WO2015023355A1 - 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment - Google Patents

1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment Download PDF

Info

Publication number
WO2015023355A1
WO2015023355A1 PCT/US2014/042560 US2014042560W WO2015023355A1 WO 2015023355 A1 WO2015023355 A1 WO 2015023355A1 US 2014042560 W US2014042560 W US 2014042560W WO 2015023355 A1 WO2015023355 A1 WO 2015023355A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
alkylene
hvr
seq
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2014/042560
Other languages
English (en)
French (fr)
Inventor
John A. Flygare
Thomas H. PILLOW
Brian Safina
Visha VERMA
Binqing Wei
William Denny
Anna GIDDENS
Ho Lee
Guo-Liang Lu
Christian Miller
Gordon Rewcastle
Moana Tercel
Muriel Bonnet
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genentech Inc
Original Assignee
Genentech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Genentech Inc filed Critical Genentech Inc
Priority to CN201480055557.3A priority Critical patent/CN105636612B/zh
Priority to MX2016001862A priority patent/MX2016001862A/es
Priority to JP2016533294A priority patent/JP6993084B2/ja
Priority to AU2014307080A priority patent/AU2014307080B2/en
Priority to CA2918139A priority patent/CA2918139A1/en
Priority to EA201690195A priority patent/EA201690195A1/ru
Priority to HK16110804.7A priority patent/HK1222566B/zh
Priority to KR1020167006280A priority patent/KR20160042080A/ko
Priority to BR112016002829A priority patent/BR112016002829A2/pt
Priority to EP14736243.8A priority patent/EP3033111B1/en
Priority to SG11201601005XA priority patent/SG11201601005XA/en
Priority to MA38812A priority patent/MA38812B1/fr
Priority to HK16110669.1A priority patent/HK1222544B/en
Priority to BR112016013258A priority patent/BR112016013258A2/pt
Priority to JP2016558547A priority patent/JP6980384B2/ja
Priority to MX2016007578A priority patent/MX2016007578A/es
Priority to CN201480068615.6A priority patent/CN105828840B/zh
Priority to KR1020167018430A priority patent/KR20160092024A/ko
Priority to CA2929565A priority patent/CA2929565A1/en
Priority to EP14830914.9A priority patent/EP3082876B1/en
Priority to PCT/US2014/070637 priority patent/WO2015095212A1/en
Publication of WO2015023355A1 publication Critical patent/WO2015023355A1/en
Priority to IL243586A priority patent/IL243586A0/en
Priority to PH12016500246A priority patent/PH12016500246A1/en
Anticipated expiration legal-status Critical
Priority to CR20160125A priority patent/CR20160125A/es
Priority to US15/182,444 priority patent/US10544215B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/06Dipeptides
    • C07K5/06008Dipeptides with the first amino acid being neutral
    • C07K5/06017Dipeptides with the first amino acid being neutral and aliphatic
    • C07K5/06034Dipeptides with the first amino acid being neutral and aliphatic the side chain containing 2 to 4 carbon atoms
    • C07K5/06052Val-amino acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/55Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68035Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a pyrrolobenzodiazepine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D207/00Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom
    • C07D207/02Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D207/30Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having two double bonds between ring members or between ring members and non-ring members
    • C07D207/34Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having two double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D207/36Oxygen or sulfur atoms
    • C07D207/402,5-Pyrrolidine-diones
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D209/00Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom
    • C07D209/56Ring systems containing three or more rings
    • C07D209/58[b]- or [c]-condensed
    • C07D209/60Naphtho [b] pyrroles; Hydrogenated naphtho [b] pyrroles
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D209/00Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom
    • C07D209/56Ring systems containing three or more rings
    • C07D209/58[b]- or [c]-condensed
    • C07D209/62Naphtho [c] pyrroles; Hydrogenated naphtho [c] pyrroles
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
    • C07D401/12Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/14Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D403/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/14Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D471/00Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00
    • C07D471/02Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00 in which the condensed system contains two hetero rings
    • C07D471/04Ortho-condensed systems
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D487/00Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
    • C07D487/02Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
    • C07D487/04Ortho-condensed systems
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F9/00Compounds containing elements of Groups 5 or 15 of the Periodic Table
    • C07F9/02Phosphorus compounds
    • C07F9/547Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom
    • C07F9/553Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom having one nitrogen atom as the only ring hetero atom
    • C07F9/572Five-membered rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F9/00Compounds containing elements of Groups 5 or 15 of the Periodic Table
    • C07F9/02Phosphorus compounds
    • C07F9/547Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom
    • C07F9/6558Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom containing at least two different or differently substituted hetero rings neither condensed among themselves nor condensed with a common carbocyclic ring or ring system
    • C07F9/65583Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom containing at least two different or differently substituted hetero rings neither condensed among themselves nor condensed with a common carbocyclic ring or ring system each of the hetero rings containing nitrogen as ring hetero atom
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F9/00Compounds containing elements of Groups 5 or 15 of the Periodic Table
    • C07F9/02Phosphorus compounds
    • C07F9/547Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom
    • C07F9/6561Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom containing systems of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring or ring system, with or without other non-condensed hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H15/00Compounds containing hydrocarbon or substituted hydrocarbon radicals directly attached to hetero atoms of saccharide radicals
    • C07H15/20Carbocyclic rings
    • C07H15/24Condensed ring systems having three or more rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3061Blood cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3069Reproductive system, e.g. ovaria, uterus, testes, prostate
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes

