronic myeloid leukemia CML
  • the cytotoxic compound can comprise a linking moiety with a reactive group bonded thereto, such as compound 14 (Example 1), 23 (Example 2), 35 (Example 3), 49 (Example 4), 80 (Example 5), 90 (Example 6), 63 (Example 7), or 70 (Example 8).
  • a linking moiety with a reactive group bonded thereto such as compound 14 (Example 1), 23 (Example 2), 35 (Example 3), 49 (Example 4), 80 (Example 5), 90 (Example 6), 63 (Example 7), or 70 (Example 8).
  • a bifunctional crosslinking reagent can be first reacted with the cytotoxic compound to provide the compound bearing a linking moiety with one reactive group bonded thereto (i.e. , drug-linker compound), which can then react with a cell binding agent.
  • a linking moiety can contain a chemical bond that allows for the release of the cytotoxic moiety at a particular site.
  • Suitable chemical bonds are well known in the art and include disulfide bonds, thioether bonds, acid labile bonds, photolabile bonds, peptidase labile bonds and esterase labile bonds (see for example US Patents 5,208,020; 5,475,092; 6,441, 163; 6,716,821 ; 6,913,748; 7,276,497; 7,276,499;
  • linkers that can be used in the present invention include non-cleavable linkers, such as those described in are described in detail in U.S.
  • a solution of a cell-binding agent e.g., an antibody
  • a cell-binding agent e.g., an antibody
  • a bifunctional crosslinking agent such as N-succinimidyl-4-(2-pyridyldithio)pentanoate (SPP), N-succinimidyl-4- (2-pyridyldithio)butanoate (SPDB), N-succinimidyl-4-(2-pyridyldithio)2-sulfo butanoate (sulfo-SPDB) to introduce dithiopyridyl groups.
  • SPP N-succinimidyl-4-(2-pyridyldithio)pentanoate
  • SPDB N-succinimidyl-4- (2-pyridyldithio)butanoate
  • sulfo-SPDB N-succinimidyl-4-(2-pyridy
  • modified antibody is then reacted with the thiol-containing cytotoxic compound described herein, such as compound 98 or 99 (Examples 9 and 10), to produce a disulfide-linked cell-binding agent-cytotoxic agent conjugate of the present invention.
  • the thiol-containing cytotoxic compound described herein such as compound 98 or 99 can react with a bifunctional crosslinking agent such as N-succinimidyl-4-(2-pyridyldithio)pentanoate (SPP), N-succinimidyl-4-(2- pyridyldithio)butanoate (SPDB), N-succinimidyl-4-(2-pyridyldithio)2-sulfo butanoate (sulfo-SPDB) to form a cytotoxic agent-linker compound, which can then react wth a cell-biding agent to produce a disulfide-linked cell-binding agent-cytotoxic agent conjugate of the present invention.
  • a bifunctional crosslinking agent such as N-succinimidyl-4-(2-pyridyldithio)pentanoate (SPP), N-succinimidyl-4-(2- pyridy
  • the cytotoxic agent-linker compound can be prepared in situ without purication before reacting with the cell-binding agent. A representative process is described in Examples 12 and 18. Alternatively, the cytotoxic agent-linker compound can be purified prior to reacting with the cell-binding agent.
  • the cell binding agent-cytotoxic agent conjugate may be purified using any purification methods known in the art, such as those described in US Patent No.
  • the cell-binding agent-cytotoxic agent conjugate can be purified using tangential flow filtration, adsorptive chromatography, adsorptive filtration, selective precipitation, non-absorptive filtration or combination thereof.
  • tangential flow filtration also known as cross flow filtration, ultrafiltration and diafiltration
  • adsorptive chromatography resins are used for the purification of the conjugates.
  • the cell-binding agent e.g., an antibody
  • an antibody modifying agent such as 2-iminothiolane, L-homocysteine thiolactone (or derivatives), or N-succinimidyl-S-acetylthioacetate (SATA) to introduce sulfhydryl groups.
  • the modified antibody is then reacted with the appropriate disulfide- containing cytotoxic agent, to produce a disulfide-linked antibody-cytotoxic agent conjugate.
  • the antibody-cytotoxic agent conjugate may then be purified by methods described above.
  • the cell binding agent may also be engineered to introduce thiol moieties, such as cysteine-engineered antibodies disclosed in US Patent Nos. 7,772485 and 7.855,275.
  • a solution of a cell-binding agent e.g., an antibody
  • a cell-binding agent e.g., an antibody
  • a molar excess of an antibody- modifying agent such as N-succinimidyl-4-(N-maleimidomethyl)-cyclohexane-l-carboxylate to introduce maleimido groups, or with N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB) to introduce iodoacetyl groups.
  • an antibody- modifying agent such as N-succinimidyl-4-(N-maleimidomethyl)-cyclohexane-l-carboxylate to introduce maleimido groups
  • N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB) to introduce iodoacetyl groups.
  • the modified cell-binding agent e.g., modified antibody
  • the modified cell-binding agent is then reacted with the thiol-containing cytotoxic agent to produce a thioether-linked cell-binding agent-cytotoxic agent conjugate.
  • the conjugate may then be purified by methods described above.
  • the number of cytotoxic molecules bound per antibody molecule can be determined spectrophotometrically by measuring the ratio of the absorbance at 280 nm and 330 nm.
  • An average of 1-10 cytotoxic compounds/antibody molecule(s) can be linked by the methods described herein.
  • the preferred average number of linked cytotoxic compounds per antibody molecule is 2-5, and the most preferred is 2.5-4.0.
  • the cytotoxic compounds and cell-binding agent-drug conjugates of the invention can be evaluated for their ability to suppress proliferation of various cancer cell lines in vitro.
  • cell lines such as human cervical carcinoma cell line KB, human acute monocytic leukemia cell line THP-1, human promyelocytic leukemia cell line HL60, human acute myeloid leukaemia cell line HNT-34, can be used for the assessment of cytotoxicity of these compounds and conjugates.
  • Cells to be evaluated can be exposed to the compounds or conjugates for 1-5 days and the surviving fractions of cells measured in direct assays by known methods. IC 50 values can then be calculated from the results of the assays.
  • an in vitro cell line sensitivity screen such as the one described by the U.S. National Cancer Institute (see Voskoglou-Nomikos et ah, 2003, Clinical Cancer Res. 9: 42227-4239, incorporated herein by reference) can be used as one of the guides to determine the types of cancers that may be sensitive to treatment with the compounds or conjugates of the invention.
  • FIGs. 2 and 4 Examples of in vitro potency and target specificity of antibody-cytotoxic agent conjugates of the present invention are shown in FIGs. 2 and 4. All of the conjugates are extremely cytotoxic on the antigen positive cancer cells with an IC 50 in the low picomolar range. Antigen negative cell lines remained viable when exposed to the same conjugates.
  • in vivo efficacy of a cell binding agent/cytotoxic agent conjugate was measured.
  • SCID mice bearing NCI-H2110 tumor cells were treated with huMovl9- 80 and huMovl9-90 conjugates and significant tumor regression was observed at multiple doses while untreated mice grew tumors rapidly (FIG. 6).
  • Activity for huMovl9-90 conjugate was observed at doses as low as 5 ⁇ g/kg.
  • the present invention includes a composition (e.g., a pharmaceutical
  • composition comprising novel benzodiazepine compounds described herein (e.g., indolinobenzodiazepine or oxazolidinobenzodiazepine), derivatives thereof, or conjugates thereof, (and/or solvates, hydrates and/or salts thereof) and a carrier (a pharmaceutically acceptable carrier).
  • novel benzodiazepine compounds described herein e.g., indolinobenzodiazepine or oxazolidinobenzodiazepine
  • derivatives thereof or conjugates thereof, (and/or solvates, hydrates and/or salts thereof) and a carrier (a pharmaceutically acceptable carrier)
  • carrier a pharmaceutically acceptable carrier
  • the present compositions are useful for inhibiting abnormal cell growth or treating a proliferative disorder in a mammal (e.g., human).
  • the present compositions are also useful for treating depression, anxiety, stress, phobias, panic, dysphoria, psychiatric disorders, pain, and inflammatory diseases in a mammal (e.g., human).
  • the present invention includes a method of inhibiting abnormal cell growth or treating a proliferative disorder in a mammal (e.g., human) comprising administering to said mammal a therapeutically effective amount of novel benzodiazepine compounds described herein (e.g., indolinobenzodiazepine or oxazolidinobenzodiazepine), derivatives thereof, or conjugates thereof, (and/or solvates and salts thereof) or a composition thereof, alone or in combination with a second therapeutic agent.
  • novel benzodiazepine compounds described herein e.g., indolinobenzodiazepine or oxazolidinobenzodiazepine
  • derivatives thereof or conjugates thereof, (and/or solvates and salts thereof) or a composition thereof, alone or in combination with a second therapeutic agent.
  • the present invention also provides methods of treatment comprising administering to a subject in need of treatment an effective amount of any of the conjugates described above.
  • the present invention provides a method for inducing cell death in selected cell populations comprising contacting target cells or tissue containing target cells with an effective amount of a cytotoxic agent comprising any of the cytotoxic compound-cell-binding agents (e.g., indolinobenzodiazepine or
  • the target cells are cells to which the cell-binding agent can bind.
  • Suitable pharmaceutically acceptable carriers, diluents, and excipients are well known and can be determined by those of ordinary skill in the art as the clinical situation warrants.
  • Suitable carriers, diluents and/or excipients include: (1) Dulbecco's phosphate buffered saline, pH about 7.4, containing or not containing about 1 mg/mL to 25 mg/mL human serum albumin, (2) 0.9% saline (0.9% w/v NaCl), and (3) 5% (w/v) dextrose; and may also contain an antioxidant such as tryptamine and a stabilizing agent such as Tween 20.
  • the method for inducing cell death in selected cell populations can be practiced in vitro, in vivo, or ex vivo.
  • Examples of in vitro uses include treatments of autologous bone marrow prior to their transplant into the same patient in order to kill diseased or malignant cells:
  • graft- versus-host-disease treatments of bone marrow prior to their transplantation in order to kill competent T cells and prevent graft- versus-host-disease (GVHD); treatments of cell cultures in order to kill all cells except for desired variants that do not express the target antigen; or to kill variants that express undesired antigen.