Definitions

  • the invention relates generally to antibodies conjugated to l-(chloromethyl)-2,3- dihydro-lH-benzo[e]indole (CBI) dimer drug moieties to form antibody-drug conjugates with therapeutic or diagnostic applications.
  • the antibodies may be engineered with free cysteine amino acids, reactive for conjugation with CBI dimer drug-linker intermediates.
  • the invention also relates to methods of using the CBI dimer antibody-drug conjugate compounds for in vitro, in situ, and in vivo diagnosis or treatment of mammalian cells, or associated pathological conditions.
  • ADC Antibody drug conjugates
  • the 5-amino-l-(chloromethyl)-l,2-dihydro-3H-benz[e]indole (amino CBI) class of DNA minor groove alkylators are potent cytotoxins (Atwell, et al (1999) J. Med. Chem.,
  • prodrugs 42:3400 have been utilized as effector units in a number of classes of prodrugs designed for cancer therapy. These have included antibody conjugates, (Jeffrey, et al. (2005) J. Med. Chem., 48: 1344), prodrugs for gene therapy based on nitrobenzyl carbamates (Hay, et al (2003) J. Med. Chem. 46:2456) and the corresponding nitro-CBI derivatives as hypoxia- activated prodrugs (Tercel, et al (2011) Angew. Chem., Int. Ed., 50:2606-2609).
  • the invention includes l-(chloromethyl)-2,3-dihydro-lH-benzo[e]indole (CBI) dimer drug moieties covalently attached by a linker to form antibody-drug conjugate (ADC) compounds with therapeutic or diagnostic applications.
  • CBI l-(chloromethyl)-2,3-dihydro-lH-benzo[e]indole
  • ADC antibody-drug conjugate
  • An aspect of the invention is an antibody-drug conjugate compound having the formula:
  • Ab is an antibody
  • L is a linker having the formula:
  • Str is a stretcher unit covalently attached to the antibody
  • Pep is an optional peptide unit of two to twelve amino acid residues
  • Sp is an optional spacer unit covalently attached to a dimer drug moiety
  • m and n are independently selected from 0 and 1 ;
  • p is an integer from 1 to 8;
  • D is the dimer drug moiety having the formula:
  • R 1 is selected from H, P(0) 3 H 2 , C(0)NR a R b , or a bond to L;
  • R 2 is selected from H, P(0) 3 H 2 , C(0)NR a R b , or a bond to L;
  • R a and R b are independently selected from H and Ci-C 6 alkyl optionally substituted with one or more F,
  • R a and R b form a five or six membered heterocyclyl group
  • T is a tether group selected from C 3 -Ci 2 alkylene, Y, (Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene), (Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene), (C 2 -C 6
  • Y is independently selected from O, S, NR 1 , aryl, and heteroaryl;
  • alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with F, OH, 0(d-C 6 alkyl), NH 2 , NHCH 3 , N(CH 3 ) 2 , OP(0) 3 H 2 , and Ci-C 6 alkyl, where alkyl is optionally substituted with one or more F;
  • alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with a bond to L;
  • D' is a drug moiety selected from:
  • X 1 and X" are independently selected from O and NR , where R is selected from H and Ci-C alkyl optionally substituted with one or more F;
  • R 4 is H, C0 2 R, or a bond to L, where R is Ci-C 6 alkyl or benzyl;
  • R 5 is H or Ci-C 6 alkyl.
  • An aspect of the invention is a pharmaceutical composition of the antibody-drug conjugate compound, and a pharmaceutically acceptable carrier, glidant, diluent, or excipient.
  • An aspect of the invention is a method of treating cancer comprising administering to a patient a therapeutically-effective amount of the antibody-drug conjugate compound.
  • An aspect of the invention is a kit for treating cancer, comprising:
  • An aspect of the invention is a linker-drug intermediate selected from:
  • X-L-D wherein: X is a reactive functional group selected from maleimide, thiol, amino, bromide, bromoacetamido, iodoacetamido, p-toluenesulfonate, iodide, hydroxyl, carboxyl, pyridyl disulfide, and N-hydroxysuccinimide;
  • L is a linker having the formula:
  • Str is a stretcher unit covalently attached to X;
  • Pep is an optional peptide unit of two to twelve amino acid residues, Sp is an optional spacer unit covalently attached to a dimer drug moiety, and m and n are independently selected from 0 and 1 ;
  • D is the dimer drug moiety having the formula:
  • R 1 is selected from H, P(0) 3 H 2 , C(0)NR a R b , or a bond to L;
  • R 2 is selected from H, P(0) 3 H 2 , C(0)NR a R b , or a bond to L;
  • R a and R b are independently selected from H and Ci-C 6 alkyl optionally substituted with one or more F, or R a and R b form a five or six membered heterocyclyl group;
  • T is a tether group selected from C 3 -Ci 2 alkylene, Y, (Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene), (Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene), (C 2 -C 6
  • Y is independently selected from O, S, NR 1 , aryl, and heteroaryl;
  • alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with F, OH, 0(Ci-C 6 alkyl), NH 2 , NHCH 3 , N(CH 3 ) 2 , OP(0) 3 H 2 , and Ci-C 6 alkyl, where alkyl is optionally substituted with one or more F;
  • alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with a bond to L;
  • D' is a drug moiety selected from:
  • X 1 and X" are independently selected from O and NR , where R is selected from H and Ci-C alkyl optionally substituted with one or more F;
  • R 4 is H, C0 2 R, or a bond to L, where R is Ci-C 6 alkyl or benzyl;
  • R 5 is H or Ci-C 6 alkyl.
  • An aspect of the invention is a process for making an antibody-drug conjugate by conjugating the antibody to a linker-drug intermediate.
  • An aspect of the invention is a CBI dimer drug moiety compound having the formula:
  • R 1 is selected from H, P(0) 3 H 2 , C(0)NR a R b
  • R 2 is selected from H, P(0) 3 H 2 , C(0)NR a R b R a and R b are independently selected from H and Ci-C 6 alkyl optionally substituted with one or more F,
  • R a and R b form a five or six membered heterocyclyl group
  • T is a tether group selected from C3-C12 alkylene, Y, (Ci-C 6 alkylene)-Y-(Ci-C6 alkylene), (Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene), (C 2 -C 6
  • Y is independently selected from O, S, NR 1 , aryl, and heteroaryl;
  • alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with F, OH, 0(Ci-C 6 alkyl), NH 2 , NHCH 3 , N(CH 3 ) 2 , OP(0) 3 H 2 , and Ci-C 6 alkyl, where alkyl is optionally substituted with one or more F;
  • alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with a bond to L;
  • D' is a drug moiety selected from:
  • X 1 and X" are independently selected from O and NR , where R is selected from H and Ci-C 6 alkyl optionally substituted with one or more F;
  • R 4 is H, C0 2 R, where R is Ci-C 6 alkyl or benzyl; and R 5 is H or Ci-C 6 alkyl.
  • Figure 1 shows the synthesis of (S)-l-(chloromethyl)-3-(5-((S)-l-(chloromethyl)-5- hydroxy-lH-benzo[e]indol-3(2H)-yl)-5-oxopentanoyl)-2,3-dihydro-lH-benzo[e]indol-5-yl 2- (2-bromo-N-methylacetamido)ethyl(methyl)carbamate 51 from (S)-tert-Butyl 1- (chloromethyl)-5-hydroxy-lH-benzo[e]indole-3(2H)-carboxylate 51a.
  • Figure 2 shows the synthesis of N-((R)-l-(chloromethyl)-3-(5-((R)-l-(chloromethyl)- 5-hydroxy-lH-benzo[e]indol-3(2H)-yl)-5-oxopentanoyl)-2,3-dihydro-lH-benzo[e]indol-5- yl)-6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)hexanamide 53 from (R)-tert-butyl 1- (chloromethyl)-5-(diphenylmethyleneamino)-lH-benzo[e]indole-3(2H)-carboxylate 53a.
  • Figure 3 shows the synthesis of l-((S)-5-amino-l-(chloromethyl)-lH-benzo[e]indol- 3(2H)-yl)-5-((S)-l-(chloromethyl)-5-hydroxy-lH-benzo[e]indol-3(2H)-yl)pentane-l,5-dione 53j from (S)-5-(5-(benzyloxy)-l-(chloromethyl)-lH-benzo[e]indol-3(2H)-yl)-5-oxopentanoic acid 57c.
  • Figure 4 shows the synthesis of unnatural enantiomer, l-((R)-5 -amino- 1- (chloromethyl)- 1 H-benzo[e]indol-3 (2H)-yl)-5 -((R)- 1 -(chloromethyl)-5 -hydroxy- 1 H- benzo[e]indol-3(2H)-yl)pentane-l,5-dione 53p from (R)-tert-butyl l-(chloromethyl)-5- hydroxy- 1 H-b enzo [e] indole-3 (2H)-carboxylate 53k.
  • Figure 5 shows the synthesis of N-(4-(((S)-l-(chloromethyl)-3-(6-((S)-7-methoxy-5- oxo-2,3 ,5 , 11 a-tetrahydro- 1 H-benzo[e]pyrrolo[ 1 ,2-a] [ 1 ,4]diazepin-8-yloxy)hexanoyl)-2,3 - dihydro-lH-benzo[e]indol-5-yloxy)methyl)phenyl)-6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l- yl)hexanamide 54 from (S)-(2-amino-4-hydroxy-5-methoxyphenyl)(2- (hydroxymethyl)pyrrolidin- 1 -yl)methanone 54a.
  • Figure 6 shows the synthesis of N-((S)-l-((S)-l-(4-(((S)-l-(chloromethyl)-3-(5-((S)-l- (chloromethyl)-5-hydroxy-lH-benzo[e]indol-3(2H)-yl)-5-oxopentanoyl)-2,3-dihydro-lH- benzo[e]indol-5-yloxy)methyl)phenylamino)-l-oxo-5-ureidopentan-2-ylamino)-3-methyl-l- oxobutan-2-yl)-6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)hexanamide 55 from (S)-tert-butyl l-(chloromethyl)-5-hydroxy-lH-benzo[e]indole-3(2H)-carboxylate 51a.
  • Figure 7 shows the synthesis of (S)-tert-butyl 8-(6-((S)-5-(4-((S)-2-((S)-2-amino-3- methylbutanamido)-5-ureidopentanamido)benzyloxy)-l-(chloromethyl)-lH-benzo[e]indol- 3(2H)-yl)-6-oxohexyloxy)-l l-hydroxy-7-methoxy-5-oxo-2,3,l 1,11 a-tetrahydro- 1H- benzo[e]pyrrolo[l,2-a][l,4]diazepine-10(5H)-carboxylate 56d from (S)-tert-Butyl 8-(6-((S)- 1 -(chloromethyl)-5-(4-nitrobenzyloxy)- 1 H-benzo[e]indol-3(2H)-yl)-6-ox
  • Figure 8 shows the synthesis of N-((S)-l-((S)-l-(4-(((S)-l-(chloromethyl)-3-(6-((S)-7- methoxy-5 -oxo-2,3 ,5 , 11 a-tetrahydro- 1 H-benzo[e]pyrrolo[ 1 ,2-a] [ 1 ,4]diazepin-8- yloxy)hexanoyl)-2,3-dihydro-lH-benzo[e]indol-5-yloxy)methyl)phenylamino)-l-oxo-5- ureidopentan-2-ylamino)-3-methyl-l-oxobutan-2-yl)-6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l- yl)hexanamide 56 from (S)-tert-butyl 8-(6-((S)-5-(
  • Figure 9 shows the synthesis of (S)-5-(l-(chloromethyl)-5-(di-tert- butoxyphosphoryloxy)-lH-benzo[e]indol-3(2H)-yl)-5-oxopentanoic acid 57d from (S)-tert- Butyl 1 -(chloromethyl)-5-hydroxy-lH-benzo[e]indole-3(2H)-carboxylate 51a.
  • Figure 10 shows the synthesis of (S)-l-(chloromethyl)-2,3-dihydro-lH-benzo[e]indol- 5-yl 2-(6-(2,5 -dioxo-2,5-dihydro- 1 H-pyrrol- 1 -yl)-N- methylhexanamido)ethyl(methyl)carbamate 57i from 6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l- yl)hexanoic acid.
  • Figure 11 shows the synthesis of (S)-l-(chloromethyl)-3-(5-((S)-l-(chloromethyl)-5- (phosphonooxy)-lH-benzo[e]indol-3(2H)-yl)-5-oxopentanoyl)-2,3-dihydro-lH- benzo[e]indol-5-yl 2-(6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)-N- methylhexanamido)ethyl(methyl)carbamate 57 from (S)-l-(chloromethyl)-2,3-dihydro-lH- benzo[e]indol-5-yl 2-(6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)-N- methylhexanamido)ethyl(methyl)carbamate
  • Figure 12 shows the synthesis of (S)-3-(5-((S)-5-(4-aminobenzyloxy)-l- (chloromethyl)-lH-benzo[e]indol-3(2H)-yl)-5-oxopentanoyl)-l-(chloromethyl)-2,3-dihydro- lH-benzo[e]indol-5-yl 4-methylpiperazine-l-carboxylate 58e from (S)-tert-butyl 1- (chloromethyl)-5-hydroxy-lH-benzo[e]indole-3(2H)-carboxylate 51a.
  • Figure 13 shows the synthesis of (S)-l-(chloromethyl)-3-(5-((S)-l-(chloromethyl)-5- (4-((S)-2-((S)-2-(6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)hexanamido)-3- methylbutanamido)-5-ureidopentanamido)benzyloxy)-lH-benzo[e]indol-3(2H)-yl)-5- oxopentanoyl)-2,3-dihydro-lH-benzo[e]indol-5-yl 4-methylpiperazine-l-carboxylate 58 from (S)-3-(5-((S)-5-(4-aminobenzyloxy)-l-(chloromethyl)-lH-benzo[e]indol-3(2H)-yl)-5- ox
  • Figure 14 shows the synthesis of (S)-l-(chloromethyl)-3-(5-((S)-l-(chloromethyl)-5- (4-((S)-2-((S)-2-(6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)hexanamido)-3- methylbutanamido)-5-ureidopentanamido)benzyloxy)-lH-benzo[e]indol-3(2H)-yl)-5- oxopentanoyl)-2,3-dihydro-lH-benzo[e]indol-5-yl dihydrogen phosphate 59 from (S)-tert- butyl 5-(4-((S)-2-((S)-2-(((9H-fluoren-9-yl)methoxy)carbonylamino)-3-methylbutanamido)- 5-ureidopentan
  • Figure 15 shows the synthesis of 2-(pyridin-2-yldisulfanyl)ethyl (S)-l- (chloromethyl)-3-(5-((S)-l-(chloromethyl)-5-(phosphonooxy)-lH-benzo[e]indol-3(2H)-yl)-5- oxopentanoyl)-2,3-dihydro-lH-benzo[e]indol-5-ylcarbamate 61 from (S)-tert-butyl 5-amino- l-(chloromethyl)-lH-benzo[e]indole-3(2H)-carboxylate 61a.
  • Figure 16 shows the synthesis of 2-(pyridin-2-yldisulfanyl)propyl (S)-l- (chloromethyl)-3-(5-((S)-l-(chloromethyl)-5-(phosphonooxy)-lH-benzo[e]indol-3(2H)-yl)-5- oxopentanoyl)-2,3-dihydro-lH-benzo[e]indol-5-ylcarbamate 62 from 51a.
  • Figure 17 shows the synthesis of (S)-3-(6-(4-((S)-2-(acetoxymethyl)pyrrolidine-l- carbonyl)-5-amino-2-methoxyphenoxy)hexanoyl)-l-(chloromethyl)-2,3-dihydro-lH- benzo[e]indol-5-yl 4-methylpiperazine-l-carboxylate 65d from (S)-2,2,2-trichloroethyl 6-(5- (tert-butoxycarbonylamino)-4-(2-(hydroxymethyl)pyrrolidine-l-carbonyl)-2- methoxyphenoxy)hexanoate 54c.
  • Figure 18 shows the synthesis of benzyl alcohol lysine 65g from (S)-2- (allyloxycarbonylamino)-6-(tert-butoxycarbonylamino)hexanoic acid 65e .
  • Figure 19 shows the synthesis of (S)-4-((S)-2-((S)-2-(((9H-fluoren-9- yl)methoxy)carbonylamino)-3-methylbutanamido)-6-(tert- butoxycarbonylamino)hexanamido)benzyl 8-(6-((S)- 1 -(chloromethyl)-5-(4-methylpiperazine- l-carbonyloxy)-lH-benzo[e]indol-3(2H)-yl)-6-oxohexyloxy)-l l-hydroxy-7-methoxy-5-oxo- 2,3,11,1 la-tetrahydro-lH-benzo[e]pyrrolo[l,2-a][l,4]diazepine-10(5H)-carboxylate 65k from (S)-3-(6-(4-((S)-2-(acetoxymethyl)pyrrolidine- 1 -carbon
  • Figure 20 shows the synthesis of (S)-4-((S)-6-amino-2-((S)-2-(6-(2,5-dioxo-2,5- dihydro- 1 H-pyrrol- 1 -yl)hexanamido)-3-methylbutanamido)hexanamido)benzyl 8-(6-((S)- 1 - (chloromethyl)-5-(4-methylpiperazine-l-carbonyloxy)-lH-benzo[e]indol-3(2H)-yl)-6- oxohexyloxy)-l l-hydroxy-7-methoxy-5-oxo-2,3,l 1,1 la-tetrahydro-lH-benzo[e]pyrrolo[l,2- a][l,4]diazepine-10(5H)-carboxylate 65 as the bis-trifluoroacetate salt from 65k.
  • Figure 21 shows the synthesis of (S)-di-tert-butyl l-(chloromethyl)-2,3-dihydro-lH- benzo[e]indol-5-yl phosphate 66d from (S)-tert-butyl 5-(benzyloxy)-l-(chloromethyl)-lH- benzo[e]indole-3(2H)-carboxylate 57a, prepared from 51a.
  • Figure 22 shows the synthesis of N-(3-(2,5-bis((E)-3-((S)-l-(chloromethyl)-5- phosphonoxy-lH-benzo[e]indol-3(2H)-yl)-3-oxoprop-l-enyl)phenylamino)-3-oxopropyl)-6- (2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)hexanamide 66 from (2E,2'E)-tert-butyl 3,3'-(2-nitro- 1 ,4-phenylene)diacrylate 66e.
  • Figure 23 shows the synthesis of N-(3-(2,5-bis((E)-3-((S)-l-(chloromethyl)-5- hydroxy-lH-benzo[e]indol-3(2H)-yl)-3-oxoprop-l-enyl)phenylamino)-3-oxopropyl)-6-(2,5- dioxo-2,5-dihydro-lH-pyrrol-l-yl)hexanamide 67 from (2E,2 * E)-tert-butyl 3,3 * -(2-(3-(((9H- fluoren-9-yl)methoxy)carbonylamino)propanamido)- 1 ,4-phenylene)diacrylate 66g.
  • Figure 24 shows the synthesis of (S)-l-(chloromethyl)-3-((E)-3-(4-((E)-3-((S)-l- (chloromethyl)-5-hydroxy-lH-benzo[e]indol-3(2H)-yl)-3-oxoprop-l-enyl)-2-(3-(6-(2,5- dioxo-2,5-dihydro-lH-pyrrol-l-yl)hexanamido)propanamido)phenyl)acryloyl)-2,3-dihydro- lH-benzo[e]indol-5-yl dihydrogen phosphate 68 from 66d, 67c, 67d.
  • Figure 25 shows the efficacy of antibody-drug conjugates in a plot of SK-BR-3 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio hu anti-CD22 HC A121C- MC-vc-PAB-(CBI dimer) 101 and Thio hu anti-Her2 HC A121C-MC-vc-PAB-(CBI dimer) 102.
  • Figure 26 shows the efficacy of antibody-drug conjugates in a plot of SK-BR-3 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio Hu Anti-Her2 4D5 HC A118C-MC-vc-PAB-(CBI-PBD) 103 and Thio Hu Anti-CD22 10F4v3 HC A118C-MC-vc- PAB-(CBI-PBD) 104
  • Figure 27 shows the efficacy of antibody-drug conjugates in a plot of SK-BR-3 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio Hu Anti-CD22 10F4v3 HC Al 18C-MC-vc-PAB-(CBI dimer) 116 and Thio Hu Anti-Her2 4D5 HC Al 18C-MC-vc-PAB- (CBI dimer) 117.
  • Figure 28 shows the efficacy of antibody-drug conjugates in a plot of EOL-1 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio Hu Anti-CD33 15G15.33 HC Al l 8C-MC-MMED-(CBI dimer phos) 125.
  • Figure 29 shows the efficacy of antibody-drug conjugates in a plot of EOL-1 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio Hu Anti-MUC16 3A5 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 126 and Thio Hu Anti-CD33 15G15.33 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 127.
  • Figure 30 shows the efficacy of antibody-drug conjugates in a plot of EOL-1 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio Hu Anti-CD33 15G15.33 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 127, Thio Hu Anti-CD33 15G15.33 HC Al 18C- MC-ED-(CBI dimer DVB phos) 129, and Thio Hu Anti-MUC16 3A5 HC Al 18C-MC-ED- (CBI dimer DVB phos) 130.
  • Figure 31 shows the efficacy of antibody-drug conjugates in a plot of the in vivo fitted tumor volume change over time in MMTV-HER2 Fo5 transgenic mammary tumors inoculated into the mammary fat pad of CRL nu/nu mice after dosing once IV with: (1) Vehicle: Histidine Buffer #8: 20mM Histidine Acetate, pH 5.5, 240mM Sucrose, 0.02% PS 20, (2) Thio Hu Anti-CD22 10F4v3 HC Al 18C-MC-MMED-(CBI dimer phos) 110, (3) Thio Hu Anti-CD22 10F4v3 HC Al 18C-MC-vc-PAB-(CBI dimer MePip) 108, (4) Thio Hu Anti- CD22 10F4v3 HC Al 18C-MC-vc-PAB-(CBI dimer phos) 111, (5) Thio Hu Anti-Her2 4D5 HC Al 18C-MC-MMED-(CBI dimer
  • Figure 32 shows the efficacy of antibody-drug conjugates in a plot of the in vivo fitted tumor volume change over time in MMTV-HER2 Fo5 transgenic mammary tumors inoculated into the mammary fat pad of CRL nu/nu mice after dosing once IV with: (1) Vehicle: Histidine Buffer #8: 20mM Histidine Acetate, pH 5.5, 240mM Sucrose, 0.02% PS 20, (2) Thio Hu Anti-CD22 10F4v3 HC Al 18C-DSE-(CBI dimer phos) 120, 10 mg/kg, (3) Thio Hu Anti-CD22 10F4v3 HC Al 18C-DSE-(CBI dimer phos) 122, 10 mg/kg, (4) Thio Hu Anti-CD22 10F4v3 HC Al 18C-MC-vc-PAB-(N10,PBD-CBI MePip) 124, 10 mg/kg, (5) Thio Hu Anti-Her2 4D5 HC Al 18C
  • Figure 33 shows the efficacy of antibody-drug conjugates in a plot of the in vivo fitted tumor volume change over time in OVCAR3X2.1 human ovarian tumors inoculated into C.B-17 SCID mice after dosing once IV with: (1) Vehicle: Histidine Buffer #8: 20mM Histidine Acetate, pH 5.5, 240mM Sucrose, 0.02% PS 20, (2) Thio Hu Anti-CD33 15G15.33 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 127, 3 mg/kg, (3) Thio Hu Anti-MUC16 3A5 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 126, 3 mg/kg, (4) Thio Hu Anti-MUC16 3A5 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 126, 1 mg/kg.
  • Vehicle Histidine Buffer #8: 20mM Histidine Acetate, pH 5.5, 240mM Sucrose,
  • Figure 34 shows the efficacy of antibody-drug conjugates in a plot of the in vivo fitted tumor volume change over time in HL-60 human acute myeloid leukemia inoculated into C.B-17 SCID mice after dosing once IV at 20 ⁇ g/m2 with: (1) Vehicle: Histidine Buffer #8: 20mM Histidine Acetate, pH 5.5, 240mM Sucrose, 0.02% PS 20, (2) Thio Hu Anti-CD33 15G15.33 HC Al l 8C-MC-MMED-(CBI dimer phos) 125, (3) Thio Hu Anti-CD33 15G15.33 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 127, (4) Thio Hu Anti-MUC16 3A5 HC Al 18C-MC-MMED-(CBI dimer phos) 128, (5) Thio Hu Anti-MUC16 3A5 HC Al 18C-MC- ED-(CBI dimer DVB diphos) 126.
  • Figure 35a shows efficacy of ADC138 in SCID mice with HL-60 human acute myeloid leukemia tumors.
  • ADC138 demonstrated dose-dependent inhibition of tumor growth compared with vehicle group.
  • the non-targeting control ADC135 had no effect on tumor growth.
  • Figure 35b shows efficacy of ADC139 in SCID mice with HL-60 human acute myeloid leukemia tumors.
  • ADC139 demonstrated clear inhibition of tumor growth compared with vehicle group.
  • the non-targeting control ADC 136 at 1 mg/kg had a modest effect on tumor growth; however, ADC 139 at the matching dose was substantially more effective, resulting in complete tumor remission.
  • Figure 36 shows efficacy of ADC134 in SCID-beige mice with Igrov-1 human ovarian tumors.
  • ADC 134 demonstrated dose-dependent inhibition of tumor growth compared with vehicle group.
  • the non-targeting control ADC137 had no effect on tumor growth.
  • Figure 37 shows the synthesis of N-(3-(2,5-bis((E)-3-((S)-l-(chloromethyl)-5-(4- methylpiperazine- 1 -carbonyloxy)-l H-benzo[e]indol-3(2H)-yl)-3-oxoprop- 1 - enyl)phenylamino)-3-oxopropyl)-6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)hexanamide (Compound No. 69, Table 4).
  • Figure 38 shows the synthesis of 2-(pyridin-2-yldisulfanyl)propyl 2,5-bis((E)-3-((S)- l-(chloromethyl)-5-(phosphonooxy)-lH-benzo[e]indol-3(2H)-yl)-3-oxoprop-l- enyl)phenylcarbamate (Table 4, Compound No. 72, FIG. 38).
  • Figure 39 shows the synthesis of [(lS)-l-(chloromethyl)-3-[(E)-3-[4-[(E)-3-[(lS)-l-
  • Figure 40 shows the synthesis of [(lS)-l-(chloromethyl)-3-[(E)-3-[4-[(E)-3-[(lS)-l- (chloromethyl)-5-phosphonooxy-l,2-dihydrobenzo[e]indol-3-yl]-3-oxo-prop-l-enyl]-2-[2- (2,5-dioxopyrrol- 1 -yl)ethoxy]phenyl]prop-2-enoyl]- 1 ,2-dihydrobenzo[e]indol-5-yl] dihydrogen phosphate (Compound No. 79, Table 4, FIG. 40).
  • Figure 41 shows the synthesis of 2-(2-pyridyldisulfanyl)propyl N-[l-(chloromethyl) 3 -[5 - [ 1 -(chloromethyl)-5 -hydroxy- 1 ,2-dihydrobenzo[e]indol-3 -yl] -5 -oxo-pentanoyl] -1,2- dihydrobenzo[e]indol-5-yl]carbamate (Compound No. 80, Table 4, FIG. 41).
  • Figure 42-43 show the synthesis of 2-(2-pyridyldisulfanyl)propyl 3-[6-[l- (chloromethyl)-5-(4-methylpiperazine-l-carbonyl)oxy-l,2-dihydrobenzo[e]indol-3-yl]-6- oxo-hexoxy]-6-hydroxy-2-methoxy- 11 -oxo-6a,7,8,9-tetrahydro-6H-pyrrolo[2, 1 - c] [ 1 ,4]benzodiazepine-5-carboxylate, 2-(2-pyridyldisulfanyl)propyl 3-[6-[ 1 -(chloromethyl)-
  • Figure 44 shows the synthesis of (15)-l-(chloromethyl)-3-((2E)-3- ⁇ 4-((lE)-3- ⁇ (15)-l (chloromethyl)-5-[(6-methyl- -D-glucopyranuronosyl)oxy]-l,2-dihydro-3H-benzo[e]indol-3 yl ⁇ -3-oxo-l-propenyl)-2-[(3- ⁇ [6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl) hexanoyl] amino propanoyl)amino]phenyl ⁇ -2-propenoyl)- 1 ,2-dihydro-3H-benzo[e]indol-5-yl methyl ⁇ -D glucopyranosiduronate (Compound No. 84, Table 4, FIG. 44).