  • Treatment can be carried out as follows. Bone marrow is harvested from the patient or other individual and then incubated in medium containing serum to which is added the cytotoxic agent of the invention, concentrations range from about 10 ⁇ to 1 pM, for about 30 minutes to about 48 hours at about 37 °C. The exact conditions of
  • concentration and time of incubation i.e., the dose, are readily determined by one of ordinary skill in the art.
  • the bone marrow cells are washed with medium containing serum and returned to the patient intravenously according to known methods.
  • the treated marrow cells are stored frozen in liquid nitrogen using standard medical equipment.
  • the cytotoxic agent of the invention will be supplied as a solution or a lyophilized powder that are tested for sterility and for endotoxin levels.
  • suitable protocols of conjugate administration are as follows. Conjugates are given weekly for 4 weeks as an intravenous bolus each week. Bolus doses are given in 50 to 1000 mL of normal saline to which 5 to 10 mL of human serum albumin can be added. Dosages will be 10 ⁇ g to 2000 mg per administration, intravenously (range of 100 ng to 20 mg/kg per day). After four weeks of treatment, the patient can continue to receive treatment on a weekly basis. Specific clinical protocols with regard to route of administration, excipients, diluents, dosages, times, etc., can be determined by one of ordinary skill in the art as the clinical situation warrants.
  • Examples of medical conditions that can be treated according to the in vivo or ex vivo methods of inducing cell death in selected cell populations include malignancy of any type including, for example, cancer, autoimmune diseases, such as systemic lupus, rheumatoid arthritis, and multiple sclerosis; graft rejections, such as renal transplant rejection, liver transplant rejection, lung transplant rejection, cardiac transplant rejection, and bone marrow transplant rejection; graft versus host disease; viral infections, such as CMV infection, HIV infection, AIDS, etc.; and parasite infections, such as giardiasis, amoebiasis, schistosomiasis, and others as determined by one of ordinary skill in the art.
  • autoimmune diseases such as systemic lupus, rheumatoid arthritis, and multiple sclerosis
  • graft rejections such as renal transplant rejection, liver transplant rejection, lung transplant rejection, cardiac transplant rejection, and bone marrow transplant rejection
  • graft versus host disease graft versus host disease
  • PDR Physician's Desk Reference
  • the PDR discloses dosages of the agents that have been used in treatment of various cancers.
  • the dosing regimen and dosages of these aforementioned chemotherapeutic drugs that are therapeutically effective will depend on the particular cancer being treated, the extent of the disease and other factors familiar to the physician of skill in the art and can be determined by the physician.
  • the contents of the PDR are expressly incorporated herein in its entirety by reference.
  • One of skill in the art can review the PDR, using one or more of the following parameters, to determine dosing regimen and dosages of the chemotherapeutic agents and conjugates that can be used in accordance with the teachings of this invention. These parameters include:
  • cytotoxic agents [302]
  • each of the cytotoxic agents described herein can be modified in such a manner that the resulting compound still retains the specificity and/or activity of the starting compound.
  • the skilled artisan will also understand that many of these compounds can be used in place of the cytotoxic agents described herein.
  • the cytotoxic agents of the present invention include analogues and derivatives of the compounds described herein.
  • DIBAL diisobutylaluminum hydride
  • DIPEA N,N-diisopropylethylamine
  • EDC l-ethyl-3-(3-dimethylaminopropyl)carbodiimide
  • EEDQ N-Ethoxycarbonyl-2-ethoxy-l,2-dihydroquinoline
  • HATU N,N,N'N'-tetramethyl-0-(7-azabenzotriazol-l-yl)uronium
  • LAH lithium aluminum hydride
  • MsCl methanesulfonyl chloride (mesyl chloride)
  • NaBH(OAc) 3 sodium triacetoxyborohydride
  • TBSC1 or TBDMSC1 te/t-butyldimethylsilyl chloride
  • TCEP HC1 in ' 5'(2-carboxyethyl)phosphine hydrochloride salt
  • Step 1 Z-Gly-Gly-OH compound 1 (5.0 g, 18.78 mmol) and H-Gly-Oi-Bu HCl compound 2 (3.46 g, 20.66 mmol) were dissolved in DMF (37.6 mL). EDC-HCl (3.96 g, 20.66 mmol) and HOBt (2.88 g, 18.78 mmol) were added to the reaction flask, followed by DIPEA (8.18 mL, 46.9 mmol). The reaction was stirred at rt under Ar overnight.
  • the reaction mixture was diluted with CH 2 CI 2 , washed with sat'd NH 4 CI, sat'd NaHC0 3 , followed by water and brine. The organic layer was dried over Na 2 S0 4 , filtered and concentrated. The crude product was purified by silica gel flash chromatography (MeOH/DCM, gradient, 0% to 5%) to yield pure compound 3 as a white solid (6.35 g, 89% yield).
  • Step 2 Compound 3 (6.3 g, 16.60 mmol) was dissovled in MeOH (52.7 mL) and water (2.64 mL). The reaction mixture was purged with Ar and was degassed for 5 min. Pd/C (wet, 10%) (0.884 g, 0.830 mmol) was slowly added. Then bubbled in H 2 from a balloon for 1 min. The reaction was stirred under a balloon of H 2 at rt overnight. The reaction mixrure was filtered through Celite and the filter cake was washed with MeOH (30 mL) and was concentrated. CH 3 CN (20 mL) was added to the residue and was concentrated. This was repeated 2 more times to obtain a sticky solid.
  • Step 3 Amine compound 4 (1.0 g, 4.08 mmol) and mono methyladipate (664 ⁇ , 4.48 mmol) were dissolved in DMF (13.59 mL). EDC HC1 (860 mg, 4.48 mmol) and HOBt
  • Step 4 Compound 5 (1.5 g, 3.87 mmol) was stirred in TFA (5.97 mL, 77.0 mmol) and deionized water (300 ⁇ ) at rt overnight. CH 3 CN (10 mL) was added to the reaction mixture and was stirred for 5 min. The mixture became thick with lots of white precipitate. More CH 3 CN (30 mL) was added and was further stirred for 5 min. The mixture was filtered and dried under vacuum/N 2 for 1 h to obtain pure compound 6 as a white solid (0.7 g, 55% yield).
  • Step 5 Aniline compound 7 (100 mg, 0.653 mmol) and acid compound 6
  • Step 6 Diol compound 8 (260 mg, 0.557 mmol) and carbontetrabromide (555 mg, 1.672 mmol) were dissolved in DMF (5.57 mL). Triphenylphosphine (439 mg, 1.672 mmol) was added and the brown mixture was stirred under Ar at rt for 4 h. The reaction mixture was diluted with DCM/MeOH (10: 1, 30 mL) and was washed with water and brine. The organic layer was dried over Na 2 S0 4 , filtered and concentrated. The crude residue was purified by silica gel flash chromatography (MeOH/DCM, 0% to 10%, gradient) to obtain compound 9 as a yellow solid.
  • Step 8 Diimine compound 11 (140 mg, 0.11 mmol) was dissolved in
  • Step 9 Methylester compound 12 (33 mg, 0.029 mmol) was dissolved in THF (1.09 mL) and water (364 ⁇ ). LiOH (6.97 mg, 0.291 mmol) was added and the reaction was stirred at rt for 1.5 h. The reaction mixture was diluted with H 2 0 (5 mL) and acidified with 0.5 M aq HC1 until pH ⁇ 4. The aqueous layer was extracted with CH_ 2 Cl 2 /MeOH (3: 1, 3 x 20 mL). The combined organic layers were dried over Na 2 S0 4 , filtered and concentrated to obtain crude compound 13 as a yellow solid (29 mg, 99%
  • Step 10 EDC-HC1 (22.08 mg, 0.115 mmol) was added to a stirred solution of acid compound 13 (29 mg, 0.023 mmol) and N-hydroxysuccinamide (21.21 mg, 0.184 mmol) in CH 2 C1 2 (2.3 mL) at rt. The reaction mixture was stirred for 2 h. The reaction mixture was diluted with CH 2 C1 2 and was washed with water (1 x 15 mL) and brine (1 x 15 mL). The organic layer was dried over Na 2 S0 4 , filtered and concentrated. The crude product was purified by RPHPLC (CI 8 column, CH 3 CN/H 2 0, gradient, 35% to 55%).
  • Step 1 Amine compound 4 (200 mg, 0.815 mmol) and 1,4-trans- cyclohexanedicarboxlic acid monomethylester compound 15 (182 mg, 0.978 mmol) were dissolved in DMF (2.72 mL). EDC-HC1 (188 mg, 0.978 mmol) and HOBt (125 mg, 0.815 mmol) were added to the reaction mixture, followed by DIEA (285 ⁇ , 1.631 mmol). The mixture was stirred at rt overnight. The reaction mixture was diluted with CH 2 CI 2 and washed with sat'd NH 4 CI, sat'd NaHC0 3 , brine, and water.
  • Step 2 TFA (1.40 mL, 18.14 mmol) and DI water (67.8 ⁇ .) were added to neat compound 16 (300 mg, 0.726 mmol) at rt and was stirred for 3 h. CH 3 CN (20 mL) was added to the reaction mixture and was concentrated. This was repeated this two more times to obtain compound 17 as a white solid (230 mg, 89% yield).
  • Step 5 Compound 20 was prepared similarly as compound 11 in Example 1. Compound 20 was obtained as a yellow solid after purification (264 mg, 60% yield).
  • Step 7 Methylester compound 21 (48 mg, 0.046 mmol) was dissolved in 1,2-dichloroethane (3.06 mL). Trimethylstannanol (124 mg, 0.688 mmol) was added to the reaction mixture and was heated at 80 °C overnight. The reaction mixture was cooled to rt and was diluted with water (15 mL). The aqueous layer was acidified to pH ⁇ 4 with 1 M HC1. The mixture was extracted with CH 2 Cl 2 /MeOH (10: 1, 3 x 20 mL). The combined organic layers were washed with brine and was dried over Na 2 S0 4 and concentrated.
  • Step 8 Compound 23 was prepared similarly as compound 13 in Example 1. (lr,4r)-2,5-dioxopyrrolidin-l-yl 4-((2-((2-((2-((3-((((S)-8-methoxy-6-oxo-l l,12,12a,13- tetrahydro-6H-benzo[5,6][l,4]diazepino[l,2-a]indol-9-yl)oxy)methyl)-5-((((S)-8- methoxy-6-oxo-12a,13-dihydro-6H-benzo[5,6][l,4]diazepino[l,2-a]indol-9- yl)oxy)methyl)phenyl)amino)-2-oxoethyl) amino)-2-oxoethyl)amino)-2- oxoethyl)carbamoyl)cyclohexan
  • Step 1 Z-Val-OH compound 24 (3.0 g, 11.94 mmol) and L-Ala-OiBu compound25 (1.907 g, 13.13 mmol) were dissolved in DMF (23.88 mL). EDC HC1 (2.52 g, 13.13 mmol) and HOBt (2.011 g, 13.13 mmol) were added to the reaction mixture, followed by DIEA (4.59 mL, 26.3 mmol). The reaction was stirred reaction at rt overnight under Ar. The reaction mixture was diluted with CH 2 C1 2 and was washed with sat'd NaHC0 3 , sat'd NH 4 C1, water and brine. The organic layer was dried over Na 2 S0 4 , filtered and concentrated. The crude residue was purified by silica gel flash
  • Step 2 Compound 26 (3.68 g, 9.72 mmol) was dissovled in MeOH (30.9 mL) and water (1.543 mL). The solution was purged with Ar and was degassed for 5 min. Pd/C (10%, wet, 0.517 g) was added slowly to the reaction mixture. H 2 was then bubbled in for a minute. Bubbling was discontinued and the reaction was then stirred under a H 2 balloon overnight. The reaction mixture was filtered through Celite and the filter cake was washed with MeOH (30 mL) and was concentrated to obtain compound 27 as a white solid (2.35 g, 99% yield).
  • Step 3 Amine compound 27 (2.35 g, 9.62 mmol) and mono methyladipate (1.69 g, 10.58 mmol) were dissolved in DMF (32.1 mL). EDC HC1 (1.94 g, 10.10 mmol) and HOBt (1.47 g, 9.62 mmol) were added to the reaction mixture, followed by DIEA (3.36 mL, 19.24 mmol). The reaction was stirred at rt overnight. The reaction mixture was diluted with DCM/MeOH (20 mL, 5: 1) and was washed with sat'd NH 4 C1, sat'd NaHC0 3 , water and brine. The organic layer was dried over Na 2 S0 4 , filtered and concentrated. The crude product was purified by silica gel flash chromatogaphy
  • Step 4 TFA (8.28 niL, 108.0 mmol) and water (0.56 mL) were added to neat compound 28 (2.77 g, 7.17 mmol) at rt and was stirred for 2.5 h. CH 3 CN (30 mL) was added to the reaction mixture and was concentrated. This was repeated 2 more times to obtain compound 29 as a pale yellow solid (2.0 g, 84% yield).
  • Step 6 Diol compound 30 (150 mg, 0.322 mmol) and CBr 4 (321 mg, 0.967 mmol) were dissolved in DMF (3222 ⁇ ). PPh 3 (254 mg, 0.967 mmol) was added to the reaction mixture, at which point the reaction turned red-pink with a slight exotherm. The reaction was stirred under Ar for 4 h. The reaction mixture was diluted with CH 2 C1 2 and was washed with water and brine. The organic layer was dried over Na 2 S0 4 and concentrated. The crude residue was purified by silica gel flash chromatography (EtOAc/hexanes, gradient, 0% to 100%) to obtain compound 31 as an off white solid (473 mg, 75% yield).
  • Step 8 Compound 33 was prepared similarly as compound 12 in Example 1. Compound 33 was obtained as a white solid after C18 purificaiton (40 mg, 31% yield).
  • Step 10 Compound 35 was prepared similarly as compound 14 in Example 1. 2,5-dioxopyrrolidin-l-yl 6-(((S)-l-(((S)-l-((3-((((S)-8-methoxy-6-oxo-l l,12, 12a,13- tetrahydro-6H-benzo[5,6][l,4]diazepino[l,2-a]indol-9-yl)oxy)methyl)-5-((((S)-8- methoxy-6-oxo-12a,13-dihydro-6H-benzo[5,6][l,4]diazepino[l,2-a]indol-9- yl)oxy)methyl) phenyl)amino)-l-oxopropan-2-yl)amino)-3-methyl-l-oxobutan-2- yl)amino)-6-oxohexanoate,
  • Step 1 (5-amino-l,3-phenylene)dimethanol compound 7 (5.0 g, 32.6 mmol) was dissolved in THF (65.3 mL). TBSC1 (12.30 g, 82 mmol) and imidazole (6.67 g, 98 mmol) were added and was stirred at rt overnight under Ar. The reaction mixture was diluted with EtOAc and was washed with sat'd NH 4 C1 and brine, dried aover Na 2 S0 4 nd concentrated. The crude residue was purified by silica gel flash chromatography (EtOAc/hexanes, gradient, 0% to 30%) to obtain compound 37 as a yellow oil (13 g, 100% yield). 1H NMR (400 MHz, CDC1 3 ): ⁇ 6.71 (s, 1H), 6.60 (s, 2H), 4.65 (s, 4H), 0.94 (s, 18
  • Step 2 CS 2 CO 3 (8.54 g, 26.2 mmol) was added to a stirred solution of aniline compound 37 (10 g, 26.2 mmol) in DMF (52.4 mL). Methyliodide (1.474 mL, 23.58 mmol) was added and the reaction was stirred at rt for 3 h. Water (10 mL) and EtOAc (30 mL) were added to the reaction mixture. The layers were separated and was extracted with EtOAc (2x). The organic layers were washed with water (4x), dried over Na 2 S0 4 , filtered and concentrated.
  • Step 3 Aniline compound 38 (1.0 g, 2.53 mmol) and Z-Gly-OH (0.582 g, 2.78 mmol) were dissolved in DMF (8.42 mL). EDC HC1 (1.21 g, 6.32 mmol) and DMAP (340 mg, 2.78 mmol) were added to the reaction mixture and was heated at 80 °C overnight. The reaction mixture was diluted with EtOAc and was washed sat'd NaHC0 3 and water (2x), dried over Na 2 S0 4 , filtered and concentrated.
  • Step 4 Compound 39 (1.26 g, 2.147 mmol) was dissolved in MeOH (6.82 mL) and THF (6.8 mL) and the solution was purged with N 2 . Pd/C (10%, 0.228 g, 0.215 mmol) was added and H 2 was bubbled in for a few minutes. The reaction was stirred under H 2 balloon overnight. The reaction mixture was filtered through Celite and was wased with MeOH and concentrated to give pure compound 40 (1 g, 100% yield).
  • Step 5 Amine compound 40 (1.0 g, 1.988 mmol) and Z-Gly-Gly-Gly-OH (662 mg, 2.385 mmol) were dissolved in DMF (6.63 mL). EDC HC1 (457 mg, 2.385 mmol) and HOBT (304 mg, 1.988 mmol) were added to the reaction mixture, followed by DIEA (694 ⁇ , 3.98 mmol). The reaction was stirred at rt overnight. The reaction mixture was diluted with EtOAc and was washed with sat'd NaHC0 3 , brine and water (2x). The organic layer was dried over Na 2 S0 4 , filtered and concentrated.
  • Step 7 Amine compound 42 (725 mg, 1.279 mmol) and mono methyladipate (246 mg, 1.535 mmol) were dissolved in DMF (6.5 mL). EDC HC1 (294 mg, 1.535 mmol) and HOBt (196 mg, 1.279 mmol) were added to the reaction mixture, followed by DIEA (447 ⁇ , 2.56 mmol). The reaction was stirred at rt overnight. The reaction mixture was diluted with DCM (20 mL) and was washed with sat'd NH 4 C1, sat'd NaHC0 3 , water and brine. The organic layer was dried over Na 2 S0 4 , filtered and concentrated. The crude product was purified by silica gel flash chromatogaphy
  • Step 9 Diol compound 44 (110 mg, 0.229 mmol) and CBr 4 (228 mg, 0.687 mmol) were dissolved in DMF (2.29 mL). PPh 3 (180 mg, 0.687 mmol) was added to the reaction mixture, at which point the reaction turned red-pink with a slight exotherm. The reaction was stirred under Ar for 6 h. The reaction mixture was diluted with
  • Step 1 (S)-2-(((benzyloxy)carbonyl)amino)propanoic acid (5 g, 22.40 mmol) and (R)- tert-butyl 2-aminopropanoate hydrochloride (4.48 g, 24.64 mmol) were dissolved in anhydrous DMF (44.8 ml). EDC HC1 (4.72 g, 24.64 mmol), HOBt (3.43 g, 22.40 mmol), and then DIPEA (9.75 ml, 56.0 mmol) were added. The reaction was stirred under argon at room temperature, overnight.
  • Step 2 Compound 71 (5.6 g, 15.98 mmol) was dissolved in methanol (50.7 mL) and water (2.54 mL). The solution was purged with argon for five minutes. Palladium on carbon (wet, 10%) (0.850 g, 0.799 mmol) was added slowly. The reaction was stirred overnight under an atmosphere of hydrogen. The solution was filtered through Celite, rinsed with methanol and concentrated. The residue was azeotroped with methanol and acetonitrile and the resulting oil was placed directly on the high vacuum to give compound 72 (3.57 g, 100% yield) which was used directly in the next step.
  • Step 3 Compound 72 (3.57 g, 16.51 mmol) and mono methyladipate (2.69 mL, 18.16 mmol) were dissolved in anhydrous DMF (55.0 mL). EDC HC1 (3.48 g, 18.16 mmol) and HOBt ( (2.53 g, 16.51 mmol) were added, followed by DIPEA (5.77 mL, 33.0 mmol). The mixture was stirred overnight at room temperature. The reaction was diluted with dichloromethane/methanol (80 mL, 5: 1) and washed with saturated ammonium chloride, saturated sodium bicarbonate, and brine. It was dried over sodium sulfate, filtered and stripped.
  • Step 4 Compound 73 (5.91 g, 16.5 mmol) was stirred in TFA (25.4 mL, 330 mmol) and deionized water (1.3 mL) at room temperature for three hours. The reaction mixture was concentrated with acetonitrile and placed on high vacuum to dryness to give crude compound 74 (4.99 g, 100% yield).
  • Step 5 Compound 74 (4.8 g, 15.88 mmol) was dissovled in anhydrous dichloromethane (101 mL) and anhydrous methanol (50.4 mL). (5-amino-l,3- phenylene)dimethanol (2.316 g, 15.12 mmol) and EEDQ (7.48 g, 30.2 mmol) were added and the reaction was stirred at room temperature, overnight. The solvent was stripped and the crude material purified by silica gel chromatography
  • Step 6 Compound 75 (0.486 g, 1.111 mmol) and carbon tetrabromide (1.105 g, 3.33 mmol) were dissolved in anhydrous DMF (11.11 mL). Triphenylphosphine (0.874 g, 3.33 mmol) was added and the reaction stirred under argon for four hours. The reaction mixture was diluted with DCM/MeOH (10: 1) and washed with water and brine. It was dried over sodium sulfate, filtered, and concentrated.
  • Step 9 Compound 78 was prepared similarly as 22 in Example 2. The crude material was passed through a silica plug to give compound 79 (38 mg, 55% yield, 75%
  • Step 10 Compound 80 was prepared similarly as compound 14 in Example 1. The crude material was purified via RPHPLC (CI 8 column, Acetonitrile/Water) to give 2,5-dioxopyrrolidin- 1-yl 6-(((S)-l -(((R)- 1 -((3-((((S)-8-methoxy-6-oxo- 11 , 12, 12a, 13- tetrahydro-6H-benzo[5,6][l,4]diazepino[l,2-a]indol-9-yl)oxy)methyl)-5-(((R)-8- methoxy-6-oxo-12a,13-dihydro-6H-benzo[5,6][l,4]diazepino[l,2-a]indol-9- yl)oxy)methyl) phenyl)amino)-l-oxopropan-2-yl)amino)-l-oxopropan
  • Step 2 Compound 81 (6.7 g, 19.12 mmol) was dissolved in methanol (60.7 mL) and water (3.03 mL). The solution was purged with argon for five minutes. Palladium on carbon (wet, 10%) (1.017 g, 0.956 mmol) was added slowly. The reaction was stirred overnight under an atmosphere of hydrogen. The solution was filtered through Celite, rinsed with methanol and concentrated. It was azeotroped with methanol and acetonitrile and the resulting oil was placed directly on the high vacuum to give compound 82 (4.02 g, 97% yield) which was used directly in the next step.
  • Step 3 Compound 82 (4.02 g, 18.59 mmol) and mono methyladipate (3.03 mL, 20.45 mmol) were dissolved in anhydrous DMF (62.0 mL). EDC HC1 (3.92 g, 20.45 mmol), HOBt (2.85 g, 18.59 mmol) and DIPEA (6.49 mL, 37.2 mmol) were added. The mixture was stirred overnight at room temperature. The reaction was diluted with dichloromethane/methanol (150 mL, 5: 1) and washed with saturated ammonium chloride, saturated sodium bicarbonate, and brine. It was dried over sodium sulfate, filtered and stripped.
  • Step 4 Compound 83 (5.91 g, 16.5 mmol) was stirred in TFA (28.6 mL, 372 mmol) and deionized water (1.5 mL) at room temperature for three hours. The reaction mixture was concentrated with acetonitrile and placed on high vacuum to give crude compound 84 as a sticky solid (5.88 g, 100% yield).
  • Step 5 Compound 84 (5.6 g, 18.52 mmol) was dissovled in anhydrous dichloromethane (118 mL) and anhydrous methanol (58.8 mL). (5-amino-l,3- phenylene)dimethanol (2.70 g, 17.64 mmol) and EEDQ (8.72 g, 35.3 mmol) were added and the reaction was stirred at room temperature, overnight. The solvent was stripped and ethyl acetate was added. The resulting slurry was filtered, washed with ethyl acetate and dried under vacuum/N2 to give compound 85 (2.79 g, 36% yield).