  • Figure 45 shows the synthesis of (S)-(l-methyl-lH-pyrrole-2,5-diyl)bis(((S)-l- (chloromethyl)-5-hydroxy-lH-benzo[e]indol-3(2H)-yl)methanone) (Compound No. 15, table 1, FIG. 45).
  • Figure 46 shows the synthesis of N-(2,5-bis((E)-3-((S)-l-(chloromethyl)-5-hydroxy- lH-benzo[e]indol-3(2H)-yl)-3-oxoprop-l-enyl)phenyl)acetamide (Compound No. 16, Table 1, FIG. 46).
  • Figure 47 shows the synthesis of (S,2E,2'E)-3,3'-(2-methoxy-l,4-phenylene)bis(l- ((S)- 1 -(chloromethyl)-5 -hydroxy- lH-benzo[e]indol-3(2H)-yl)prop-2-en- 1 -one) (Comopund No. 17, Table 1, FIG. 47).
  • Figure 48 shows the synthesis of (S,2E,2'E)-3,3'-(l-methyl-lH-pyrrole-2,5-diyl)bis(l- ((S)- 1 -(chloromethyl)-5 -hydroxy- lH-benzo[e]indol-3(2H)-yl)prop-2-en- 1 -one) (Compound No. 18 Table 1, FIG. 48).
  • Figure 49 shows the synthesis of (S)-3,3'-(2-methoxy-l,4-phenylene)bis(l-((S)-l- (chloromethyl)-5-hydroxy-lH-benzo[e]indol-3(2H)-yl)prop-2-yn-l-one) (Compound 19, table 1, FIG. 49).
  • antibody herein is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity (Miller et al (2003) Jour, of Immunology 170:4854-4861). Antibodies may be murine, human, humanized, chimeric, or derived from other species. An antibody is a protein generated by the immune system that is capable of recognizing and binding to a specific antigen. (Janeway, C, Travers, P., Walport, M., Shlomchik (2001) Immuno
  • a target antigen generally has numerous binding sites, also called epitopes, recognized by CDRs on multiple antibodies. Each antibody that specifically binds to a different epitope has a different structure. Thus, one antigen may have more than one corresponding antibody.
  • An antibody includes a full-length immunoglobulin molecule or an immunologically active portion of a full-length
  • immunoglobulin molecule i.e., a molecule that contains an antigen binding site that immunospecifically binds an antigen of a target of interest or part thereof, such targets including but not limited to, cancer cell or cells that produce autoimmune antibodies associated with an autoimmune disease.
  • the immunoglobulin disclosed herein can be of any type (e.g., IgG, IgE, IgM, IgD, and IgA), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule.
  • the immunoglobulins can be derived from any species. In one aspect, however, the immunoglobulin is of human, murine, or rabbit origin.
  • Antibody fragments comprise a portion of a full length antibody, generally the antigen binding or variable region thereof.
  • Examples of antibody fragments include Fab, Fab', F(ab') 2 , and Fv fragments; diabodies; linear antibodies; minibodies (Olafsen et al (2004) Protein Eng. Design & Sel. 17(4):315-323), fragments produced by a Fab expression library, anti-idiotypic (anti-Id) antibodies, CDR (complementary determining region), and epitope- binding fragments of any of the above which immunospecifically bind to cancer cell antigens, viral antigens or microbial antigens, single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies
  • Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations which include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies.
  • the modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al (1975) Nature, 256:495, or may be made by recombinant DNA methods (see for example: US 4816567; US 5807715).
  • the monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al (1991) Nature, 352:624-628; Marks et al (1991) J. Mol. Biol, 222:581-597; for example.
  • the monoclonal antibodies herein specifically include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or
  • Chimeric antibodies of interest herein include "primatized" antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g., Old World Monkey, Ape, etc.) and human constant region sequences.
  • a non-human primate e.g., Old World Monkey, Ape, etc.
  • an “intact antibody” herein is one comprising a VL and VH domains, as well as a light chain constant domain (CL) and heavy chain constant domains, CHI, CH2 and CH3.
  • the constant domains may be native sequence constant domains (e.g., human native sequence constant domains) or amino acid sequence variant thereof.
  • the intact antibody may have one or more "effector functions" which refer to those biological activities attributable to the Fc constant region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody. Examples of antibody effector functions include Clq binding;
  • Fc region herein is used to define a C-terminal region of an
  • immunoglobulin heavy chain that contains at least a portion of the constant region.
  • the term includes native sequence Fc regions and variant Fc regions.
  • a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
  • the C-terminal lysine (Lys447) of the Fc region may or may not be present.
  • numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
  • FR Framework or "FR” refers to variable domain residues other than hypervariable region (HVR) residues.
  • the FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
  • immunoglobulin antibodies can be assigned to different "classes.” There are five major classes of intact immunoglobulin antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into “subclasses” (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgA, and IgA2.
  • the heavy-chain constant domains that correspond to the different classes of antibodies are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
  • Ig forms include hinge-modifications or hingeless forms (Roux et al (1998) J. Immunol. 161 :4083-4090; Lund et al (2000) Eur. J. Biochem. 267:7246-7256; US 2005/0048572; US 2004/0229310).
  • a "human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody- encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • a "human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
  • the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3.
  • the subgroup is subgroup kappa I as in Kabat et al, supra.
  • the subgroup is subgroup III as in Kabat et al, supra.
  • a “humanized” antibody refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs.
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
  • a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
  • a "humanized form" of an antibody, e.g., a non-human antibody refers to an antibody that has undergone humanization.
  • hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops ("hypervariable loops").
  • native four-chain antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
  • HVRs generally comprise amino acid residues from the hypervariable loops and/or from the "complementarity determining regions" (CDRs), the latter being of highest sequence variability and/or involved in antigen recognition.
  • CDRs complementarity determining regions
  • Exemplary hypervariable loops occur at amino acid residues 26-32 (LI), 50-52 (L2), 91-96 (L3), 26-32 (HI), 53-55 (H2), and 96-101 (H3).
  • Exemplary CDRs CDR-L1, CDR-L2, CDR-L3, CDR-Hl , CDR-H2, and CDR-H3 occur at amino acid residues 24-34 of LI, 50-56 of L2, 89-97 of L3, 31-35B of HI, 50-65 of H2, and 95-102 of H3.
  • CDRs generally comprise the amino acid residues that form the hypervariable loops.
  • CDRs also comprise "specificity determining residues,” or "SDRs,” which are residues that contact antigen. SDRs are contained within regions of the CDRs called abbreviated-CDRs, or a- CDRs.
  • Exemplary a-CDRs (a-CDR-Ll, a-CDR-L2, a-CDR-L3, a-CDR-Hl , a-CDR-H2, and a-CDR-H3) occur at amino acid residues 31-34 of LI, 50-55 of L2, 89-96 of L3, 31-35B of HI, 50-58 of H2, and 95-102 of H3.
  • HVR residues and other residues in the variable domain are numbered herein according to Kabat et al, supra.
  • variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen.
  • variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions
  • FRs FRs
  • HVRs hypervariable regions
  • a single VH or VL domain may be sufficient to confer antigen-binding specificity.
  • antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al, Nature 352:624-628 (1991).
  • vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked.
  • the term includes the vector as a self- replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
  • Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as "expression vectors.”
  • a “free cysteine amino acid” refers to a cysteine amino acid residue which has been engineered into a parent antibody, has a thiol functional group (-SH), and is not paired as an intramolecular or intermolecular disulfide bridge.
  • Linker means a chemical moiety comprising a chain of atoms that covalently attaches an antibody to a drug moiety.
  • a linker is a divalent radical, specified as L.
  • substituent When indicating the number of substituents, the term “one or more” refers to the range from one substituent to the highest possible number of substitution, i.e. replacement of one hydrogen up to replacement of all hydrogens by substituents.
  • substituted denotes an atom or a group of atoms replacing a hydrogen atom on the parent molecule.
  • substituted denotes that a specified group bears one or more substituents. Where any group may carry multiple substituents and a variety of possible substituents is provided, the substituents are independently selected and need not to be the same.
  • unsubstituted means that the specified group bears no substituents.
  • optionally substituted means that the specified group is unsubstituted or substituted by one or more substituents, independently chosen from the group of possible substituents.
  • substituents independently chosen from the group of possible substituents.
  • one or more means from one substituent to the highest possible number of substitution, i.e. replacement of one hydrogen up to replacement of all hydrogens by substituents.
  • alkyl refers to a saturated linear or branched-chain monovalent hydrocarbon radical of any length from one to twelve carbon atoms (C 1 -C 12 ), wherein the alkyl radical may be optionally substituted independently with one or more substituents described below.
  • an alkyl radical is one to eight carbon atoms (Ci-Cg), or one to six carbon atoms (Ci-C 6 ).
  • alkyl groups include, but are not limited to, methyl (Me, -CH 3 ), ethyl (Et, -CH 2 CH 3 ), 1 -propyl (n-Pr, n-propyl, - CH 2 CH 2 CH 3 ), 2-propyl (i-Pr, i-propyl, -CH(CH 3 ) 2 ), 1 -butyl (n-Bu, n-butyl, - CH 2 CH 2 CH 2 CH 3 ), 2-methyl-l -propyl (i-Bu, i-butyl, -CH 2 CH(CH 3 ) 2 ), 2-butyl (s-Bu, s-butyl, - CH(CH 3 )CH 2 CH 3 ), 2-methyl-2-propyl (t-Bu, t-butyl, -C(CH 3 ) 3 ), 1-pentyl (n-pentyl, - CH 2 CH 2 CH 2 CH 3 ), 2-pentyl (n
  • alkylene refers to a saturated linear or branched-chain divalent hydrocarbon radical of any length from one to twelve carbon atoms (Ci-Ci 2 ), wherein the alkylene radical may be optionally substituted independently with one or more substituents described below.
  • an alkylene radical is one to eight carbon atoms (Ci-C 8 ), or one to six carbon atoms (Ci-C 6 ).
  • alkylene groups include, but are not limited to, methylene (-CH 2 -), ethylene (-CH 2 CH 2 -), propylene (- CH 2 CH 2 CH 2 -), and the like.
  • alkynyl refers to a linear or branched monovalent hydrocarbon radical of any length from two to eight carbon atoms (C 2 -C 8 ) with at least one site of unsaturation, i.e., a carbon-carbon, sp triple bond, wherein the alkynyl radical may be optionally substituted independently with one or more substituents described herein. Examples include, but are not limited to, ethynyl (-C ⁇ CH), propynyl (propargyl, -CH 2 C ⁇ CH), and the like.
  • alkynylene refers to a linear or branched divalent hydrocarbon radical of any length from two to eight carbon atoms (C 2 -C 8 ) with at least one site of unsaturation, i.e., a carbon-carbon, sp triple bond, wherein the alkynylene radical may be optionally substituted independently with one or more substituents described herein. Examples include, but are not limited to, ethynylene (-C ⁇ C-), propynylene (propargylene, -CH 2 C ⁇ C-), and the like.
  • carrier refers to a monovalent non-aromatic, saturated or partially unsaturated ring having 3 to 12 carbon atoms (C 3 -C 12 ) as a monocyclic ring or 7 to 12 carbon atoms as a bicyclic ring.
  • Bicyclic carbocycles having 7 to 12 atoms can be arranged, for example, as a bicyclo [4,5], [5,5], [5,6] or [6,6] system, and bicyclic carbocycles having 9 or 10 ring atoms can be arranged as a bicyclo [5,6] or [6,6] system, or as bridged systems such as bicyclo[2.2.1]heptane, bicyclo[2.2.2]octane and bicyclo[3.2.2]nonane. Spiro moieties are also included within the scope of this definition.
  • Examples of monocyclic carbocycles include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, 1-cyclopent-l-enyl, l-cyclopent-2-enyl, l-cyclopent-3- enyl, cyclohexyl, 1-cyclohex-l-enyl, l-cyclohex-2-enyl, l-cyclohex-3-enyl, cyclohexadienyl, cycloheptyl, cyclooctyl, cyclononyl, cyclodecyl, cycloundecyl, cyclododecyl, and the like.
  • Carbocyclyl groups are optionally substituted independently with one or more substituents described herein.
  • Aryl means a monovalent aromatic hydrocarbon radical of 6-20 carbon atoms (C 6 - C 2 o) derived by the removal of one hydrogen atom from a single carbon atom of a parent aromatic ring system. Some aryl groups are represented in the exemplary structures as "Ar”. Aryl includes bicyclic radicals comprising an aromatic ring fused to a saturated, partially unsaturated ring, or aromatic carbocyclic ring.
  • Typical aryl groups include, but are not limited to, radicals derived from benzene (phenyl), substituted benzenes, naphthalene, anthracene, biphenyl, indenyl, indanyl, 1 ,2-dihydronaphthalene, 1,2,3,4-tetrahydronaphthyl, and the like.
  • Aryl groups are optionally substituted independently with one or more substituents described herein.
  • Arylene means a divalent aromatic hydrocarbon radical of 6-20 carbon atoms (C 6 - C 2 o) derived by the removal of two hydrogen atom from a two carbon atoms of a parent aromatic ring system. Some arylene groups are represented in the exemplary structures as "Ar”. Arylene includes bicyclic radicals comprising an aromatic ring fused to a saturated, partially unsaturated ring, or aromatic carbocyclic ring.
  • Typical arylene groups include, but are not limited to, radicals derived from benzene (phenylene), substituted benzenes, naphthalene, anthracene, biphenylene, indenylene, indanylene, 1 ,2-dihydronaphthalene, 1,2,3,4-tetrahydronaphthyl, and the like.
  • Arylene groups are optionally substituted with one or more substituents described herein.
  • heterocycle heterocyclyl
  • heterocyclic ring heterocyclic ring
  • a heterocycle may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms and 1 to 4 heteroatoms selected from N, O, P, and S) or a bicycle having 7 to 10 ring members (4 to 9 carbon atoms and 1 to 6 heteroatoms selected from N, O, P, and S), for example: a bicyclo [4,5], [5,5], [5,6], or [6,6] system. Heterocycles are described in Paquette, Leo A.;
  • Heterocyclyl also includes radicals where heterocycle radicals are fused with a saturated, partially unsaturated ring, or aromatic carbocyclic or heterocyclic ring.
  • heterocyclic rings include, but are not limited to, morpholin-4-yl, piperidin-l-yl, piperazinyl, piperazin-4-yl-2-one, piperazin-4-yl-3-one, pyrrolidin-l-yl, thiomorpholin-4-yl, S-dioxothiomorpholin-4-yl, azocan-l-yl, azetidin-l-yl, octahydropyrido[l,2-a]pyrazin-2-yl, [l,4]diazepan-l-yl, pyrrolidinyl, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothienyl, tetrahydropyranyl, dihydropyranyl, tetrahydrothiopyranyl, piperidino, morpholino, thiomorpholino, thioxanyl, piperazinyl, homopipe
  • heterocycle groups herein are optionally substituted independently with one or more substituents described herein.
  • heteroaryl refers to a monovalent aromatic radical of 5-, 6-, or 7- membered rings, and includes fused ring systems (at least one of which is aromatic) of 5-20 atoms, containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur.
  • heteroaryl groups are pyridinyl (including, for example, 2- hydroxypyridinyl), imidazolyl, imidazopyridinyl, 1 -methyl- lH-benzo[d]imidazole,
  • the heterocycle or heteroaryl groups may be carbon (carbon-linked), or nitrogen (nitrogen-linked) bonded where such is possible.
  • carbon bonded heterocycles or heteroaryls are bonded at position 2, 3, 4, 5, or 6 of a pyridine, position 3, 4, 5, or 6 of a pyridazine, position 2, 4, 5, or 6 of a pyrimidine, position 2, 3, 5, or 6 of a pyrazine, position 2, 3, 4, or 5 of a furan, tetrahydrofuran, thiofuran, thiophene, pyrrole or tetrahydropyrrole, position 2, 4, or 5 of an oxazole, imidazole or thiazole, position 3, 4, or 5 of an isoxazole, pyrazole, or isothiazole, position 2 or 3 of an aziridine, position 2, 3, or 4 of an azetidine, position 2, 3, 4, 5, 6, 7, or 8 of a quinoline or position 1, 3, 4, 5, 6,
  • nitrogen bonded heterocycles or heteroaryls are bonded at position 1 of an aziridine, azetidine, pyrrole, pyrrolidine, 2-pyrroline, 3- pyrroline, imidazole, imidazolidine, 2-imidazoline, 3 -imidazoline, pyrazole, pyrazoline, 2- pyrazoline, 3-pyrazoline, piperidine, piperazine, indole, indoline, lH-indazole, position 2 of a isoindole, or isoindoline, position 4 of a morpholine, and position 9 of a carbazole, or ⁇ - carboline.
  • chiral refers to molecules which have the property of non-superimposability of the mirror image partner, while the term “achiral” refers to molecules which are superimposable on their mirror image partner.
  • stereoisomers refers to compounds which have identical chemical constitution, but differ with regard to the arrangement of the atoms or groups in space.
  • “Diastereomer” refers to a stereoisomer with two or more centers of chirality and whose molecules are not mirror images of one another. Diastereomers have different physical properties, e.g. melting points, boiling points, spectral properties, and reactivities. Mixtures of diastereomers may separate under high resolution analytical procedures such as electrophoresis and chromatography.
  • Enantiomers refer to two stereoisomers of a compound which are non- superimposable mirror images of one another.
  • d and 1 or (+) and (-) are employed to designate the sign of rotation of plane-polarized light by the compound, with (-) or 1 meaning that the compound is levorotatory.
  • a compound prefixed with (+) or d is dextrorotatory.
  • these stereoisomers are identical except that they are mirror images of one another.
  • a specific stereoisomer may also be referred to as an enantiomer, and a mixture of such isomers is often called an enantiomeric mixture.
  • a 50:50 mixture of enantiomers is referred to as a racemic mixture or a racemate, which may occur where there has been no stereoselection or stereospecificity in a chemical reaction or process.
  • racemic mixture and racemate refer to an equimolar mixture of two enantiomeric species, devoid of optical activity.
  • ADC antibody-drug conjugate
  • exemplary salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucuronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, /?-toluenesulfonate, and pamoate (i.e., 1,1 '-methyl ene-bis -(2-hydroxy-3- naphthoate)) salts.
  • a pharmaceutically acceptable salt may involve the inclusion of another molecule such as an acetate ion, a succinate ion or other counterion.
  • the counterion may be any organic or inorganic moiety that stabilizes the charge on the parent compound.
  • a pharmaceutically acceptable salt may have more than one charged atom in its structure. Instances where multiple charged atoms are part of the pharmaceutically acceptable salt can have multiple counter ions. Hence, a
  • pharmaceutically acceptable salt can have one or more charged atoms and/or one or more counterion.
  • BME beta-mercaptoethanol
  • Boc N-(t-butoxycarbonyl)
  • cit citrulline (2-amino-5-ureido pentanoic acid)
  • DCC 1,3-dicyclohexylcarbodiimide
  • DCM dichloromethane
  • DEA diethylamine
  • DEAD diethylazodicarboxylate
  • DEPC diethylphosphorylcyanidate
  • DIAD diisopropylazodicarboxylate
  • DIEA N,N-diisopropylethylamine
  • DMA is
  • DMAP 4-dimethylaminopyridine
  • DME ethyleneglycol dimethyl ether (or 1,2-dimethoxyethane)
  • DMF is N,N-dimethylformamide
  • DMSO is
  • EDCI is l-(3-dimethylaminopropyl)-3- ethylcarbodiimide hydrochloride
  • EEDQ is 2-ethoxy-l-ethoxycarbonyl-l,2- dihydroquinoline
  • ES-MS is electrospray mass spectrometry
  • EtOAc is ethyl acetate
  • Fmoc is N-(9-fluorenylmethoxycarbonyl)
  • gly is glycine
  • HATU is 0-(7-azabenzotriazol-l-yl)- N,N,N',N'-tetramethyluronium hexafluorophosphate
  • HOBt is 1-hydroxybenzotriazole
  • HPLC high pressure liquid chromatography
  • ile is isoleucine
  • lys is lysine
  • MeCN is 1-hydroxybenzotriazole
  • HPLC high pressure liquid chromatography
  • ile is isoleucine
  • the compounds of the invention include antibody-drug conjugates comprising cysteine engineered antibodies where one or more amino acids of a wild-type or parent antibody are replaced with a cysteine amino acid. Any form of antibody may be so engineered, i.e. mutated.
  • a parent Fab antibody fragment may be engineered to form a cysteine engineered Fab, referred to herein as "ThioFab.”
  • a parent monoclonal antibody may be engineered to form a "ThioMab.”
  • a single site mutation yields a single engineered cysteine residue in a ThioFab, while a single site mutation yields two engineered cysteine residues in a ThioMab, due to the dimeric nature of the IgG antibody.
  • Mutants with replaced (“engineered”) cysteine (Cys) residues are evaluated for the reactivity of the newly introduced, engineered cysteine thiol groups.
  • the thiol reactivity value is a relative, numerical term in the range of 0 to 1.0 and can be measured for any cysteine engineered antibody.
  • Thiol reactivity values of cysteine engineered antibodies of the invention are in the ranges of 0.6 to 1.0; 0.7 to 1.0; or 0.8 to 1.0.