  • Step 6 Compound 85 (0.52 g, 1.189 mmol) and carbon tetrabromide (1.183 g, 3.57 mmol) were dissolved in anhydrous DMF (11.89 mL). Triphenylphosphine (0.935 g, 3.57 mmol) was added and the reaction stirred under argon for four hours. The reaction mixture was diluted with DCM/MeOH (10: 1) and washed with water and brine, dried over sodium sulfate, filtered, and concentrated. The crude material was purified by silica gel chromatography (DCM/MeOH) to give compound 86 (262 mg, 39% yield).
  • DCM/MeOH silica gel chromatography
  • Step 7 Compound 87 was prepared similarly as compound 11 in Example 1. The crude material was purified by silica gel chromatography
  • Step 9 Compound 88 was prepared similarly as 22 in Example 2. The crude material was passed through a silica plug to give compound 89 (48.8 mg, 80% yield).
  • Step 10 Compound 90 was prepared similarly as 14 in Example 1. The crude material was purified via RPHPLC (CI 8 column, Acetonitrile/Water) to give 2,5- dioxopyrrolidin-l-yl 6-(((S)-l-(((S)-l-((3-((((S)-8-methoxy-6-oxo-l l,12,12a,13- tetrahydro-6H-benzo[5,6][l,4]diazepino[l,2-a]indol-9-yl)oxy)methyl)-5-((((R)-8- methoxy-6-oxo-12a,13-dihydro-6H-benzo[5,6][l,4]diazepino[l,2-a]indol-9- yl)oxy)methyl) phenyl)amino)-l-oxopropan-2-yl)amino) -l-oxopropan
  • Step 2 Compound 51 (876 mg, 2.145 mmol) was dissovled in MeOH (20.4 mL) and water (1.02 mL) and was purged with Ar. The solution was degassed for 5 min. Pd/C (10%, wet with 50% water, 228 mg) was added slowly. H 2 was bubbled into the through a balloon for a minute. The reaction was stirred under a H 2 balloon overnight. H 2 0 ( ⁇ 3 mL) was added to reaction mixture to dissolve all white solids formed. The solution was then filtered through Celite and the filter cake was washed with MeOH (30 mL) and concentrated. The residue was dissolved in CH 3 CN (20 mL) and was concentrated. This was repeated 2 more times.
  • Step 3 NaOH (1.665 g, 41.6 mmol) was added to a stirreed solution of trimethyl benzene- 1, 3, 5-tricarboxylate compound 53 (5 g, 19.82 mmol) in MeOH (66.1 mL) and water (13.22 mL). The reaction mixture was refuxed under Ar for 3 h. Lots of white precipitate had formed. The solution was cooled to rt and was diluted with H 2 0 until all solids were dissolved. The mixture was acidified to pH ⁇ 2-3 with aqueous 5 N HC1, extracted with EtOAc (3x), dried over Na 2 S0 4 , filtered and concentrated.
  • Step 4 Diacid compound 54 (1.0 g, 4.46 mmol) was dissolved in THF (17.84 mL). The solution was cooled to 0 °C and BH 3 DMS (2 M in THF) (8.92 mL, 17.84 mmol) was added slowly under Ar. The reaction was stirred at 0 °C for 5 min, then was warmed to rt and stirred overnight. The reaction was opened to air and was slowly quenched with MeOH, followed by slow addition of H 2 0 until no gas evolution was observed. The mixture was extracted with EtOAc (2x) and the layers were separated. The organic layers were washed with aqueous - 3% H 2 0 2 , aq.
  • Step 5 Diol compound 55 (320 mg, 1.631 mmol) was dissolved in DCM
  • Step 6 Dimesylate compound 56 (435 mg, 1.11 mmol) was dissolved in DMF (5.55 mL). IGN monomer compound 10 (719 mg, 2.444 mmol) was added, followed by and K 2 C0 3 (384 mg, 2.78 mmol) and was stirred at rt under Ar overnight. Water (20 mL) was added to precipitate out the product. The slurry was stirred for 5 min, filtered and dried under vacuum/N 2 for 1.5 h. The crude residue was purified by silica gel flash chromatography (EtOAc/hexanes, gradient, 50% to 100%; then 5%
  • Step 9 Compound 61 was prepared similarly as compound 12 in Example 1. Compound 61 was obtained as a white solid after C18 purificaiton (8 mg, 25% yield).
  • Step 1 Z-L-Ala-L-Ala-OH compound 64 (3.0 g, 10.19 mmol) and ⁇ -alanine methylester-HCl (1.565 g, 11.21 mmol) were dissolved in DMF (20.39 mL). EDC-HCl (2.150 g, 11.21 mmol) and HOBt (1.561 g, 10.19 mmol) were added, followed by DIPEA (4.44 mL, 25.5 mmol). The reaction was stirred rt under Ar overnight. The reaction mixture was diluted with EtOAc and was washed with sat'd NH 4 C1, sat'd NaHC0 3 and brine.
  • Step 2 Compound 65 (1.0 g, 2.64 mmol) was dissovled in methanol (12.55 mL), water (0.628 mL) and THF (2 mL). The solution was purged with Ar and then was degassed for 5 min. Pd/C (10%, wet with 50% water, 0.140 g) was added slowly. H 2 was bubbled into the solution for a minute and the reaction was further stirred under a H 2 balloon (1 atm) overnight. The reaction mixture was filtered through Celite and was washed with MeOH (30 mL) and concentrated. CH 3 CN (15 mL) was added to the residue and was concentrated.
  • Step 3 Compound 67 was prepared similarly as 60 in Example 7. Compound 67 was obtained as a yellow solid after silica gel flash chromatography (69 mg, 53% yield).
  • Step 4 Compound68 was prepared similarly as compound 12 in Example 1.
  • Step 1 Compound 4 (2.0 g, 8.15 mmol) and 4-methyl-4-(methyldisulfanyl)pentanoic acid (1.743 g, 8.97 mmol) were dissolved in anhydrous DMF (27.2 mL). EDC HC1 (1.719 g, 8.97 mmol) and HOBt (1.249 g, 8.15 mmol) were added, followed by DIPEA (2.85 mL, 16.31 mmol). The mixture was stirred at room temperature overnight. The reaction was diluted with dichloromethane/methanol (5: 1) and washed with saturated ammonium chloride, saturated sodium bicarbonate, and brine. It was dried over sodium sulfate, filtered and stripped.
  • Step 2 Compound 91 (3.44 g, 8.15 mmol) was stirred in TFA (12.56 mL, 163 mmol) and deionized water (0.65mL) at room temperature for 3.5 hours. The reaction was diluted with acetonitrile and evaporated to dryness. The crude solid was slurried with with ethyl acetate, filtered and rinsed with ethyl acetate and then dichloromethane/methanol (1: 1) to give compound 92 (2.98 g, 100% yield).
  • Step 3 Compound 92 (1.74 g, 4.76 mmol) was dissovled in dichloromethane (30.2 mL) and methanol (15.11 mL). N-Ethoxycarbonyl-2-ethoxy-l,2-dihdroquinoline (2.243 g, 9.07 mmol) and (5-amino-l,3-phenylene)dimethanol (0.695 g, 4.53 mmol) were added and the reaction was stirred at room temoerature overnight. The solvent was removed and ethyl acetate was added. The solid was filtered through Celite and washed with ethyl acetate and then methanol.
  • Step 4 Compound 93 (305 mg, 0.609 mmol) was suspended in anhydrous DCM (5.992 mL). Anhydrous DMF was added until the solution became homogeneous (-2.5 mL). The solution was cooled to - 10°C in an acetone/dry ice bath. Triethylamine (0.425 mL, 3.05 mmol) was added, followed by methanesulfonic anhydride (274 mg, 1.523 mmol). The mixture stirred at - 10°C for 1 hour. The reaction was quenched with ice water and extracted with cold ethyl acetate/methanol (20: 1). The organic layer was washed with ice water and dried over anhydrous sodium sulfate, filtered and
  • Step 6 Compound 95 (445 mg, 0.423 mmol) was dissolved in 1,2- dichloroethane (2.82 mL). Sodium triacytoxyborohydride (80 mg, 0.359 mmol) was added at room temperature and was stirred for 1 hour. The reaction was diluted with dichloromethane and washed with saturated ammonium chloride. The organic layer was washed with brine and dried to give of a mixture of compound 95, 96, and 96a (496 mg). This crude mixture was dissolved in 2-Propanol (39.17 mL) and water (19.59 mL). Sodium bisulfite (245 mg, 2.35 mmol) was added and was stirred at room tempurature for 3.5 hours.
  • TCEP HC1 46.7 mg
  • the conjugate was purified and buffer exchanged into 250 mM Glycine, 10 mM Histidine, 1% sucrose, 0.01% Tween-20, 50 ⁇ sodium bisulfite formulation buffer pH 6.2 using NAP desalting columns (Illustra Sephadex G-25 DNA Grade, GE Healthcare). Dialysis was performed in the same buffer for 20 hours at 4 °C utilizing Slide-a-Lyzer dialysis cassettes (ThermoScientific 20,000 MWCO).
  • the conjugated antibody was found to be >87% intact by gel chip analysis.
  • the MS spectrometry data is shown in FIG. 7A.
  • the conjugate was purified and buffer exchanged into 100 mM Arginine, 20 mM Histidine, 2% sucrose, 0.01% Tween-20, 50 ⁇ sodium bisulfite formulation buffer pH 6.2 using NAP desalting columns (Illustra Sephadex G-25 DNA Grade, GE Healthcare). Dialysis was performed in the same buffer over night at 4 °C utilizing Slide-a-Lyzer dialysis cassettes (ThermoScientific 10,000 MWCO).
  • the MS spectrometry data is shown in FIG. 7A.
  • Example 13 Preparation of huMOV19-35
  • the conjugate was purified and buffer exchanged into 250 mM Glycine, 10 mM Histidine, 1% sucrose, 0.01% Tween-20, 50 ⁇ sodium bisulfite formulation buffer pH 6.2 using NAP desalting columns (Illustra Sephadex G-25 DNA Grade, GE Healthcare). Dialysis was performed in the same buffer for 8 hours at room temperature utilizing Slide-a-Lyzer dialysis cassettes (ThermoScientific 10,000
  • the MS spectrometry data is shown in FIG. 7A.
  • the conjugate was purified and buffer exchanged into 250 mM Glycine, 10 mM Histidine, 1% sucrose, 0.01% Tween-20, 50 ⁇ sodium bisulfite formulation buffer pH 6.2 using NAP desalting columns (Illustra Sephadex G-25 DNA Grade, GE Healthcare). Dialysis was performed in the same buffer for 20 hours at 4°C utilizing Slide-a-Lyzer dialysis cassettes (ThermoScientific 20,000 MWCO).
  • the conjugated antibody was found to be >90% intact by gel chip analysis.
  • the MS spectrometry data is shown in FIG. 7B.
  • the conjugate was purified and buffer exchanged into 250 mM Glycine, 10 mM Histidine, 1% sucrose, 0.01% Tween-20, 50 ⁇ sodium bisulfite formulation buffer pH 6.2 using NAP desalting columns (Illustra Sephadex G-25 DNA Grade, GE Healthcare). Dialysis was performed in the same buffer for 20 hours at 4 °C utilizing Slide-a-Lyzer dialysis cassettes (ThermoScientific 20,000 MWCO).
  • the conjugated antibody was found to be >90% intact by gel chip analysis.
  • the conjugate was purified and buffer exchanged into 10 mM succinate, 50 mM sodium chloride, 8.5% w/v sucrose, 0.01% Tween-20, 50 ⁇ sodium bisulfite pH 6.2 formulation buffer using NAP desalting columns (Illustra Sephadex G-25 DNA Grade, GE Healthcare). Dialysis was performed in the same buffer for 4 hours at room temperature and then overnight at 4 °C utilizing Slide-a-Lyzer dialysis cassettes
  • the MS spectrometry data is shown in FIG. 7B.
  • the conjugate was purified and buffer exchanged into 250 mM Glycine, 10 mM Histidine, 1% sucrose, 0.01% Tween-20, 50 ⁇ sodium bisulfite formulation buffer pH 6.2 using NAP desalting columns (Illustra Sephadex G-25 DNA Grade, GE Healthcare). Dialysis was performed in the same buffer for 4 hours at room temperature utilizing Slide-a-Lyzer dialysis cassettes (ThermoScientific 20,000
  • the conjugated antibody was found to be >95% intact by gel chip analysis.
  • the MS spectrometry data is shown in FIG. 7C.
  • Example 18 Preparation of huMOV19-sulfo-SPDB-99

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Neurology (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Rheumatology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Oncology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Urology & Nephrology (AREA)
  • Communicable Diseases (AREA)
  • Hematology (AREA)
  • Hospice & Palliative Care (AREA)
  • Reproductive Health (AREA)
  • Dermatology (AREA)
  • Pulmonology (AREA)
  • Psychiatry (AREA)
  • Pain & Pain Management (AREA)
  • Virology (AREA)
PCT/US2015/048059 2014-09-03 2015-09-02 Cytotoxic benzodiazepine derivatives Ceased WO2016036801A1 (en)

Priority Applications (33)

Application Number Priority Date Filing Date Title
BR112017002963A BR112017002963A2 (pt) 2014-09-03 2015-09-02 derivados citotóxicos de benzodiazepina
EP15763739.8A EP3189056B1 (en) 2014-09-03 2015-09-02 Cytotoxic benzodiazepine derivatives
PL15763739T PL3189056T3 (pl) 2014-09-03 2015-09-02 Cytotoksyczne pochodne benzodiazepinowe
TN2017000070A TN2017000070A1 (en) 2014-09-03 2015-09-02 Cytotoxic benzodiazepine derivatives
CN202210858832.1A CN116514903A (zh) 2014-09-03 2015-09-02 细胞毒性苯并二氮杂䓬衍生物
HRP20201293TT HRP20201293T1 (hr) 2014-09-03 2015-09-02 Citotoksični derivati benzodiazepina
CR20170111A CR20170111A (es) 2014-09-03 2015-09-02 Derivados de benzodiazepina citotóxicos
JP2017512775A JP6606545B2 (ja) 2014-09-03 2015-09-02 細胞障害性ベンゾジアゼピン誘導体
CN201580047847.8A CN106604927B (zh) 2014-09-03 2015-09-02 细胞毒性苯并二氮杂䓬衍生物
EP20178715.7A EP3778601A1 (en) 2014-09-03 2015-09-02 Cytotoxic benzodiazepine derivatives
SI201531320T SI3189056T1 (sl) 2014-09-03 2015-09-02 Citotoksični derivati benzodiazepinov
AU2015311987A AU2015311987B2 (en) 2014-09-03 2015-09-02 Cytotoxic benzodiazepine derivatives
CA2959630A CA2959630A1 (en) 2014-09-03 2015-09-02 Cytotoxic benzodiazepine derivatives
MA40413A MA40413B1 (fr) 2014-09-03 2015-09-02 Dérivés de benzodiazépine cytotoxique
EA201790446A EA034138B1 (ru) 2014-09-03 2015-09-02 Цитотоксические бензодиазепиновые производные
MX2017002758A MX2017002758A (es) 2014-09-03 2015-09-02 Derivados de benzodiazepina citotoxicos.
SM20200449T SMT202000449T1 (it) 2014-09-03 2015-09-02 Derivati benzodiazepinici citotossici
LTEP15763739.8T LT3189056T (lt) 2014-09-03 2015-09-02 Citotoksiniai benzodiazepinai
RS20201000A RS60751B1 (sr) 2014-09-03 2015-09-02 Citotoksični derivati benzodiazepina
KR1020247003505A KR20240023671A (ko) 2014-09-03 2015-09-02 세포독성 벤조다이아제핀 유도체
SG11201701455SA SG11201701455SA (en) 2014-09-03 2015-09-02 Cytotoxic benzodiazepine derivatives
DK15763739.8T DK3189056T3 (da) 2014-09-03 2015-09-02 Cytotoksiske benzodiazepinderivater
ES15763739T ES2815353T3 (es) 2014-09-03 2015-09-02 Derivados de benzodiazepina citotóxicos
KR1020177009021A KR102632830B1 (ko) 2014-09-03 2015-09-02 세포독성 벤조다이아제핀 유도체
IL250712A IL250712B (en) 2014-09-03 2017-02-22 History of benzodiazepine cytotoxicity
PH12017500358A PH12017500358A1 (en) 2014-09-03 2017-02-28 Cytotoxic benzodiazepine derivatives
CONC2017/0003011A CO2017003011A2 (es) 2014-09-03 2017-03-28 Derivados de benzodiazepina citotóxicos
IL274114A IL274114A (en) 2014-09-03 2020-04-21 History of benzodiazepine cytotoxicity
IL281317A IL281317B (en) 2014-09-03 2020-04-21 History of benzodiazepine cytotoxicity
AU2020227006A AU2020227006B2 (en) 2014-09-03 2020-08-31 Cytotoxic benzodiazepine derivatives
CY20201100835T CY1123325T1 (el) 2014-09-03 2020-09-04 Κυτταροτοξικα παραγωγα βενζοδιαζεπινης
IL291598A IL291598A (en) 2014-09-03 2022-03-22 History of benzodiazepine cytotoxicity
AU2022202418A AU2022202418B2 (en) 2014-09-03 2022-04-12 Cytotoxic benzodiazepine derivatives