  • Cysteine amino acids may be engineered at reactive sites in an antibody and which do not form intrachain or intermolecular disulfide linkages (Junutula, et al., 2008b Nature Biotech., 26(8):925-932; Dornan et al (2009) Blood 114(13):2721-2729; US 7521541; US 7723485; WO2009/052249, Shen et al (2012) Nature Biotech., 30(2): 184-191; Junutula et al (2008) Jour of Immun. Methods 332:41-52).
  • the engineered cysteine thiols may react with linker reagents or the linker-drug intermediates of the present invention which have thiol- reactive, electrophilic groups such as maleimide or alpha-halo amides to form ADC with cysteine engineered antibodies (ThioMabs) and the drug (D) moiety.
  • the location of the drug moiety can thus be designed, controlled, and known.
  • the drug loading can be controlled since the engineered cysteine thiol groups typically react with thiol-reactive linker reagents or linker-drug intermediates in high yield.
  • Engineering an antibody to introduce a cysteine amino acid by substitution at a single site on the heavy or light chain gives two new cysteines on the symmetrical antibody.
  • a drug loading near 2 can be achieved and near homogeneity of the conjugation product ADC.
  • cysteine engineered antibodies of the invention preferably retain the antigen binding capability of their wild type, parent antibody counterparts.
  • cysteine engineered antibodies are capable of binding, preferably specifically, to antigens.
  • antigens include, for example, tumor-associated antigens (TAA), cell surface receptor proteins and other cell surface molecules, transmembrane proteins, signaling proteins, cell survival regulatory factors, cell proliferation regulatory factors, molecules associated with (for e.g., known or suspected to contribute functionally to) tissue development or differentiation, lymphokines, cytokines, molecules involved in cell cycle regulation, molecules involved in vasculogenesis and molecules associated with (for e.g., known or suspected to contribute functionally to) angiogenesis.
  • TAA tumor-associated antigens
  • the tumor-associated antigen may be a cluster differentiation factor (i.e., a CD protein).
  • An antigen to which a cysteine engineered antibody is capable of binding may be a member of a subset of one of the above-mentioned categories, wherein the other subset(s) of said category comprise other molecules/antigens that have a distinct characteristic (with respect to the antigen of interest).
  • Cysteine engineered antibodies are prepared for conjugation with linker-drug intermediates by reduction and reoxidation of intrachain disulfide groups (Example 19).
  • Cysteine engineered antibodies which may be useful in the antibody-drug conjugates of the invention in the treatment of cancer include, but are not limited to, antibodies against cell surface receptors and tumor-associated antigens (TAA). Tumor-associated antigens are known in the art, and can be prepared for use in generating antibodies using methods and information which are well known in the art. In attempts to discover effective cellular targets for cancer diagnosis and therapy, researchers have sought to identify transmembrane or otherwise tumor-associated polypeptides that are specifically expressed on the surface of one or more particular type(s) of cancer cell as compared to on one or more normal noncancerous cell(s).
  • TAA tumor-associated antigens
  • tumor-associated polypeptides are more abundantly expressed on the surface of the cancer cells as compared to on the surface of the non-cancerous cells.
  • the identification of such tumor-associated cell surface antigen polypeptides has given rise to the ability to specifically target cancer cells for destruction via antibody-based therapies.
  • TAA tumor-associated antigens
  • TAA tumor-associated antigens
  • Tumor-associated antigens targeted by antibodies include all amino acid sequence variants and isoforms possessing at least about 70%, 80%, 85%, 90%, or 95% sequence identity relative to the sequences identified in the cited references, or which exhibit substantially the same biological properties or characteristics as a TAA having a sequence found in the cited references.
  • a TAA having a variant sequence generally is able to bind specifically to an antibody that binds specifically to the TAA with the corresponding sequence listed.
  • BMPR1B bone morphogenetic protein receptor-type IB, Genbank accession
  • NP 001194 bone morphogenetic protein receptor, type IB /pid NP_001194.1 - Cross-references: MIM:603248; NP 001194.1; AY065994
  • WO2004048938 (Example 2); WO2004032842 (Example IV); WO2003042661 (Claim 12); WO2003016475 (Claim 1); WO200278524 (Example 2); WO200299074 (Claim 19; Page 127-129); WO200286443 (Claim 27; Pages 222, 393); WO2003003906 (Claim 10; Page 293); WO200264798 (Claim 33; Page 93-95); WO200014228 (Claim 5; Page 133-136); US2003224454 (Fig 3); WO2003025138 (Claim 12; Page 150);
  • member 5 /pid NP_003477.3 - Homo sapiens
  • EP1394274 (Example 11); WO2004016225 (Claim 2); WO2003042661 (Claim 12);
  • WO200289747 (Example 5; Page 618-619); WO2003022995 (Example 9; Fig 13A, Example 53; Page 173, Example 2; Fig 2A);
  • NP 036581 six transmembrane epithelial antigen of the prostate
  • WO200292836 (Claim 6; Fig 12); WO200283866 (Claim 15; Page 116-121); US2003124140 (Example 16); Cross-references: GL34501467; AAK74120.3; AF361486 1
  • MPF MPF, MSLN, SMR, megakaryocyte potentiating factor, mesothelin
  • Napi3b (NAPI-3B, NPTIIb, SLC34A2, solute carrier family 34 (sodium
  • Sema 5b (FLJ10372, KIAA1445, Mm.42015, SEMA5B, SEMAG, Semaphorin 5b Hlog, sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B, Genbank accession no.
  • WO2003003984 (Claim 1); WO200206339 (Claim 1; Page 50); WO200188133 (Claim 1; Page 41-43, 48-58); WO2003054152 (Claim 20); WO2003101400 (Claim 11);
  • PSCA hlg (2700050C12Rik, C530008O16Rik, RIKEN cDNA 2700050C12, RIKEN cDNA 2700050C12 gene, Genbank accession no. AY358628); Ross et al (2002) Cancer Res. 62:2546-2553; US2003129192 (Claim 2); US2004044180 (Claim 12); US2004044179 (Claim 11); US2003096961 (Claim 11); US2003232056 (Example 5); WO2003105758 (Claim 12); US2003206918 (Example 5); EP 1347046 (Claim 1); WO2003025148 (Claim 20);
  • ETBR Endothelin type B receptor, Genbank accession no. AY275463
  • WO2004048938 (Example 2); WO2004040000 (Claim 151); WO2003087768 (Claim 1); WO2003016475 (Claim 1); WO2003016475 (Claim 1); WO200261087 (Fig 1);
  • WO2003016494 (Fig 6); WO2003025138 (Claim 12; Page 144); WO200198351 (Claim 1; Page 124-125); EP522868 (Claim 8; Fig 2); WO200177172 (Claim 1; Page 297-299);
  • WO2003104275 (Claim 1); WO2004046342 (Example 2); WO2003042661 (Claim 12); WO2003083074 (Claim 14; Page 61); WO2003018621 (Claim 1); WO2003024392 (Claim 2; Fig 93); WO200166689 (Example 6);
  • LocusID 54894; NP_060233.2; NM_017763_1 (11) STEAP2 (HGNC 8639, IPCA-1, PCANAP1, STAMP1, STEAP2, STMP, prostate cancer associated gene 1, prostate cancer associated protein 1, six transmembrane epithelial antigen of prostate 2, six transmembrane prostate protein, Genbank accession no.
  • TrpM4 (BR22450, FLJ20041, TRPM4, TRPM4B, transient receptor potential cation channel, subfamily M, member 4, Genbank accession no. NM_017636)
  • WO200040614 (Claim 14; Page 100-103); WO200210382 (Claim 1; Fig 9 A);
  • WO2003042661 (Claim 12); WO200230268 (Claim 27; Page 391); US2003219806 (Claim 4); WO200162794 (Claim 14; Fig 1A-D);
  • CRIPTO (CR, CRl, CRGF, CRIPTO, TDGFl, teratocarcinoma-derived growth factor, Genbank accession no. NP 003203 or NM 003212)
  • WO200216413 (Claim 1; Page 94-95, 105); WO200222808 (Claim 2; Fig 1); US5854399 (Example 2; Col 17-18); US5792616 (Fig 2);
  • MIM 187395; NP_003203.1; NM_003212_1 (14) CD21 (CR2 (Complement receptor 2) or C3DR (C3d/Epstein Barr virus
  • WO9102536 (Fig 9.1-9.9); WO2004020595 (Claim 1);
  • CD79b (CD79B, CD79 , IGb (immunoglobulin-associated beta), B29, Genbank accession no. NM 000626 or 11038674)
  • WO2003048202 (claim 1, pages 306 and 309); WO 99/558658, US6534482 (claim 13, Fig
  • FcPvH2 (IFGP4, IRTA4, SPAPIA (SH2 domain containing phosphatase anchor protein la), SPAP1B, SPAP1C, Genbank accession no. NM 030764, AY358130)
  • HER2 (ErbB2, Genbank accession no. Ml 1730)
  • NCA (CEACAM6, Genbank accession no. Ml 8728);
  • WO2004031238 WO2003042661 (Claim 12); WO200278524 (Example 2); WO200286443 (Claim 27; Page 427); WO200260317 (Claim 2);
  • WO200222153 (Page 45-47); US2002042366 (Page 20-21); WO200146261 (Page
  • EphB2R (DRT, ERK, Hek5, EPHT3, Tyro5, Genbank accession no. NM 004442) Chan,J. and Watt, V.M., Oncogene 6 (6), 1057-1061 (1991) Oncogene 10 (5):897-905 (1995), Annu. Rev. Neurosci. 21 :309-345 (1998), Int. Rev. Cytol.
  • WO2002102235 (Claim 13; Page 299); US2003091580 (Example 2); WO200210187 (Claim
  • WO200140269 (Example 3; Pages 190-192); WO200036107 (Example 2; Page 205-207);
  • WO2004053079 (Claim 12); WO2003004989 (Claim 1); WO200271928 (Page 233-234,
  • PSCA Prostate stem cell antigen precursor, Genbank accession no. AJ297436
  • WO9851805 (Claim 17; Page 97); W09851824 (Claim 10; Page 94); WO9840403 (Claim 2; Fig IB);
  • AAP14954 lipoma HMGIC fusion-partner-like protein /pid AAP14954.1 - Homo sapiens Species: Homo sapiens (human)
  • WO2003054152 (Claim 20); WO2003000842 (Claim 1); WO2003023013 (Example 3,
  • WO2004011611; WO2003045422 (Example; Page 32-33); WO2003014294 (Claim 35; Fig 6B); WO2003035846 (Claim 70; Page 615-616); WO200294852 (Col 136-137);
  • WO200238766 (Claim 3; Page 133); WO200224909 (Example 3; Fig 3);
  • CD22 B-cell receptor CD22-B isoform, BL-CAM, Lyb-8, Lyb8, SIGLEC-2, FLJ22814, Genbank accession No. AK026467;
  • CD79a (CD79A, CD79a, immunoglobulin-associated alpha, a B cell-specific protein that covalently interacts with Ig beta (CD79B) and forms a complex on the surface with Ig M molecules, transduces a signal involved in B-cell differentiation), pi: 4.84, MW: 25028 TM: 2 [P] Gene Chromosome: 19ql3.2, Genbank accession No. NP 001774.10)
  • CXCR5 Bokitt's lymphoma receptor 1, a G protein-coupled receptor that is activated by the CXCL13 chemokine, functions in lymphocyte migration and humoral defense, plays a role in HIV-2 infection and perhaps development of AIDS, lymphoma, myeloma, and leukemia); 372 aa, pi: 8.54 MW: 41959 TM: 7 [P] Gene Chromosome: l lq23.3, Genbank accession No. NP_001707.1)
  • HLA-DOB Beta subunit of MHC class II molecule (la antigen) that binds peptides and presents them to CD4+ T lymphocytes); 273 aa, pi: 6.56 MW: 30820 TM: 1 [P] Gene Chromosome: 6p21.3, Genbank accession No. NP 002111.1)
  • P2X5 Purinergic receptor P2X ligand-gated ion channel 5, an ion channel gated by extracellular ATP, may be involved in synaptic transmission and neurogenesis, deficiency may contribute to the pathophysiology of idiopathic detrusor instability
  • 422 aa pi: 7.63, MW: 47206 TM: 1
  • Gene Chromosome 17pl3.3, Genbank accession No. NP_002552.2) Le et al (1997) FEBS Lett. 418(1-2): 195-199; WO2004047749; WO2003072035 (claim 10); Touchman et al (2000) Genome Res. 10: 165-173; WO200222660 (claim 20);
  • WO2003093444 (claim 1); WO2003087768 (claim 1); WO2003029277 (page 82); (32) CD72 (B-cell differentiation antigen CD72, Lyb-2) PROTEIN SEQUENCE Full maeaity...tafrfpd (1..359; 359 aa), pi: 8.66, MW: 40225 TM: 1 [P] Gene Chromosome: 9pl3.3, Genbank accession No. NP_001773.1)
  • WO2004042346 (claim 65); WO2003026493 (pages 51-52, 57-58); WO200075655 (pages 105-106); Von Hoegen et al (1990) J. Immunol. 144(12):4870-4877; Strausberg et al (2002) Proc. Natl. Acad. Sci USA 99: 16899-16903;
  • LY64 Lymphocyte antigen 64 (RP105), type I membrane protein of the leucine rich repeat (LRR) family, regulates B-cell activation and apoptosis, loss of function is associated with increased disease activity in patients with systemic lupus erythematosis); 661 aa, pi: 6.20, MW: 74147 TM: 1 [P] Gene Chromosome: 5ql2, Genbank accession No.
  • FcRHl Fc receptor- like protein 1, a putative receptor for the immunoglobulin Fc domain that contains C2 type Ig-like and IT AM domains, may have a role in B-lymphocyte differentiation
  • IRTA2 Immunoglobulin superfamily receptor translocation associated 2, a putative immunoreceptor with possible roles in B cell development and lymphomagenesis
  • TENB2 (TMEFF2, tomoregulin, TPEF, HPP1, TR, putative transmembrane
  • proteoglycan related to the EGF/heregulin family of growth factors and follistatin
  • 374 aa NCBI Accession: AAD55776, AAF91397, AAG49451, NCBI RefSeq: NP 057276; NCBI Gene: 23671; OMIM: 605734; SwissProt Q9UIK5; Genbank accession No. AF179274;
  • WO2004074320 (SEQ ID NO 810); JP2004113151 (SEQ ID NOS 2, 4, 8); WO2003042661
  • WO200230268 page 329
  • WO200190304 SEQ ID NO 2706
  • US2004249130
  • PMEL17 (silver homolog; SILV; D12S53E; PMEL17; (SI); (SIL); ME20; gplOO) BC001414; BT007202; M32295; M77348; NM 006928; McGlinchey, R.P. et al (2009) Proc. Natl. Acad. Sci. U.S.A. 106 (33), 13731-13736; Kummer, M.P. et al (2009) J. Biol. Chem. 284 (4), 2296-2306;
  • TMEFF1 transmembrane protein with EGF-like and two follistatrn-like domains 1; Tomoregulin- 1; H7365; C9orf2; C90RF2; U19878; X83961) NM 080655; NM 003692;
  • GDNF-Ral GDNF family receptor alpha 1; GFRA1; GDNFR; GDNFRA; RETLl; TRNRl; RETIL; GDNFR-alphal; GFR-ALPHA-1; U95847; BC014962; NM 145793)
  • Ly6G6D lymphocyte antigen 6 complex, locus G6D; Ly6-D, MEGT1
  • NP_067079.2 NP_067079.2
  • NM_021246.2 Mallya, M. et al (2002) Genomics 80 (1): 113-123; Ribas, G. et al (1999) J.
  • LGR5 leucme-rich repeat-containing G protein-coupled receptor 5; GPR49, GPR67
  • NP 003658.1 NP 003658.1
  • NM 003667.2 Salanti, G. et al (2009) Am. J. Epidemiol. 170 (5):537-545; Yamamoto, Y. et al (2003) Hepatology 37 (3):528-533;
  • RET ret proto-oncogene; MEN2A; HSCR1; MEN2B; MTC1; (PTC); CDHF12;
  • LY6K lymphocyte antigen 6 complex, locus K; LY6K; HSJ001348; FLJ35226) NP_059997.3; NM_017527.3; Ishikawa, N. et al (2007) Cancer Res. 67 (24): 11601-11611; de Nooij-van Dalen, A.G. et al (2003) Int. J. Cancer 103 (6):768-774; (46) GPR19 (G protein-coupl ed receptor 19; Mm.4787) NP_006134.1; NM_006143.2;
  • GPR54 ISS1 receptor; KISS1R; GPR54; HOT7T175; AXOR12
  • ASPHD1 (aspartate beta-hydroxylase domain containing 1; LOC253982) NP_859069.2; NM_181718.3; Gerhard, D.S. et al (2004) Genome Res. 14 (10B):2121-2127; (49) Tyrosinase (TYR; OCAIA; OCAIA; tyrosinase; SHEP3) NP 000363.1; NM 000372.4; Bishop, D.T. et al (2009) Nat. Genet. 41 (8):920-925; Nan, H. et al (2009) Int. J. Cancer 125 (4):909-917;
  • TMEM118 ring finger protein, transmembrane 2; RNFT2; FLJ14627
  • GPR172A G protein-coupled receptor 172A; GPCR41; FLJ11856; D15Ertd747e
  • the parent antibody may also be a fusion protein comprising an albumin-binding peptide (ABP) sequence (Dennis et al. (2002) “Albumin Binding As A General Strategy For Improving The Pharmacokinetics Of Proteins” J Biol Chem. 277:35035-35043; WO
  • ABSP albumin-binding peptide
  • Antibodies of the invention include fusion proteins with ABP sequences taught by: (i) Dennis et al (2002) J Biol Chem. 277:35035-35043 at Tables III and IV, page 35038; (ii) US 20040001827 at [0076]; and (iii) WO 01/45746 at pages 12-13, and all of which are incorporated herein by reference.
  • DNA encoding an amino acid sequence variant of the starting polypeptide is prepared by a variety of methods known in the art. These methods include, but are not limited to, preparation by site-directed (or oligonucleotide-mediated) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared DNA encoding the polypeptide. Variants of recombinant antibodies may be constructed also by restriction fragment manipulation or by overlap extension PCR with synthetic oligonucleotides. Mutagenic primers encode the cysteine codon replacement(s). Standard mutagenesis techniques can be employed to generate DNA encoding such mutant cysteine engineered antibodies.
  • Antibodies may be produced using recombinant methods and compositions, e.g., as described in US 4816567.
  • isolated nucleic acid encodes an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody).
  • one or more vectors e.g., expression vectors
  • a host cell comprising such nucleic acid is provided.
  • a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
  • the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NSO, Sp20 cell).
  • a method comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
  • nucleic acid encoding an antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
  • nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
  • Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
  • antibodies may be produced in bacteria, in particular when
  • Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
  • Plant cell cultures can also be utilized as hosts, such as those described in US 5959177, US 6040498, US 6420548, US 7125978, and US 6417429 (describing PLANTIBODIESTM technology for producing antibodies in transgenic plants).
  • Vertebrate cells may also be used as hosts.
  • mammalian cell lines that are adapted to grow in suspension may be useful.
  • Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al, J. Gen Virol.
  • TM4 cells as described, e.g., in Mather, Biol. Reprod. 23 :243-251 (1980); monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3 A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al, Annals N. Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
  • CHO Chinese hamster ovary
  • DHFR " CHO cells (Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); and myeloma cell lines such as Y0, NSO and Sp2/0.
  • CHO Chinese hamster ovary
  • myeloma cell lines such as Y0, NSO and Sp2/0.
  • Site-directed mutagenesis is one method for preparing substitution variants, i.e. mutant proteins (Carter (1985) et al Nucleic Acids Res. 13:4431-4443; Ho et al (1989) Gene (Amst.) 77:51-59; and Kunkel et al (1987) Proc. Natl. Acad. Sci. USA 82:488).
  • Starting DNA is altered by first hybridizing an oligonucleotide encoding the desired mutation to a single strand of such starting DNA. After hybridization, a DNA polymerase is used to synthesize an entire second strand, using the hybridized oligonucleotide as a primer, and using the single strand of the starting DNA as a template.
  • the oligonucleotide encoding the desired mutation is incorporated in the resulting double-stranded DNA.
  • Site- directed mutagenesis may be carried out within the gene expressing the protein to be mutagenized in an expression plasmid and the resulting plasmid may be sequenced to confirm the introduction of the desired cysteine replacement mutations (Liu et al (1998) J. Biol. Chem. 273:20252-20260).
  • Site-directed mutagenesis protocols and formats are widely available, e.g. QuikChange® Multi Site-Directed Mutagenesis Kit (Stratagene, La Jolla, CA).
  • PCR mutagenesis is also suitable for making amino acid sequence variants of the starting polypeptide.
  • the starting material is the plasmid (or other vector) comprising the starting polypeptide DNA to be mutated.
  • the codon(s) in the starting DNA to be mutated are identified. There must be a unique restriction endonuclease site on each side of the identified mutation site(s). If no such restriction sites exist, they may be generated using the above described oligonucleotide -mediated
  • oligonucleotide encoding the sequence of the DNA between the restriction sites but containing the desired mutation(s) is synthesized using standard procedures, wherein the two strands of the oligonucleotide are synthesized separately and then hybridized together using standard techniques.
  • This double-stranded oligonucleotide is referred to as the cassette.
  • This cassette is designed to have 5' and 3' ends that are compatible with the ends of the linearized plasmid, such that it can be directly ligated to the plasmid.
  • This plasmid now contains the mutated DNA sequence. Mutant DNA containing the encoded cysteine replacements can be confirmed by DNA sequencing.
  • Single mutations are also generated by oligonucleotide directed mutagenesis using double stranded plasmid DNA as template by PCR based mutagenesis (Sambrook and Russel, (2001) Molecular Cloning: A Laboratory Manual, 3rd edition; Zoller et al (1983) Methods Enzymol. 100:468-500; Zoller, M.J. and Smith, M. (1982) Nucl. Acids Res.
  • one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant.
  • the Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl , IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
  • the invention contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious.
  • Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
  • An antibody-drug conjugate compound of the invention comprises a CBI dimer drug moiety D.
  • a CBI dimer drug moiety may be comprised of two CBI drug units or one CBI drug unit and one PBD drug unit.
  • the CBI dimer drug moiety D has the formula:
  • R 1 is selected from H, P(0) 3 H 2 , C(0)NR a R b ;
  • R 2 is selected from H, P(0) 3 H 2 , C(0)NR a R b ;
  • R a and R b are independently selected from H and Ci-C 6 alkyl optionally substituted with one or more F,
  • R a and R b form a five or six membered heterocyclyl group
  • T is a tether group selected from C 3 -Ci 2 alkylene, Y, (Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene), (Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene), (C 2 -C 6
  • Y is independently selected from O, S, NR 1 , aryl, and heteroaryl;
  • alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with F, OH, 0(Ci-C 6 alkyl), NH 2 , NHCH 3 , N(CH 3 ) 2 , OP(0) 3 H 2 , and Ci-C 6 alkyl, where alkyl is optionally substituted with one or more F; or alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with a bond to L;
  • D' is a drug moiety selected from:
  • X and X' are independently selected from O and NR , where R is selected from H and Ci-C 6 alkyl optionally substituted with one or more F;
  • R 4 is H, C0 2 R, where R is Ci-C 6 alkyl or benzyl;