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US201462045248P 2014-09-03 2014-09-03
US62/045,248 2014-09-03
US201462087040P 2014-12-03 2014-12-03
US62/087,040 2014-12-03
US201562149370P 2015-04-17 2015-04-17
US62/149,370 2015-04-17
US201562164305P 2015-05-20 2015-05-20
US62/164,305 2015-05-20

Publications (1)

Publication Number Publication Date
WO2016036801A1 true WO2016036801A1 (en) 2016-03-10

Family

ID=54140691

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/048059 Ceased WO2016036801A1 (en) 2014-09-03 2015-09-02 Cytotoxic benzodiazepine derivatives

Country Status (33)

Country Link
US (5) US9669102B2 (https=)
EP (2) EP3778601A1 (https=)
JP (4) JP6606545B2 (https=)
KR (2) KR20240023671A (https=)
CN (2) CN116514903A (https=)
AU (3) AU2015311987B2 (https=)
BR (1) BR112017002963A2 (https=)
CA (1) CA2959630A1 (https=)
CL (1) CL2017000507A1 (https=)
CO (1) CO2017003011A2 (https=)
CR (1) CR20170111A (https=)
CY (1) CY1123325T1 (https=)
DK (1) DK3189056T3 (https=)
DO (1) DOP2017000053A (https=)
EA (1) EA034138B1 (https=)
EC (1) ECSP17020133A (https=)
ES (1) ES2815353T3 (https=)
HU (1) HUE051002T2 (https=)
IL (4) IL250712B (https=)
LT (1) LT3189056T (https=)
MA (1) MA54254A (https=)
MX (1) MX2017002758A (https=)
PE (1) PE20170775A1 (https=)
PH (1) PH12017500358A1 (https=)
PL (1) PL3189056T3 (https=)
PT (1) PT3189056T (https=)
RS (1) RS60751B1 (https=)
SG (2) SG11201701455SA (https=)
SI (1) SI3189056T1 (https=)
SM (1) SMT202000449T1 (https=)
TN (1) TN2017000070A1 (https=)
TW (4) TWI697493B (https=)
WO (1) WO2016036801A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017004026A1 (en) * 2015-06-29 2017-01-05 Immunogen, Inc. Anti-cd 123 antibodies and conjugates and derivatives thereof
WO2017015496A1 (en) * 2015-07-21 2017-01-26 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
KR20170063668A (ko) * 2014-09-02 2017-06-08 이뮤노젠 아이엔씨 항체 약물 컨쥬게이트 조성물의 제형화 방법
WO2018183494A1 (en) 2017-03-31 2018-10-04 Immunogen, Inc. Cd19-targeting antibody-drug conjugates
WO2018195245A1 (en) 2017-04-20 2018-10-25 Immunogen, Inc. Methods of preparing indolinobenzodiazepine derivatives
WO2024005123A1 (ja) 2022-06-30 2024-01-04 東レ株式会社 癌の治療及び/又は予防用医薬組成物

Families Citing this family (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2815353T3 (es) 2014-09-03 2021-03-29 Immunogen Inc Derivados de benzodiazepina citotóxicos
PT3380525T (pt) 2015-11-25 2024-02-05 Immunogen Inc Formulações farmacêuticas e métodos que as utilizam
MX2018009487A (es) * 2016-02-05 2019-01-31 Millennium Pharm Inc Conjugados de anticuerpo y fármaco dirigidos contra gcc.
TWI845890B (zh) 2016-11-23 2024-06-21 美商伊繆諾金公司 苯二氮平衍生物之選擇性磺化
SI3558391T1 (sl) 2016-12-23 2022-06-30 Immunogen, Inc. Imunokonjugati, ciljno usmerjeni na ADAM9, in načini njihove uporabe
WO2018129029A1 (en) 2017-01-04 2018-07-12 Immunogen, Inc. Met antibodies and immunoconjugates and uses thereof
EP3717021A1 (en) 2017-11-27 2020-10-07 Mersana Therapeutics, Inc. Pyrrolobenzodiazepine antibody conjugates
EP3727463A1 (en) 2017-12-21 2020-10-28 Mersana Therapeutics, Inc. Pyrrolobenzodiazepine antibody conjugates
TWI897855B (zh) 2018-10-26 2025-09-21 美商免疫遺傳股份有限公司 E p C A M 抗體、可活化抗體及免疫偶聯物以及其用途
US11833214B2 (en) * 2019-03-21 2023-12-05 Immunogen, Inc. Methods of preparing cell-binding agent-drug conjugates
TWI841715B (zh) * 2019-03-27 2024-05-11 日商第一三共股份有限公司 抗體-吡咯并苯二氮呯衍生物結合物及parp抑制劑之組合及其用途
US20220306751A1 (en) 2019-09-13 2022-09-29 Mythic Therapeutics, Inc. Antigen-binding protein constructs and uses thereof
CN119212735A (zh) * 2023-04-27 2024-12-27 石药集团巨石生物制药有限公司 一种抗体药物偶联物

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010091150A1 (en) * 2009-02-05 2010-08-12 Immunogen, Inc. Novel benzodiazepine derivatives
WO2012112687A1 (en) * 2011-02-15 2012-08-23 Immunogen, Inc. Methods of preparation of conjugates