  • R 5 is H or Ci-C 6 alkyl.
  • Y is phenyl, pyridyl, 1 -methyl- lH-benzo[d]imidazole, or [ 1 ,2,4]triazolo[ 1 ,5-a]pyridine.
  • CBI dimer drug moiety D compounds include those in Table 1 which are useful for preparing Linker-CBI drug intermediates of Table 3.
  • Tether reagents useful for preparing CBI dimer drug moiety D compounds include those in Table 2
  • An antibody-drug conjugate (ADC) compound of the invention comprises a linker L having the formula:
  • Str is a stretcher unit covalently attached to the antibody;
  • Pep is an optional peptide unit of two to twelve amino acid residues,
  • Sp is an optional spacer unit covalently attached to a dimer drug moiety, and
  • m and n are independently selected from 0 and 1.
  • Str has the 1,3-disubstituted, pyrrolidine-2,5-dione (succinimide) formula:
  • R 6 is selected from the group consisting of Ci-Cio alkylene, C3-C8 carbocyclyl, 0-(Ci-C 8 alkyl), arylene, C1-C10 alkylene-arylene, arylene-Ci-Cio alkylene, Ci- C10 alkylene-(C3-C 8 carbocyclyl), (C 3 -C 8 carbocyclyl)-Ci-Cio alkylene, C 3 -C 8 heterocyclyl, C 1 -C 10 alkylene-(C 3 -C 8 heterocyclyl), (C 3 -C 8 heterocyclyl)-Ci-Cio alkylene, C 1 -C 10 alkylene-C(0)N(R 8 )-C 2 -C 6 alkylene-N(R 8 ), N(R 8 )-(C 2 -C 6 alkylene), and
  • the 1,3-disubstituted, pyrrolidine-2,5-dione embodiments of the Str stretcher unit may be formed from conjugation of cysteine thiols of antibodies with the maleimide group of linker-drug intermediates, such as those in Table 4.
  • Str has the formula:
  • R is selected from C1-C10 alkylene, C1-C10 alkylene-O, N(R )-(C 2 -C6 alkylene)-N(R 8 ), N(R 8 )-(C 2 -C 6 alkylene), and (CH 2 CH 2 0) r -CH 2 ; where R 8 is H or Ci-C 6 alkyl, and r is an integer ranging from 1 to 10.
  • Str has the formula:
  • R 9 is selected from Ci-Cio alkylene, Ci-Cio alkylene-O, (C 2 -C6
  • alkylene N(R ), and (CH 2 CH 2 0) r -CH 2 ; where R is H or Ci-C 6 alkyl, and r is an integer ranging from 1 to 10.
  • L forms a disulfide bond with a cysteine amino acid of the antibody
  • R 9 is C 2 -C 6 alkylene-0 where alkylene is optionally substituted with F, OH, 0(Ci-C 6 alkyl), NH 2 , NHCH 3 , N(CH 3 ) 2 , OP(0) 3 H 2 , and Ci-C 6 alkyl, where alkyl is optionally substituted with one or more F.
  • Linker reagents and linker-drug intermediates may have a peptide unit of two to twelve or more amino acid residues.
  • m is 1 and Pep comprises two to twelve amino acid residues independently selected from glycine, alanine, phenylalanine, lysine, arginine, valine, and citrulline.
  • Pep is valine-citrulline.
  • Peptide-linker reagents were prepared as described (WO 2012113847; US 7659241; US 7498298; US 2009/0111756; US 2009/0018086; US 6214345; Dubowchik et al (2002) Bioconjugate Chem. 13(4):855-869).
  • Sp comprises para-aminobenzyl or para- aminobenzyloxycarbonyl.
  • Table 3 shows exemplary Linker reagents useful for preparing Linker-CBI drug intermediates of Table 4.
  • Linker-drug intermediates useful for conjugation to antibodies to prepare antibody- drug conjugates have the formula:
  • X is a reactive functional group selected from maleimide, thiol, amino, bromide, bromoacetamido, iodoacetamido, p-toluenesulfonate, iodide, hydroxyl, carboxyl, pyridyl disulfide, and N-hydroxysuccinimide;
  • L is a linker having the formula:
  • Str is a stretcher unit covalently attached to reactive functional group X;
  • Pep is an optional peptide unit of two to twelve amino acid residues, Sp is an optional spacer unit covalently attached to a dimer drug moiety, and m and n are independently selected from 0 and 1;
  • D is the dimer drug moiety having the formula:
  • R 1 is selected from H, P(0) 3 H 2 , C(0)NR a R b , or a bond to L;
  • R 2 is selected from H, P(0) 3 H 2 , C(0)NR a R b , or a bond to L;
  • R a and R b are independently selected from H and Ci-C 6 alkyl optionally substituted with one or more F, or R a and R b form a five or six membered heterocyclyl group;
  • T is a tether group selected from C 3 -Ci 2 alkylene, Y, (Ci-C 6 alkylene)-Y-(Ci-C6 alkylene), (Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene), (C 2 -C 6
  • Y is independently selected from O, S, NR 1 , aryl, and heteroaryl;
  • alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with F, OH, 0(Ci-C 6 alkyl), NH 2 , NHCH 3 , N(CH 3 ) 2 , OP(0) 3 H 2 , and Ci-C 6 alkyl, where alkyl is optionally substituted with one or more F;
  • alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with a bond to L;
  • D' is a drug moiety selected from:
  • X 1 and X" are independently selected from O and NR , where R is selected from H and Ci-C 6 alkyl optionally substituted with one or more F;
  • R 4 is H, C0 2 R, or a bond to L, where R is Ci-C 6 alkyl or benzyl;
  • R 5 is H or Ci-C 6 alkyl.
  • Linker-drug intermediates of Table 4 were prepared by coupling a CBI dimer drug moiety with a linker reagent, as exemplified in Examples 1-18 and Figures 1-24.
  • H o H o benzo[e]indol-5- yloxy)methyl)phenylamino)- 1 - oxo-5 -ureidopentan-2-ylamino)- 3 -methyl- 1 -oxobutan-2-yl)-6- (2 , 5 -dioxo-2 , 5 -dihydro- 1 H- pyrrol- 1 -yl)hexanamide - - - -
  • the antibody-drug conjugate (ADC) compounds of the invention comprise an antibody specific for a tumor-associated antigen linked to a potent CBI dimer drug moiety, and include those with therapeutic activity, effective against a number of hyperproliferative disorders, including cancer.
  • the biological activity of the drug moiety is modulated by conjugation to an antibody.
  • the ADC of the invention selectively deliver an effective dose of the CBI dimer drug, or toxin, to tumor cell or site whereby greater selectivity, i.e. a lower efficacious dose, may be achieved while increasing the therapeutic index ("therapeutic window").
  • the ADC compounds include a cysteine-engineered antibody conjugated, i.e. covalently attached by a linker, to the CBI dimer drug moiety.
  • An antibody-drug conjugate compound of the invention has the formula: Ab-(L-D) p wherein:
  • Ab is an antibody
  • L is a linker having the formula:
  • Str is a stretcher unit covalently attached to the antibody
  • Pep is an optional peptide unit of two to twelve amino acid residues
  • Sp is an optional spacer unit covalently attached to a dimer drug moiety
  • m and n are independently selected from 0 and 1 ;
  • R 1 is selected from H, P(0) 3 H 2 , C(0)NR a R b , or a bond to L;
  • R 2 is selected from H, P(0) 3 H 2 , C(0)NR a R b , or a bond to L;
  • R a and R b are independently selected from H and Ci-C 6 alkyl optionally substituted with one or more F,
  • R a and R b form a five or six membered heterocyclyl group
  • T is a tether group selected from C 3 -Ci 2 alkylene, Y, (Ci-C 6 alkylene)-Y-(Ci-C6 alkylene), (Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene)-Y-(Ci-C 6 alkylene), (C 2 -C 6
  • Y is independently selected from O, S, NR 1 , aryl, and heteroaryl; where alkylene, alkenylene, aryl, and heteroaryl are independently and optionally substituted with F, OH, 0(Ci-C 6 alkyl), NH 2 , NHCH 3 , N(CH 3 ) 2 , OP(0) 3 H 2 , and Ci-C 6 alkyl, where alkyl is optionally substituted with one or more F;
  • D' is a drug moiety selected from:
  • X 1 and X" are independently selected from O and NR , where R is selected from H and Ci-C 6 alkyl optionally substituted with one or more F;
  • R 4 is H, C0 2 R where R is Ci-C 6 alkyl or benzyl;
  • R 5 is H.
  • R a and R b form a five or six membered heterocyclyl group selected from N-methylpiperazinyl, morpholinyl, piperidyl, and pyrrolidinyl.
  • the drug moiety may is joined to the antibody via a protease cleavable, peptide linker cleavable by cathepsin B, a lysosomal protease found in most mammalian cell types (US 6214345; Dubowchik et al (2002) Bioconj. Chem. 13:855-869).
  • the ADC may act as a pro-drug in that the drug is inactive until the linker is cleaved.
  • the ADC is able to concentrate the active drug specifically in a tumor cell location where disease may be poorly treated by conventional chemotherapy.
  • the drug moiety is attached to the antibody via a non-peptide, non-protease cleavable linker, which may include functionality such as disulfide or succinimidyl groups.
  • a non-peptide, non-protease cleavable linker which may include functionality such as disulfide or succinimidyl groups.
  • the number of drug moieties which may be conjugated via a reactive linker moiety to an antibody molecule may be limited by the number of free cysteine residues, which are introduced by the methods described herein.
  • Exemplary ADC therefore comprise antibodies which have 1, 2, 3, or 4 engineered cysteine amino acids (Lyon, R. et al (2012) Methods in Enzym. 502: 123-138).
  • the antibody-drug conjugate compound has the formula:
  • AAl and AA2 are independently selected from an amino acid side chain.
  • the amino acid side chain is independently selected from H, -CH 3 , -CH 2 (C 6 H 5 ),
  • the antibody-drug conjugate compound has the formula:
  • the antibody-drug conjugate compound has the formula:
  • the antibody-drug conjugate compound has the formula:
  • the antibody-drug conjugate compound has the formula:
  • the antibody-drug conjugate compound has the formula:
  • the antibody-drug conjugate compound has the formula:
  • the antibody-drug conjugate compound has the formula:
  • the antibody-drug conjugate compound has the formula:
  • R 7 is independently selected from H and C1-C12 alkyl.
  • p is 1, 2, 3 or 4. In one embodiment, p is 2.
  • D is a moiety selected from the compounds listed in Table 1 or a derivative thereof.
  • L-D is a moiety seletected from the compounds listed in Table 4 or a derivative thereof.
  • the present invention relates to a conjugate seletected from the molecules listed in Table 5.
  • the drug loading is the average number of CBI drug moieties per antibody.
  • Drug loading may range from 1 to 8 drugs (D) per antibody (Ab), i.e. where 1, 2, 3, 4, 5, 6, 7, and 8 drug moieties are covalently attached to the antibody.
  • Compositions of ADC include collections of antibodies conjugated with a range of drugs, from 1 to 8. The average number of drugs per antibody in preparations of ADC from conjugation reactions may be
  • the quantitative distribution of ADC in terms of p may also be determined.
  • ELISA the averaged value of p in a particular preparation of ADC may be determined (Hamblett et al (2004) Clin. Cancer Res. 10:7063-7070; Sanderson et al (2005) Clin. Cancer Res. 11 :843-852).
  • the distribution of p (drug) values is not discernible by the antibody-antigen binding and detection limitation of ELISA.
  • ELISA assay for detection of antibody-drug conjugates does not determine where the drug moieties are attached to the antibody, such as the heavy chain or light chain fragments, or the particular amino acid residues. In some instances, separation, purification, and
  • characterization of homogeneous ADC where p is a certain value from ADC with other drug loadings may be achieved by means such as reverse phase HPLC or electrophoresis.
  • p may be limited by the number of attachment sites on the antibody.
  • an antibody may have only one or several cysteine thiol groups, or may have only one or several sufficiently reactive thiol groups through which a linker may be attached.
  • Higher drug loading, e.g. p >5, may cause aggregation, insolubility, toxicity, or loss of cellular permeability of certain antibody-drug conjugates.
  • an antibody may contain, for example, many lysine residues that do not react with the linker-drug intermediate (X-L-D) or linker reagent. Only the most reactive lysine groups may react with an amine-reactive linker reagent. Also, only the most reactive cysteine thiol groups may react with a thiol-reactive linker reagent or linker-drug intermediate. Generally, antibodies do not contain many, if any, free and reactive cysteine thiol groups which may be linked to a drug moiety.
  • cysteine thiol residues in the antibodies of the compounds exist as disulfide bridges and must be reduced with a reducing agent such as dithiothreitol (DTT) or TCEP, under partial or total reducing conditions.
  • DTT dithiothreitol
  • the loading (drug/antibody ratio, "DAR") of an ADC may be controlled in several different manners, including: (i) limiting the molar excess of linker-drug intermediate or linker reagent relative to antibody, (ii) limiting the conjugation reaction time or temperature, and (iii) partial or limiting reductive conditions for cysteine thiol modification.
  • the resulting product is a mixture of ADC compounds with a distribution of drug moieties attached to an antibody, e.g. 1, 2, 3, etc.
  • Liquid chromatography methods such as polymeric reverse phase (PLRP) and hydrophobic interaction (HIC) may separate compounds in the mixture by drug loading value.
  • Preparations of ADC with a single drug loading value (p) may be isolated, however, these single loading value ADCs may still be heterogeneous mixtures because the drug moieties may be attached, via the linker, at different sites on the antibody.
  • antibody-drug conjugate compositions of the invention include mixtures of antibody-drug conjugate compounds where the antibody has one or more drug moieties and where the drug moieties may be attached to the antibody at various amino acid residues.
  • Exemplary antibody-drug conjugates (ADC) compounds 101-139 of the invention were prepared from linker-drug intermediates 51-68 according to Example 20 and as shown in Table 4.
  • the anti-CD22 antibodies of ADC in Table 5 comprise three light chain hypervariable regions (HVR-Ll, HVR-L2 and HVR-L3) and three heavy chain hypervariable regions (HVR-H1, HVR-H2 and HVR-H3), according to US 8226945:
  • the anti-MUC16 antibodies of ADC in Table 5 comprise three light chain
  • HVR-Ll hypervariable regions
  • HVR-L2 hypervariable regions
  • HVR-L3 heavy chain hypervariable regions
  • HVR-H1, HVR-H2 and HVR-H3 three heavy chain hypervariable regions
  • HVR-L2 YGATSLET (SEQ ID NO: 8)
  • the anti-MUC16 antibodies of ADC in Table 5 comprise the variable heavy chain sequence of SEQ ID NO: 13 and the variable light chain sequence of SEQ ID NO: 14.
  • the anti-MUC16 antibody of an ADC of the invention is a cysteine-engineered, ThioMab comprising one or more free cysteine amino acid residues located in a light chain sequence selected from SEQ ID NOs: 15-32, or in a heavy chain sequence selected from SEQ ID NOs: 33-46:
  • the anti-MUC16 cysteine-engineered, ThioMab is a humanized antibody comprising the heavy chain sequence of SEQ ID NO:47.
  • EVQLVESGGGLVQPGGSLRLSCAASGYS ITNDYAWNWVRQAPGKGLEWVGYI SYSGYTTY NPSLKSRFTI SRDTSKNTLYLQMNSLRAEDTAVYYCARWTSGLDYWGQGTLVTVSSCSTK GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRE
  • the anti-MUC16 cysteine-engineered, ThioMab is a humanized antibody comprising the light chain sequence of SEQ ID NO:48.
  • the anti-MUC16 cysteine-engineered, ThioMab is a chimeric antibody comprising the heavy chain sequence of SEQ ID NO:49.
  • the anti-MUC16 cysteine-engineered, ThioMab is a chimeric antibody comprising the light chain sequence of SEQ ID NO:50.
  • ADC of Table 5 comprise anti-HER2 antibodies.
  • an anti-HER2 antibody of an ADC of the invention comprises a humanized anti-HER2 antibody, e.g., huMAb4D5-l, huMAb4D5-2, huMAb4D5-3, huMAb4D5-4, huMAb4D5-5, huMAb4D5-6, huMAb4D5-7 and huMAb4D5-8, as described in Table 3 of US 5821337.
  • Those antibodies contain human framework regions with the complementarity-determining regions of a murine antibody (4D5) that binds to HER2.
  • the humanized antibody huMAb4D5-8 is also referred to as trastuzumab, commercially available under the tradename HERCEPTIN®.
  • an anti-HER2 antibody of an ADC of the invention comprises a humanized anti-HER2 antibody, e.g., humanized 2C4, as described in US7862817.
  • An exemplary humanized 2C4 antibody is pertuzumab, commercially available under the tradename PERJETA®.
  • the cysteine-engineered Thiomab antibodies used to prepare the ADC of Table 5 have a cysteine residue introduced at the 118-alanine site (EU numbering) of the heavy chain. This site is numbered 121 by Sequential numbering or 114 by Kabat numbering.
  • the anti-CD33 antibody 15G15.33 of ADC in Table 5 comprises three light chain hypervariable regions (HVR-L1, HVR-L2 and HVR-L3) and three heavy chain hypervariable regions (HVR-H1, HVR-H2 and HVR-H3)
  • HVR-H3 EWADVFD (SEQ ID NO: 56
  • the anti-CD33 antibody 15G15.33 of ADC in Table 5 comprises the light chain variable region of SEQ ID NO:57 and/or the heavy chain variable region of SEQ ID NO:58.
  • the invention provides an anti-CD33 antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:62; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:63; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:64; (d)
  • HVR-Ll comprising the amino acid sequence of SEQ ID NO:59; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:60; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:61.
  • the invention provides an antibody comprising at least one, at least two, or all three VH HVR sequences selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:62; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 63; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 64 .
  • the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO: 64.
  • the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:64 and HVR-L3 comprising the amino acid sequence of SEQ ID NO:61.
  • the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:64, HVR-L3 comprising the amino acid sequence of SEQ ID NO:61, and HVR-H2 comprising the amino acid sequence of SEQ ID NO: 63.
  • the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:62; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:63; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 64.
  • the invention provides an antibody comprising at least one, at least two, or all three VL HVR sequences selected from (a) HVR-Ll comprising the amino acid sequence of SEQ ID NO:59; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:60; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:61.
  • the antibody comprises (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO:59; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:60; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:61.
  • an antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from (i) HVR- Hl comprising the amino acid sequence of SEQ ID NO:62, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 63, and (iii) HVR-H3 comprising an amino acid sequence selected from SEQ ID NO:64; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from (i) HVR-L1 comprising the amino acid sequence of SEQ ID NO:59, (ii) HVR-L2 comprising the amino acid sequence of SEQ ID NO:60, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:61.
  • the invention provides an antibody comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:62; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:63; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:64; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:59; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:60; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:61.
  • an anti-CD33 antibody is humanized.
  • an anti-CD33 antibody comprises HVRs as in any of the above embodiments, and further comprises a human acceptor framework, e.g. a human immunoglobulin framework or a human consensus framework.
  • the human acceptor framework is the human VL kappa I consensus (VL K i) framework and/or the VH framework VHi.
  • the human acceptor framework is the human VL kappa I consensus (VL KI ) framework and/or the VH framework VHi comprising any one of the following mutations.
  • an anti-CD33 antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, and/or SEQ ID NO:72.
  • VH heavy chain variable domain
  • a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the amino acid sequence of SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, and/or SEQ ID NO:72 contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-CD33 antibody comprising that sequence retains the ability to bind to CD33.
  • a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, and/or SEQ ID NO:72.
  • the anti- CD33 antibody comprises the VH sequence of SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, and/or SEQ ID NO:72, including post-translational modifications of that sequence.
  • the VH comprises one, two or three HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:62, (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:63, and (c) HVR- H3 comprising the amino acid sequence of SEQ ID NO: 64.
  • an anti-CD33 antibody comprising a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:65, SEQ ID NO:67, SEQ ID NO:69, and/or SEQ ID NO:71.
  • VL light chain variable domain
  • a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the amino acid sequence of SEQ ID NO:65, SEQ ID NO:67, SEQ ID NO:69, and/or SEQ ID NO:71 contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-CD33 antibody comprising that sequence retains the ability to bind to CD33.
  • a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO:65, SEQ ID NO:67, SEQ ID NO:69, and/or SEQ ID NO:71.
  • the anti-CD33 antibody comprises the VL sequence of SEQ ID NO:65, SEQ ID NO:67, SEQ ID NO:69, and/or SEQ ID NO:71, including post-translational modifications of that sequence.
  • the VL comprises one, two or three HVRs selected from (a) HVR-Ll comprising the amino acid sequence of SEQ ID NO:59; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:60; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:61.
  • an anti-CD33 antibody comprising a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above.
  • the antibody comprises the VH and VL sequences in SEQ ID NO: 66 and SEQ ID NO: 65, respectively, including post-translational modifications of those sequences.