Family Cites Families (67)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3453266A (en) 1966-03-14 1969-07-01 American Home Prod 1,2,5-benzothiadiazepine 1,1-dioxides
US3506646A (en) 1966-06-27 1970-04-14 American Home Prod Process for the preparation of 7h-pyrido (1,2-b)(1,2,5)benzothiadiazepine 5,5 - dioxides and pyrrolo(1,2-b)(1,2,5)benzothiadiazepine 5,5-dioxides
US3875162A (en) 1973-07-26 1975-04-01 Squibb & Sons Inc Certain 6H-pyrimido{8 1,2-c{9 {8 1,3,5{9 benzothiadiaza compounds
US4003905A (en) 1974-12-11 1977-01-18 E. R. Squibb & Sons, Inc. Diels-alder adducts of benzdiazepines
US4444688A (en) 1981-05-11 1984-04-24 Ciba-Geigy Corporation Imidazobenzothiadiazepines
JP2920385B2 (ja) 1988-08-18 1999-07-19 武田薬品工業株式会社 1,2,5‐ベンゾチアジアゼピン誘導体,その製造法および用途
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
ES2341666T3 (es) 1991-12-02 2010-06-24 Medimmune Limited Produccion de autoanticuerpos de repertorios de segmentos de anticue rpos expresados en la superficie de fagos.
ES2149768T3 (es) 1992-03-25 2000-11-16 Immunogen Inc Conjugados de agentes enlazantes de celulas derivados de cc-1065.
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
US20080152586A1 (en) 1992-09-25 2008-06-26 Avipep Pty Limited High avidity polyvalent and polyspecific reagents
US6355780B1 (en) 1995-02-22 2002-03-12 Yeda Research And Development Co. Ltd. Antibodies to the death domain motifs of regulatory proteins
CA2297070A1 (en) 1997-08-01 1999-02-11 Morphosys Ag Novel method and phage for the identification of nucleic acid sequences encoding members of a multimeric (poly)peptide complex
US6156746A (en) 1998-08-25 2000-12-05 Bristol-Myers Squibb Company 1,2,5-benzothiadiazepine-1,1-dioxides with n-2 imidazolylalkyl substituents
DE69930328T2 (de) 1998-08-27 2006-12-14 Spirogen Ltd., Ryde Dimere Pyrrolobenzodiazepine
US7115396B2 (en) 1998-12-10 2006-10-03 Compound Therapeutics, Inc. Protein scaffolds for antibody mimics and other binding proteins
ES2276708T3 (es) 1999-11-24 2007-07-01 Immunogen, Inc. Agentes citotoxicos que comprenden taxanos y su uso terapeutico.
DE60140474D1 (de) 2000-09-08 2009-12-24 Univ Zuerich Sammlung von proteinen mit sich wiederholenden sequenzen (repeat proteins), die repetitive sequenzmodule enthalten
US6441163B1 (en) 2001-05-31 2002-08-27 Immunogen, Inc. Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents
US6716821B2 (en) 2001-12-21 2004-04-06 Immunogen Inc. Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same
US6756397B2 (en) 2002-04-05 2004-06-29 Immunogen, Inc. Prodrugs of CC-1065 analogs
GB0209467D0 (en) 2002-04-25 2002-06-05 Astrazeneca Ab Chemical compounds
CN100522955C (zh) 2002-08-02 2009-08-05 伊缪诺金公司 含有新型强效紫杉烷的细胞毒性剂及其治疗用途
JP2006500364A (ja) 2002-08-16 2006-01-05 イムノージェン インコーポレーテッド 高い反応性と溶解度を有する架橋剤および小分子薬物の標的化送達用コンジュゲートの調製におけるそれらの使用
BR0316101A (pt) 2002-11-07 2005-09-27 Immunogen Inc Anticorpos anticd33 e processo para tratamento de leucemia melóide aguda usando os mesmos
FR2850654A1 (fr) 2003-02-03 2004-08-06 Servier Lab Nouveaux derives d'azepines tricycliques, leur procede de preparation et les compositions pharmaceutiques qui les contiennent
US8088387B2 (en) 2003-10-10 2012-01-03 Immunogen Inc. Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates
US7276497B2 (en) 2003-05-20 2007-10-02 Immunogen Inc. Cytotoxic agents comprising new maytansinoids
PL3524611T3 (pl) 2003-05-20 2021-06-14 Immunogen, Inc. Udoskonalone czynniki cytotoksyczne zawierające nowe maitansynoidy
EA014640B1 (ru) 2003-07-21 2010-12-30 Иммьюноджен, Инк. Антитело или его эпитоп-связывающий фрагмент, которые связываются с гликотопом са6, и способы их применения
US7834155B2 (en) 2003-07-21 2010-11-16 Immunogen Inc. CA6 antigen-specific cytotoxic conjugate and methods of using the same
US7511032B2 (en) * 2003-10-22 2009-03-31 The United States Of America As Represented By The Secretary, Department Of Health And Human Services Pyrrolobenzodiazepine derivatives, compositions comprising the same and methods related thereto
JP5166861B2 (ja) 2004-03-09 2013-03-21 スピロゲン リミティッド ピロロベンゾジアゼピン
EP3225633B1 (en) 2004-05-21 2020-03-25 The UAB Research Foundation Variable lymphocyte receptors, related polypeptides and nucleic acids, and uses thereof
KR20120064120A (ko) 2004-06-01 2012-06-18 제넨테크, 인크. 항체 약물 접합체 및 방법
KR101270829B1 (ko) 2004-09-23 2013-06-07 제넨테크, 인크. 시스테인 유전자조작 항체 및 접합체
EP1817341A2 (en) 2004-11-29 2007-08-15 Seattle Genetics, Inc. Engineered antibodies and immunoconjugates
CA2597407C (en) 2005-02-11 2013-09-10 Immunogen, Inc. Process for preparing stable drug conjugates
BRPI0613593A2 (pt) 2005-07-08 2011-01-18 Univ Zuerich método de teste "phage display" filamentoso, vetor de fago ou de fagomìdeo e biblioteca de vetores de fago ou fagomìdeo
US7772485B2 (en) 2005-07-14 2010-08-10 Konarka Technologies, Inc. Polymers with low band gaps and high charge mobility
ITRM20050416A1 (it) 2005-08-03 2007-02-04 Uni Degli Studi Di Roma Tor Vergata Derivati delle benzodiazepine e loro usi in campo medico.
MX2008002607A (es) 2005-08-22 2008-03-19 Immunogen Inc Un conjugado citotoxico ca6 antigeno-especifico y metodos para utilizar el mismo.
EP3539572A1 (en) 2005-08-24 2019-09-18 ImmunoGen, Inc. Process for preparing maytansinoid antibody conjugates
WO2007062466A1 (en) 2005-11-29 2007-06-07 The University Of Sydney Demibodies: dimerisation-activated therapeutic agents
SI1813614T1 (sl) 2006-01-25 2012-01-31 Sanofi 174 Citotoksična sredstva, ki obsegajo nove tomajmicinske derivate
US7897568B2 (en) 2006-03-03 2011-03-01 Vinay K. Singh Compositions for treatment of cancer
ES2567402T3 (es) 2006-05-30 2016-04-22 Genentech, Inc. Anticuerpos anti CD22, sus inmunoconjugados y usos de los mismos
CA2655379A1 (en) 2006-06-22 2007-12-27 Walter And Eliza Hall Institute Of Medical Research Structure of the insulin receptor ectodomain
PL2019104T3 (pl) 2007-07-19 2014-03-31 Sanofi Sa Środki cytotoksyczne obejmujące nowe pochodne tomaymycyny i ich zastosowanie terapeutyczne
CA2700391A1 (en) 2007-09-24 2009-04-02 University Of Zuerich Designed armadillo repeat proteins
EP2276506A4 (en) 2008-04-30 2014-05-07 Immunogen Inc EFFICIENT CONJUGATES AND HYDROPHILIC BINDER
KR20200058590A (ko) 2008-04-30 2020-05-27 이뮤노젠 아이엔씨 가교제 및 그 용도
BRPI0919881B1 (pt) 2008-10-31 2021-09-08 Centocor Ortho Biotech Inc Proteína de arcabouço e seu método de geração, biblioteca e seu método de construção, molécula de ácido nucleico, vetor de ácido nucleico, célula hospedeira, composição, dispositivo médico e artigo de fabricação
BRPI1008532B1 (pt) 2009-02-12 2021-12-14 Janssen Biotech, Inc Arcabouço de proteína isolada, método para construção de uma biblioteca de arcabouço de proteína isolada, molécula de ácido nucleico isolada, vetor de ácido nucleico isolado, célula hospedeira de bactéria ou fungo, composição, dispositivo médico e artigo de manufatura para uso farmacêutico ou de diagnóstico em seres humanos
FR2947269B1 (fr) * 2009-06-29 2013-01-18 Sanofi Aventis Nouveaux composes anticancereux
SG181814A1 (en) 2009-12-23 2012-07-30 Avipep Pty Ltd Immuno-conjugates and methods for producing them 2
CN103037900B (zh) 2010-02-24 2016-04-06 伊缪诺金公司 叶酸受体1抗体与免疫缀合物以及其用途
SG183542A1 (en) 2010-03-12 2012-10-30 Immunogen Inc Cd37-binding molecules and immunoconjugates thereof
EP3569256B1 (en) 2010-04-30 2022-06-15 Janssen Biotech, Inc. Stabilized fibronectin domain compositions, methods and uses
CN103298489A (zh) 2010-10-29 2013-09-11 伊缪诺金公司 新型egfr结合分子及其免疫偶联物
CN105399831A (zh) 2010-10-29 2016-03-16 伊缪诺金公司 非拮抗性egfr结合分子及其免疫偶联物
IL281714B2 (en) 2011-04-01 2023-11-01 Immunogen Inc Methods for increasing the effectiveness of FOLR1 cancer therapy
HK1211208A1 (zh) 2012-08-22 2016-05-20 Immunogen, Inc. 細胞毒性苯並二氮呯衍生物
MX340090B (es) * 2012-11-05 2016-06-23 Pfizer Analogos de spliceostatina.
TW201609152A (zh) * 2014-09-03 2016-03-16 免疫原公司 包含細胞結合劑及細胞毒性劑之偶聯物
ES2815353T3 (es) 2014-09-03 2021-03-29 Immunogen Inc Derivados de benzodiazepina citotóxicos