  • the antibody comprises the VH and VL sequences in SEQ ID NO:68 and SEQ ID NO:67, respectively, including post-translational modifications of those sequences.
  • the antibody comprises the VH and VL sequences in SEQ ID NO:70 and SEQ ID NO:69, respectively, including post-translational modifications of those sequences.
  • the antibody comprises the VH and VL sequences in SEQ ID NO: 72 and SEQ ID NO:71, respectively, including post-translational modifications of those sequences.
  • an antibody that binds to the same epitope as an anti-CD33 antibody comprising a VH sequence of SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, and/or SEQ ID NO:72 and a VL sequence of SEQ ID NO:65, SEQ ID NO:67, SEQ ID NO:69, and/or SEQ ID NO:71, respectively.
  • an anti-CD33 antibody is a monoclonal antibody, including a human antibody.
  • an anti-CD33 antibody is an antibody fragment, e.g., a Fv, Fab, Fab', scFv, diabody, or F(ab') 2 fragment.
  • the antibody is a substantially full length antibody, e.g., an IgGl antibody, IgG2a antibody or other antibody class or isotype as defined herein.
  • an anti-CD33 antibody according to any of the above
  • the cytotoxic or cytostatic activity of an antibody-drug conjugate is measured by: exposing mammalian cells having receptor proteins, e.g. HER2, to the antibody of the ADC in a cell culture medium; culturing the cells for a period from about 6 hours to about 5 days; and measuring cell viability.
  • Cell-based in vitro assays were used to measure viability (proliferation), cytotoxicity, and induction of apoptosis (caspase activation) of the ADC of the invention.
  • ADC antibody-drug conjugates
  • the CellTiter-Glo ® Luminescent Cell Viability Assay is a commercially available
  • the homogeneous assay procedure involves adding the single reagent (CellTiter-Glo ® Reagent) directly to cells cultured in serum-supplemented medium. Cell washing, removal of medium and multiple pipetting steps are not required.
  • the system detects as few as 15 cells/well in a 384-well format in 10 minutes after adding reagent and mixing.
  • the cells may be treated continuously with ADC, or they may be treated and separated from ADC. Generally, cells treated briefly, i.e. 3 hours, showed the same potency effects as continuously treated cells.
  • the homogeneous "add-mix-measure” format results in cell lysis and generation of a luminescent signal proportional to the amount of ATP present.
  • the amount of ATP is directly proportional to the number of cells present in culture.
  • the CellTiter-Glo ® Assay generates a "glow-type" luminescent signal, produced by the luciferase reaction, which has a half-life generally greater than five hours, depending on cell type and medium used. Viable cells are reflected in relative luminescence units (RLU).
  • the substrate, Beetle Luciferin is oxidatively decarboxylated by recombinant firefly luciferase with concomitant conversion of ATP to AMP and generation of photons.
  • ADC antibody-drug conjugate
  • Mammalian cells useful for cell proliferation assays for anti- MUC16 ADC include: (1) a MUC16 polypeptide-expressing cell line OVCAR-3; (2) a PC3- derived cell line engineered to stably express a portion of the MUC16 polypeptide on its cell surface (PC3/MUC16); (3) the parental PC3 cell line that does not express the MUC16 polypeptide; and (4) a PC3 cell line that does not express MUC16 polypeptide but carries the vector used to drive exogenous MUC16 expression (PC3/neo).
  • Figure 25 shows the efficacy of antibody-drug conjugates in a plot of SK-BR-3 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio hu anti-CD22 HC A121C- MC-vc-PAB-(CBI dimer) 101 and Thio hu anti-Her2 HC A121C-MC-vc-PAB-(CBI dimer) 102.
  • the Her2 antigen is highly expressed in SK-BR-3 cells.
  • the anti-Her2 ADC 102 shows linear, non-dose response cell-killing activity whereas control, off-target anti-CD22 ADC 101 shows less activity.
  • Figure 26 shows the efficacy of antibody-drug conjugates in a plot of SK-BR-3 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio Hu Anti-Her2 4D5 HC A118C-MC-vc-PAB-(CBI-PBD) 103 and Thio Hu Anti-CD22 10F4v3 HC A118C-MC-vc- PAB-(CBI-PBD) 104.
  • the anti-Her2 ADC 103 shows linear, non-dose response cell-killing activity whereas control, off-target anti-CD22 ADC 104 shows less activity.
  • Figure 27 shows the efficacy of antibody-drug conjugates in a plot of SK-BR-3 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio Hu Anti-CD22 10F4v3 HC Al 18C-MC-vc-PAB-(CBI dimer) 116 and Thio Hu Anti-Her2 4D5 HC Al 18C-MC-vc-PAB- (CBI dimer) 117.
  • the anti-Her2 ADC 117 shows linear, non-dose response cell-killing activity whereas control, off-target anti-CD22 ADC 116 shows less activity.
  • Figure 28 shows the efficacy of antibody-drug conjugates in a plot of EOL-1 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio Hu Anti-CD33 15G15.33 HC Al 18C-MC-MMED-(CBI dimer phos) 125 which shows modest dose response cell-killing activity.
  • Figure 29 shows the efficacy of antibody-drug conjugates in a plot of EOL-1 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio Hu Anti-MUC16 3A5 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 126 and Thio Hu Anti-CD33 15G15.33 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 127.
  • the anti-CD33 ADC 127 shows potent, dose responsive cell-killing activity whereas control, off-target anti-MUC16 ADC 126 shows less activity.
  • Figure 30 shows the efficacy of antibody-drug conjugates in a plot of EOL-1 in vitro cell viability at 3 days versus concentrations ⁇ g/ml) of Thio Hu Anti-CD33 15G15.33 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 127, Thio Hu Anti-CD33 15G15.33 HC Al 18C- MC-ED-(CBI dimer DVB phos) 129, and Thio Hu Anti-MUC16 3A5 HC Al 18C-MC-ED- (CBI dimer DVB phos) 130.
  • the anti-CD33 ADC 127 and 129 shows potent, dose responsive cell-killing activity whereas control, off-target anti-MUC16 ADC 130 shows less activity.
  • the in vivo efficacy of antibody-drug conjugates (ADC) of the invention can be measured by tumor xenograft studies in mice (Example 22).
  • the in vivo efficacy of antibody-drug conjugates (ADC) was measured tumor growth inhibition in mice (Example 21).
  • the ADC showed surprising and unexpected potency in inhibition of tumor growth. Efficacy of the ADC was correlated with target antigen expression of the tumor cells.
  • the efficacy of antibody-drug conjugates were measured in vivo by implanting allografts or xenografts of cancer cells in rodents and treating the tumors with ADC.
  • the in vivo efficacy of the ADC was measured using a transgenic explant mouse model expressing moderate to high levels of a tumor-associated antigen, such as Her2, MUC16, and CD33. Subjects were treated once with ADC and monitored over 3-6 weeks to measure the time to tumor doubling, log cell kill, and tumor shrinkage. Follow up dose- response and multi-dose experiments were conducted.
  • a tumor-associated antigen such as Her2, MUC16, and CD33.
  • the in vivo efficacy of an anti-HER2 ADC of the invention can be measured by a high expressing HER2 transgenic explant mouse model (Phillips et al (2008) Cancer Res. 68:9280-90).
  • An allograft is propagated from the Fo5 mmtv transgenic mouse which does not respond to, or responds poorly to, HERCEPTIN® therapy.
  • Subjects were treated once with ADC at certain dose levels (mg/kg) and placebo buffer control (Vehicle) and monitored over two weeks or more to measure the time to tumor doubling, log cell kill, and tumor shrinkage.
  • Figure 31 shows the efficacy of antibody-drug conjugates in a plot of the in vivo fitted tumor volume change over time in MMTV-HER2 Fo5 transgenic mammary tumors inoculated into the mammary fat pad of CRL nu/nu mice after dosing once IV with: (1) Vehicle: Histidine Buffer #8: 20mM Histidine Acetate, pH 5.5, 240mM Sucrose, 0.02% PS 20, (2) Thio Hu Anti-CD22 10F4v3 HC Al 18C-MC-MMED-(CBI dimer phos) 110, (3) Thio Hu Anti-CD22 10F4v3 HC Al 18C-MC-vc-PAB-(CBI dimer MePip) 108, (4) Thio Hu Anti- CD22 10F4v3 HC Al 18C-MC-vc-PAB-(CBI dimer phos) 111, (5) Thio Hu Anti-Her2 4D5 HC Al 18C-MC-MMED-(CBI dimer
  • Figure 32 shows the efficacy of antibody-drug conjugates in a plot of the in vivo fitted tumor volume change over time in MMTV-HER2 Fo5 transgenic mammary tumors inoculated into the mammary fat pad of CRL nu/nu mice after dosing once IV with: (1) Vehicle: Histidine Buffer #8: 20mM Histidine Acetate, pH 5.5, 240mM Sucrose, 0.02% PS 20, (2) Thio Hu Anti-CD22 10F4v3 HC Al 18C-DSE-(CBI dimer phos) 120, 10 mg/kg, (3) Thio Hu Anti-CD22 10F4v3 HC Al 18C-DSE-(CBI dimer phos) 122, 10 mg/kg, (4) Thio Hu Anti-CD22 10F4v3 HC Al 18C-MC-vc-PAB-(N10,PBD-CBI MePip) 124, 10 mg/kg, (5) Thio Hu Anti-Her2 4D5 HC Al 18C
  • Figure 33 shows the efficacy of antibody-drug conjugates in a plot of the in vivo fitted tumor volume change over time in OVCAR3X2.1 human ovarian tumors inoculated into C.B-17 SCID mice after dosing once IV with: (1) Vehicle: Histidine Buffer #8: 20mM Histidine Acetate, pH 5.5, 240mM Sucrose, 0.02% PS 20, (2) Thio Hu Anti-CD33 15G15.33 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 127, 3 mg/kg, (3) Thio Hu Anti-MUC 16 3 A5 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 126, 3 mg/kg, (4) Thio Hu Anti-MUC 16 3A5 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 126, 1 mg/kg.
  • Vehicle Histidine Buffer #8: 20mM Histidine Acetate, pH 5.5, 240mM Sucrose,
  • the anti-MUC16 antibody of ADC 126 and including 3A5 and 1 ID 10 variants, have been described in WO 2007/001851; US 7989595; US 8449883, the contents of which are incorporated by reference.
  • the 3A5 monoclonal antibody binds multiple sites of the MUC16 polypeptide with 433 pM affinity by OVCAR-3 Scatchard analysis (Chen et al (2007) Cancer Res. 67(10): 4924-4932)
  • Figure 34 shows the efficacy of antibody-drug conjugates in a plot of the in vivo fitted tumor volume change over time in HL-60 human acute myeloid leukemia inoculated into C.B-17 SCID mice after dosing once IV at 20 ⁇ g/m2 with: (1) Vehicle: Histidine Buffer #8: 20mM Histidine Acetate, pH 5.5, 240mM Sucrose, 0.02% PS 20, (2) Thio Hu Anti-CD33 15G15.33 HC Al l 8C-MC-MMED-(CBI dimer phos) 125, (3) Thio Hu Anti-CD33 15G15.33 HC Al 18C-MC-ED-(CBI dimer DVB diphos) 127, (4) Thio Hu Anti-MUC 16 3A5 HC Al 18C-MC-MMED-(CBI dimer phos) 128, (5) Thio Hu Anti-MUC16 3A5 HC Al 18C-MC- ED-(CBI dimer DVB diphos) 126.
  • the antibody-drug conjugates (ADC) of the invention may be administered by any route appropriate to the condition to be treated.
  • the ADC will typically be administered parenterally, i.e. infusion, subcutaneous, intramuscular, intravenous, intradermal, intrathecal and epidural.
  • compositions of therapeutic antibody-drug conjugates (ADC) of the invention are typically prepared for parenteral administration, i.e. bolus, intravenous, intratumor injection with a pharmaceutically acceptable parenteral vehicle and in a unit dosage injectable form.
  • An antibody-drug conjugate (ADC) having the desired degree of purity is optionally mixed with pharmaceutically acceptable diluents, carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences (1980) 16th edition, Osol, A. Ed.), in the form of a lyophilized formulation or an aqueous solution.
  • the antibody-drug conjugates (ADC) of the present invention may be used to treat various diseases or disorders, e.g. characterized by the overexpression of a tumor antigen.
  • exemplary conditions or hyperproliferative disorders include benign or malignant solid tumors and hematological disorders such as leukemia and lymphoid malignancies.
  • Others include neuronal, glial, astrocytal, hypothalamic, glandular,
  • the disease or disorder to be treated is a hyperproliferative disease such as cancer.
  • cancer to be treated herein include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g.
  • lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
  • lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer,
  • Autoimmune diseases for which the ADC compounds may be used in treatment include rheumatologic disorders (such as, for example, rheumatoid arthritis, Sjogren's syndrome, scleroderma, lupus such as systemic lupus erythematosus (SLE) and lupus nephritis, polymyositis/dermatomyositis, cryoglobulinemia, anti-phospholipid antibody syndrome, and psoriatic arthritis), osteoarthritis, autoimmune gastrointestinal and liver disorders (such as, for example, inflammatory bowel diseases (e.g., ulcerative colitis and Crohn's disease), autoimmune gastritis and pernicious anemia, autoimmune hepatitis, primary biliary cirrhosis, primary sclerosing cholangitis, and celiac disease), vasculitis (such as, for example, ANCA-associated vasculitis, including Churg-Strauss vasculitis,
  • More preferred such diseases include, for example, rheumatoid arthritis, ulcerative colitis, ANCA-associated vasculitis, lupus, multiple sclerosis, Sjogren's syndrome, Graves' disease, IDDM, pernicious anemia, thyroiditis, and
  • an ADC for the prevention or treatment of disease, the appropriate dosage of an ADC will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the molecule is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician.
  • the molecule is suitably administered to the patient at one time or over a series of treatments.
  • about 1 ⁇ g/kg to 15 mg/kg (e.g. 0.1-20 mg/kg) of molecule is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
  • a typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above.
  • An exemplary dosage of ADC to be administered to a patient is in the range of about 0.1 to about 10 mg/kg of patient weight
  • an article of manufacture containing materials useful for the treatment of the disorders described above.
  • the article of manufacture comprises a container and a label or package insert on or associated with the container.
  • Suitable containers include, for example, bottles, vials, syringes, blister pack, etc.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container holds an antibody-drug conjugate (ADC) composition which is effective for treating the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • ADC antibody-drug conjugate
  • At least one active agent in the composition is an ADC.
  • the label or package insert indicates that the composition is used for treating the condition of choice, such as cancer.
  • the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
  • linker-drug intermediate 52 was prepared ( Figures 7 and 8).
  • Trifluoroacetic acid (3.9 mL) and H 2 0 (0.1 mL) were added to a solution of 53c (66 mg, 0.125 mmol) in DCM (4 mL) at 0 °C. The mixture was stirred at 0 °C for 1 h 20 min, then ice and H 2 0 were added. The mixture was basified to pH 8 with saturated aqueous
  • Example 3 a l-((S)-5 -amino- l-(chloromethyl)- lH-benzo[e]indol-3(2H)-yl)-5-((S)- l-(chloromethyl)-5-hydroxy-lH-benzo[e]indol-3(2H)-yl)pentane-l,5-dione 53j
  • Acetic acid (HO Ac, 8 mL) was added to a stirred solution of 53i (190 mg, 0.261 mmol) in THF-H 2 0 (24 mL/12 mL) at r.t. and the mixture stirred overnight. After 19 h the mixture was diluted with H 2 0 and a solid precipitated out. The THF was removed under vacuum and the aqueous suspension treated with DIPEA until neutral. The solid was collected by filtration, washed with H 2 0 and dried. The solid was dissolved in DMF (1.5 mL) and diluted with MeOH causing a solid to precipitate.
  • the material was further purified by preparative HPLC (column: Synergi-MAX RP 4 ⁇ , 21.20 x 250 mm; flow rate: 13 mL/min; mobile phase: solvent A: H 2 0/TFA pH 2.5, solvent B: MeCN/H 2 0 90: 10; method: isocratic, solvent A:solvent B 20:80, 15 min; wavelength: 254 nm, 330 nm) to give l-((S)-5 -amino- 1- (chloromethyl)- 1 H-benzo[e]indol-3 (2H)-yl)-5 -((S)- 1 -(chloromethyl)-5 -hydroxy- 1 H- benzo[e]indol-3(2H)-yl)pentane-l,5-dione 53j, 30 mg, 22%, HPLC purity: 87.9%) as a white solid.
  • Example 3b 1 -((R)-5 -amino- 1 -(chloromethyl)- lH-benzo[e]indol-3(2H)-yl)-5-((R)- l-(chloromethyl)-5-hydroxy-lH-benzo[e]indol-3(2H)-yl)pentane-l ,5-dione 53p
  • Triethylamine (Et 3 N, 0.54 mL, 3.89 mmol) and triflic anhydride (0.60 mL, 3.60 mmol) were added to a stirred solution of (R)-tert-butyl l-(chloromethyl)-5 -hydroxy- 1H- benzo[e]indole-3(2H)-carboxylate 53k (1.00 g, 3.00 mmol) in DCM (100 mL) at 0 °C ( Figure 4). The reaction was stirred at 0 °C for 20 min, then diluted with H 2 0, the layers were separated and the aqueous layer was extracted with DCM (1 x).
  • Hydrogen chloride gas (HC1 (g) was bubbled through a solution of 53a (300 mg, 0.604 mmol) in dry dioxane (10 mL) (over 3 A molecular sieves) at r.t. After 10 min a solid had precipitated out of solution and the solvent was removed under vacuum after 20 mins. The crude solid, (R)-l-(chloromethyl)-N-(diphenylmethylene)-2,3-dihydro-lH- benzo[e]indol-5-amine 53m was used in the next step without purification.
  • Acetic acid (HO Ac, 4 mL) was added to a stirred solution of 53o (80 mg, 0.110 mmol) in THF-H 2 0 (12 mL/6 mL) at r.t. and the mixture stirred overnight. After 18 h the mixture was diluted with H 2 0 and a solid precipitated out. The THF was removed under vacuum and the aqueous suspension treated with DIPEA until pH 8, resulting in the precipitation of more solid.
  • the solid was collected and washed successively with 0.01% NH 4 OH (3x100 mL), water (3x100 mL), and petroleum ether (3x100 mL). The solid was dried to give the anilino derivative of 54g (1.16 g, 100%) which was treated with 6-(2,5-dioxo-2,5- dihydro-lH-pyrrol-l-yl)hexanoic acid (253 mg, 1.20 mmol), EDCI.HC1 (576 mg, 3.00 mmol) and anhydrous TsOH (34.4 mg, 0.20 mmol) in dry DMA (2 mL). The mixture was stirred at r.t. and under nitrogen for 17 h.
  • Reduction Method A 55a (1.53 g, 3.26 mmol) was dissolved in THF-acetone (75 mL/60 mL). H 2 0 (30 mL) was added once 55a had dissolved. NH 4 C1 (10.5 g, 196 mmol) and Zn powder (6.40 g, 97.9 mmol) were added and the resulting mixture stirred at r.t., under nitrogen for 1 h. The reaction mixture was then filtered through celite, the celite plug washed with DCM and the combined filtrates washed with H 2 0 (lx), dried (Na 2 S0 4 ) and solvent removed under vacuum to give compound 55b as an orange solid. The crude product was used in the next step without purification.
  • Boc removal Method A TFA (9.5 mL) was added portion wise to a suspension of 55e (685 mg, 0.747 mmol) in DCM (19 mL) at 0 °C. The reaction mixture was stirred at 0 °C for 1 h 45 min. Aqueous NH 3 (0.25%>, 100 mL) was then added portion wise to the mixture at 0 °C, followed by the addition of concentrated aqueous NH 3 until pH 9-10. Hexanes:EtOAc 90: 10 were then added and the mixture stirred at 0 °C for 40 mins, the suspension sonicated and the precipitate collected by filtration, washed with H 2 0, H 2 0:MeOH 80:20,
  • Boc removal Method B BF 3 .Et 2 0 (0.07 mL, 0.552 mmol) was added to a suspension of 55e (0.106 g, 0.116 mmol) in DCM (40 mL), at 0 °C. After 1 h 50 mins the suspension was concentrated under vacuum at r.t. until only a little DCM remained. A little MeOH was added until the precipitate dissolved and the solution was then diluted with H 2 0. A solid precipitated out and the H 2 0 was decanted. Hexanes:EtOAc 90: 10 (20 mL) were added and the suspension sonicated before the solid was collected by filtration.
  • Diisopropylethyl amine, DIPEA (10 mg, 0.0774 mmol) in DMF (3 mL) was added to 55h (74 mg, 0.0712 mmol) and 2,5-dioxopyrrolidin-l-yl 6-(2,5-dioxo-2,5-dihydro-lH-pyrrol- l-yl)hexanoate (33 mg, 0.107 mmol), and the resulting mixture stirred at r.t., under nitrogen.
  • N-Fmoc compound 56c (0.89 g, 0.70 mmol) in dry DMA (6 mL) at 0 °C under a nitrogen atmosphere was added a solution of piperidine in DMA (1.0 mmol per mL solution) (3.48 mL, 3.48 mmol). After addition, the mixture was stirred further at this temperature for 1.5 h. A mixture of ethyl acetate-petroleum ether (1 :2) (90 mL) was added and the mixture was stirred at 0 °C for 10 min. The solvent layer was decanted from the insoluble material and discarded.
  • the aqueous phase was extracted with ethyl acetate three times.
  • the combined organic extracts were washed with water and brine, dried over anhydrous Na 2 S0 4 , and filtered through celite.
  • the solvent was removed by rotary evaporator and the excess benzyl bromide was pumped off.
  • the aqueous phase was acidified using IN HC1 to a pH of 2 and extracted with ethyl acetate three times.
  • the combined ethyl acetate extracts were washed with water and brine, dried over anhydrous Na 2 S0 4 , and filtered through a silica gel pad washing with a mixture of MeOH and ethyl acetate (v/v 1 : 10).
  • the solvent was removed to give (S)-5-(5- (benzyloxy)-l-(chloromethyl)-lH-benzo[e]indol-3(2H)-yl)-5-oxopentanoic acid 57c as an off-white solid (978 mg, 59%).
  • the solution was washed with aqueous NaHC0 3 , cold aqueous 5% citric acid, and brine, then dried over anhydrous Na 2 S0 4 , and filtered through a silica gel pad washing with ethyl acetate.
  • the mixture was redistributed between ethyl acetate and cold dilute aqueous NaHC0 3 .
  • the aqueous phase was extracted with ethyl acetate three times.
  • the combined organic extracts were washed with water followed by brine, dried over anhydrous Na 2 S0 4 , and filtered through celite. The solvent was removed and the resultant residue was triturated with petroleum ether.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Public Health (AREA)
  • Cell Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Biotechnology (AREA)
  • Oncology (AREA)
  • Gynecology & Obstetrics (AREA)
  • Pregnancy & Childbirth (AREA)
  • Reproductive Health (AREA)
  • Hematology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Nitrogen Condensed Heterocyclic Rings (AREA)
  • Indole Compounds (AREA)
PCT/US2014/042560 2013-08-12 2014-06-16 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment Ceased WO2015023355A1 (en)

Priority Applications (25)

Application Number Priority Date Filing Date Title
CN201480055557.3A CN105636612B (zh) 2013-08-12 2014-06-16 抗体-药物缀合物及使用和治疗方法
MX2016001862A MX2016001862A (es) 2013-08-12 2014-06-16 Compuestos de conjugado anticuerpo-farmaco dimerico de 1-(clorometil)-2,3-dihidro-1h-benzo[e]indol, y metodos de uso y tratamiento.
JP2016533294A JP6993084B2 (ja) 2013-08-12 2014-06-16 1-(クロロメチル)-2,3-ジヒドロ-1h-ベンゾ[e]インドール二量体抗体 - 薬物コンジュゲート化合物、並びに使用及び処置の方法
AU2014307080A AU2014307080B2 (en) 2013-08-12 2014-06-16 1-(chloromethyl)-2,3-dihydro-1H-benzo(E)indole dimer antibody-drug conjugate compounds, and methods of use and treatment
CA2918139A CA2918139A1 (en) 2013-08-12 2014-06-16 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
EA201690195A EA201690195A1 (ru) 2013-08-12 2014-06-16 Конъюгатные соединения антитело-лекарство на основе димера 1-(хлорметил)-2,3-дигидро-1h-бензо[e]индола и способы применения и лечения
HK16110804.7A HK1222566B (zh) 2013-08-12 2014-06-16 抗體-藥物綴合物及使用和治療方法
KR1020167006280A KR20160042080A (ko) 2013-08-12 2014-06-16 1-(클로로메틸)-2,3-디히드로-1H-벤조[e]인돌 이량체 항체-약물 접합체 화합물, 및 사용 및 치료 방법
BR112016002829A BR112016002829A2 (pt) 2013-08-12 2014-06-16 Composto e processo para preparar o composto de conjugado anticorpo-¿droga, composição farmacêutica, método de tratamento do câncer, kit para o tratamento do câncer, intermediário ligante¿-droga, porção e composto de porção droga de dímero cbi
EP14736243.8A EP3033111B1 (en) 2013-08-12 2014-06-16 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
SG11201601005XA SG11201601005XA (en) 2013-08-12 2014-06-16 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
MA38812A MA38812B1 (fr) 2013-08-12 2014-06-16 Conjugués anticorps-médicament dimérique 1-(chlorométhyl)-2,3-dihydro-1 h-benzo [e]indole, et méthodes d'utilisation et de traitement
HK16110669.1A HK1222544B (en) 2013-08-12 2014-06-16 1-(chloromethyl)-2, 3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
BR112016013258A BR112016013258A2 (pt) 2013-12-16 2014-12-16 composto conjugado anticorpo-droga, composição farmacêutica, método para tratar câncer e kit
PCT/US2014/070637 WO2015095212A1 (en) 2013-12-16 2014-12-16 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
MX2016007578A MX2016007578A (es) 2013-12-16 2014-12-16 Compuestos de conjugado anticuerpo-farmaco dimerico de 1-(clorometil)-2,3-dihidro-1h-benzo [e] indol, y metodos de uso y tratamiento.
CN201480068615.6A CN105828840B (zh) 2013-12-16 2014-12-16 1-(氯甲基)-2,3-二氢-1H-苯并[e]吲哚二聚体抗体-药物缀合物化合物及使用和治疗方法
KR1020167018430A KR20160092024A (ko) 2013-12-16 2014-12-16 1-(클로로메틸)-2,3-디히드로-1H-벤조[e]인돌 이량체 항체-약물 접합체 화합물, 및 사용 및 치료 방법
CA2929565A CA2929565A1 (en) 2013-12-16 2014-12-16 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
EP14830914.9A EP3082876B1 (en) 2013-12-16 2014-12-16 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
JP2016558547A JP6980384B2 (ja) 2013-12-16 2014-12-16 1−(クロロメチル)−2,3−ジヒドロ−1h−ベンゾ[e]インドール二量体抗体−薬物コンジュゲート化合物、並びに使用及び処置の方法
IL243586A IL243586A0 (en) 2013-08-12 2016-01-12 Antibody-drug conjugate compounds of dimer of 1-(chloromethyl)-3,2-dihydro-1h-benzo[e]indole and methods of use and treatment
PH12016500246A PH12016500246A1 (en) 2013-08-12 2016-02-04 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
CR20160125A CR20160125A (es) 2013-08-12 2016-03-11 Compuestos de conjugado anticuerpo-fármaco dimérico de 1-(clorometil)-2,3-dihidro-1h-benzo[e]indol, y métodos de uso y tratamiento
US15/182,444 US10544215B2 (en) 2013-12-16 2016-06-14 1-(Chloromethyl)-2,3-dihydro-1H-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201361864889P 2013-08-12 2013-08-12
US61/864,889 2013-08-12
US201361916388P 2013-12-16 2013-12-16
US61/916,388 2013-12-16
US201461969499P 2014-03-24 2014-03-24
US61/969,499 2014-03-24