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010091150A1 (en) * 2009-02-05 2010-08-12 Immunogen, Inc. Novel benzodiazepine derivatives
WO2012112687A1 (en) * 2011-02-15 2012-08-23 Immunogen, Inc. Methods of preparation of conjugates

Cited By (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3311846A1 (en) * 2014-09-02 2018-04-25 ImmunoGen, Inc. Methods for formulating antibody drug conjugate compositions
KR20170063668A (ko) * 2014-09-02 2017-06-08 이뮤노젠 아이엔씨 항체 약물 컨쥬게이트 조성물의 제형화 방법
KR102626976B1 (ko) 2014-09-02 2024-01-18 이뮤노젠 아이엔씨 항체 약물 컨쥬게이트 조성물의 제형화 방법
EP3188761A4 (en) * 2014-09-02 2018-04-18 ImmunoGen, Inc. Methods for formulating antibody drug conjugate compositions
US10603388B2 (en) 2014-09-02 2020-03-31 Immunogen, Inc. Methods for formulating antibody drug conjugate compositions
US11897961B2 (en) 2015-06-29 2024-02-13 Immunogen, Inc. Anti-CD123 antibodies and conjugates and derivatives thereof
US11332535B2 (en) 2015-06-29 2022-05-17 Immunogen, Inc. Anti-CD123 antibodies and conjugates and derivatives thereof
WO2017004026A1 (en) * 2015-06-29 2017-01-05 Immunogen, Inc. Anti-cd 123 antibodies and conjugates and derivatives thereof
EP3842459A1 (en) * 2015-06-29 2021-06-30 ImmunoGen, Inc. Anti-cd123 antibodies and conjugates and derivatives thereof
US10919969B2 (en) 2015-06-29 2021-02-16 Immunogen, Inc. Anti-CD123 antibodies and conjugates and derivatives thereof
US10077313B2 (en) 2015-06-29 2018-09-18 Immunogen, Inc. Anti-CD123 antibodies and conjugates and derivatives thereof
US10875925B2 (en) 2015-06-29 2020-12-29 Immunogen, Inc. Anti-CD123 antibodies and conjugates and derivatives thereof
US10442865B2 (en) 2015-06-29 2019-10-15 Immunogen, Inc. Methods of use of anti-CD123 antibodies and antigen-binding fragments thereof
US10392407B2 (en) 2015-07-21 2019-08-27 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
JP2018526340A (ja) * 2015-07-21 2018-09-13 イミュノジェン・インコーポレーテッド 細胞毒性ベンゾジアゼピン誘導体の調製方法
WO2017015496A1 (en) * 2015-07-21 2017-01-26 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
US9873708B2 (en) 2015-07-21 2018-01-23 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
EP3653628A1 (en) * 2015-07-21 2020-05-20 ImmunoGen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
RU2727151C2 (ru) * 2015-07-21 2020-07-21 Иммуноджен, Инк. Способы получения цитотоксических производных бензодиазепина
US10787463B2 (en) 2015-07-21 2020-09-29 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
US10081640B2 (en) 2015-07-21 2018-09-25 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
US10899775B2 (en) 2015-07-21 2021-01-26 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
US10370389B2 (en) 2015-07-21 2019-08-06 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
CN108026103A (zh) * 2015-07-21 2018-05-11 伊缪诺金公司 制备细胞毒性苯并二氮杂䓬衍生物的方法
US9890179B2 (en) 2015-07-21 2018-02-13 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
US11420982B2 (en) 2015-07-21 2022-08-23 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
EP4163284A1 (en) * 2015-07-21 2023-04-12 ImmunoGen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
WO2018183494A1 (en) 2017-03-31 2018-10-04 Immunogen, Inc. Cd19-targeting antibody-drug conjugates
WO2018195245A1 (en) 2017-04-20 2018-10-25 Immunogen, Inc. Methods of preparing indolinobenzodiazepine derivatives
WO2024005123A1 (ja) 2022-06-30 2024-01-04 東レ株式会社 癌の治療及び/又は予防用医薬組成物

Also Published As

Publication number Publication date
AU2015311987B2 (en) 2020-06-04
HUE051002T2 (hu) 2021-01-28
EP3189056B1 (en) 2020-06-10
EP3778601A1 (en) 2021-02-17
KR20240023671A (ko) 2024-02-22
ECSP17020133A (es) 2018-02-28
IL291598A (en) 2022-05-01
DK3189056T3 (da) 2020-09-14
DOP2017000053A (es) 2017-05-31
CR20170111A (es) 2017-05-23
US10238751B2 (en) 2019-03-26
KR20170063670A (ko) 2017-06-08
SG11201701455SA (en) 2017-03-30
RS60751B1 (sr) 2020-10-30
AU2020227006A1 (en) 2020-09-24
US9669102B2 (en) 2017-06-06
CN106604927A (zh) 2017-04-26
IL281317B (en) 2022-04-01
JP2022166293A (ja) 2022-11-01
PL3189056T3 (pl) 2020-11-02
IL274114A (en) 2020-06-30
CA2959630A1 (en) 2016-03-10
US10722588B2 (en) 2020-07-28
US20200405870A1 (en) 2020-12-31
TN2017000070A1 (en) 2018-07-04
US20160082114A1 (en) 2016-03-24
TWI819474B (zh) 2023-10-21
JP2021042234A (ja) 2021-03-18
MX2017002758A (es) 2017-10-20
TWI757759B (zh) 2022-03-11
EA034138B1 (ru) 2020-01-09
PH12017500358A1 (en) 2017-07-17
PE20170775A1 (es) 2017-07-04
MA54254A (fr) 2021-09-22
JP2020075912A (ja) 2020-05-21
CN106604927B (zh) 2022-08-09
KR102632830B1 (ko) 2024-02-02
AU2022202418B2 (en) 2024-06-06
TW202037596A (zh) 2020-10-16
CN116514903A (zh) 2023-08-01
AU2015311987A1 (en) 2017-03-09
CY1123325T1 (el) 2021-12-31
IL250712B (en) 2020-04-30
TWI697493B (zh) 2020-07-01
JP2017527563A (ja) 2017-09-21
EA201790446A1 (ru) 2017-07-31
US20170340748A1 (en) 2017-11-30
US20230233697A1 (en) 2023-07-27
JP7132311B2 (ja) 2022-09-06
AU2022202418A1 (en) 2022-05-19
SG10201901824UA (en) 2019-03-28
US11116845B2 (en) 2021-09-14
PT3189056T (pt) 2020-09-04
US20190269786A1 (en) 2019-09-05
IL250712A0 (en) 2017-08-31
CO2017003011A2 (es) 2017-07-11
BR112017002963A2 (pt) 2019-07-16
TW201613929A (en) 2016-04-16
LT3189056T (lt) 2020-09-25
CL2017000507A1 (es) 2017-11-03
EP3189056A1 (en) 2017-07-12
TW202222802A (zh) 2022-06-16
AU2020227006B2 (en) 2022-05-12
ES2815353T3 (es) 2021-03-29
SI3189056T1 (sl) 2020-10-30
TW202417447A (zh) 2024-05-01
JP6802340B2 (ja) 2020-12-16
JP6606545B2 (ja) 2019-11-13
SMT202000449T1 (it) 2020-09-10

Similar Documents

Publication Publication Date Title
AU2022202418B2 (en) Cytotoxic benzodiazepine derivatives
EP3188733B1 (en) Conjugates comprising cell-binding agents and cytotoxic agents
US9974867B2 (en) Cytotoxic benzodiazepine derivatives
US20180346488A1 (en) Cytotoxic benzodiazepine derivatives and conjugates thereof
HK40046012A (en) Cytotoxic benzodiazepine derivatives
HK1236943A1 (en) Cytotoxic benzodiazepine derivatives
HK1236943B (en) Cytotoxic benzodiazepine derivatives
EA039619B1 (ru) Способ получения индолинобензодиазепиновых соединений

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15763739

Country of ref document: EP

Kind code of ref document: A1

REEP Request for entry into the european phase

Ref document number: 2015763739

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015763739

Country of ref document: EP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017002963

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 250712

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2959630

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 12017500358

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: MX/A/2017/002758

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: DZP2017000118

Country of ref document: DZ

Ref document number: 000378-2017

Country of ref document: PE

ENP Entry into the national phase

Ref document number: 2017512775

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2015311987

Country of ref document: AU

Date of ref document: 20150902

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201790446

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 2017111

Country of ref document: CR

Ref document number: CR2017-000111

Country of ref document: CR

WWE Wipo information: entry into national phase

Ref document number: NC2019/0002153

Country of ref document: CO

Ref document number: NC2017/0003011

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: A201701399

Country of ref document: UA

Ref document number: 14460/1

Country of ref document: GE

ENP Entry into the national phase

Ref document number: 20177009021

Country of ref document: KR

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: NC2019/0002153

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112017002963

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170214

WWG Wipo information: grant in national office

Ref document number: NC2019/0002153

Country of ref document: CO

WWW Wipo information: withdrawn in national office

Ref document number: NC2019/0002153

Country of ref document: CO

WWW Wipo information: withdrawn in national office

Ref document number: 291598

Country of ref document: IL