Related Child Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2014/070637 Continuation-In-Part WO2015095212A1 (en) 2013-12-16 2014-12-16 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment

Publications (1)

Publication Number Publication Date
WO2015023355A1 true WO2015023355A1 (en) 2015-02-19

Family

ID=51134439

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2014/042560 Ceased WO2015023355A1 (en) 2013-08-12 2014-06-16 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment

Country Status (17)

Country Link
US (1) US10442836B2 (cg-RX-API-DMAC7.html)
EP (1) EP3033111B1 (cg-RX-API-DMAC7.html)
JP (2) JP6993084B2 (cg-RX-API-DMAC7.html)
KR (1) KR20160042080A (cg-RX-API-DMAC7.html)
CN (1) CN105636612B (cg-RX-API-DMAC7.html)
AU (1) AU2014307080B2 (cg-RX-API-DMAC7.html)
BR (1) BR112016002829A2 (cg-RX-API-DMAC7.html)
CA (1) CA2918139A1 (cg-RX-API-DMAC7.html)
CL (1) CL2016000318A1 (cg-RX-API-DMAC7.html)
CR (1) CR20160125A (cg-RX-API-DMAC7.html)
EA (1) EA201690195A1 (cg-RX-API-DMAC7.html)
IL (1) IL243586A0 (cg-RX-API-DMAC7.html)
MX (1) MX2016001862A (cg-RX-API-DMAC7.html)
PH (1) PH12016500246A1 (cg-RX-API-DMAC7.html)
SG (1) SG11201601005XA (cg-RX-API-DMAC7.html)
TW (1) TWI636792B (cg-RX-API-DMAC7.html)
WO (1) WO2015023355A1 (cg-RX-API-DMAC7.html)

Cited By (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016040856A2 (en) 2014-09-12 2016-03-17 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2016040868A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anti-cll-1 antibodies and immunoconjugates
WO2016151432A1 (en) 2015-03-20 2016-09-29 Pfizer Inc. Bifunctional cytotoxic agents containing the cti pharmacophore
WO2016205176A1 (en) * 2015-06-15 2016-12-22 Genentech, Inc. Antibodies and immunoconjugates
US20170002074A1 (en) * 2013-12-13 2017-01-05 Genentech, Inc. Anti-cd33 antibodies and immunoconjugates
CN106380508A (zh) * 2015-07-28 2017-02-08 上海皓元生物医药科技有限公司 一种抗体偶联药物连接子的工业化生产方法
WO2017064675A1 (en) 2015-10-16 2017-04-20 Genentech, Inc. Hindered disulfide drug conjugates
WO2017072295A1 (de) * 2015-10-29 2017-05-04 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Bifunktionale prodrugs
WO2017201449A1 (en) 2016-05-20 2017-11-23 Genentech, Inc. Protac antibody conjugates and methods of use
WO2017205741A1 (en) 2016-05-27 2017-11-30 Genentech, Inc. Bioanalytical method for the characterization of site-specific antibody-drug conjugates
WO2017223275A1 (en) 2016-06-24 2017-12-28 Mersana Therapeutics, Inc. Pyrrolobenzodiazepines and conjugates thereof
WO2018031662A1 (en) 2016-08-11 2018-02-15 Genentech, Inc. Pyrrolobenzodiazepine prodrugs and antibody conjugates thereof
JP2018076307A (ja) * 2014-01-27 2018-05-17 ファイザー・インク 二官能性細胞毒性剤
KR20180054849A (ko) * 2015-10-02 2018-05-24 제넨테크, 인크. 피롤로벤조디아제핀 항체 약물 콘쥬게이트 및 이의 사용 방법
JP2018513120A (ja) * 2015-03-09 2018-05-24 ハイデルベルク ファルマ ゲゼルシャフト ミット ベシュレンクテル ハフツング 新規アマトキシン−抗体コンジュゲート
US10124069B2 (en) 2013-12-16 2018-11-13 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
EP3441386A1 (en) * 2017-08-11 2019-02-13 Georg-August-Universität Göttingen Method for the synthesis of monoprotected bifunctional prodrugs and antibody drug conjugates based thereon as well as a method for preparing antibody drug conjugates
EP3455225A1 (en) * 2016-05-13 2019-03-20 Femtogenix Limited Asymmetric conjugate compounds
US10501545B2 (en) 2015-06-16 2019-12-10 Genentech, Inc. Anti-CLL-1 antibodies and methods of use
US10533058B2 (en) 2013-12-16 2020-01-14 Genentech Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
US10544215B2 (en) 2013-12-16 2020-01-28 Genentech, Inc. 1-(Chloromethyl)-2,3-dihydro-1H-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
US10556895B2 (en) 2014-12-03 2020-02-11 Genentech, Inc. Quaternary amine compounds and antibody-drug conjugates thereof
WO2020089811A1 (en) 2018-10-31 2020-05-07 Novartis Ag Dc-sign antibody drug conjugates
WO2020123275A1 (en) 2018-12-10 2020-06-18 Genentech, Inc. Photocrosslinking peptides for site specific conjugation to fc-containing proteins
US10689458B2 (en) 2015-11-30 2020-06-23 Pfizer Inc. Site specific HER2 antibody drug conjugates
WO2020157491A1 (en) 2019-01-29 2020-08-06 Femtogenix Limited G-a crosslinking cytotoxic agents
JP2021006531A (ja) * 2015-07-12 2021-01-21 ハンジョウ ディーエーシー バイオテック シーオー.,エルティディ.Hangzhou Dac Biotech Co.,Ltd. 細胞結合分子の共役のための架橋連結体
EP3782654A1 (en) 2014-09-12 2021-02-24 Genentech, Inc. Anti-her2 antibodies and immunoconjugates
US10973920B2 (en) 2014-06-30 2021-04-13 Glykos Finland Oy Saccharide derivative of a toxic payload and antibody conjugates thereof
US11147852B2 (en) 2011-12-23 2021-10-19 Pfizer Inc. Engineered antibody constant regions for site-specific conjugation and methods and uses therefor
WO2022020288A1 (en) 2020-07-21 2022-01-27 Genentech, Inc. Antibody-conjugated chemical inducers of degradation of brm and methods thereof
US11364303B2 (en) 2017-09-29 2022-06-21 Pfizer Inc. Cysteine engineered antibody drug conjugates
EP3936151A4 (en) * 2019-03-07 2023-01-11 ABL Bio, Inc. ANTIBODY-DRUG CONJUGATE AND USE OF THE DRUG
WO2023147328A1 (en) 2022-01-26 2023-08-03 Genentech, Inc. Antibody-conjugated chemical inducers of degradation with hydolysable maleimide linkers and methods thereof
WO2023147329A1 (en) 2022-01-26 2023-08-03 Genentech, Inc. Antibody-conjugated chemical inducers of degradation and methods thereof
WO2024224112A1 (en) * 2023-04-28 2024-10-31 Iksuda Therapeutics Limited Antibody-drug conjugate compounds, and methods of use and treatment

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2799540A1 (en) 2010-06-08 2011-12-15 Genentech, Inc. Cysteine engineered antibodies and conjugates
CN107029242A (zh) 2015-11-03 2017-08-11 财团法人工业技术研究院 抗体药物复合物及其制造方法
CA3005454A1 (en) 2015-11-18 2017-05-26 Sorrento Therapeutics, Inc. Chemically-locked bispecific antibodies
WO2017214024A1 (en) * 2016-06-06 2017-12-14 Genentech, Inc. Silvestrol antibody-drug conjugates and methods of use
JP7050770B2 (ja) * 2016-10-05 2022-04-08 エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト 抗体薬物コンジュゲートの調製方法
JP2019530707A (ja) * 2016-10-10 2019-10-24 セレラント セラピューティクス インコーポレイテッド イソキノリジノベンゾジアゼピン(iqb)−1(クロロメチル)−2,3−ジヒドロ−1h−ベンゾ[e]インドール(cbi)二量体
CA3084459A1 (en) 2016-10-16 2018-04-19 Cellerant Therapeutics, Inc. Anti-il1-rap antibodies
US10864279B2 (en) 2016-12-16 2020-12-15 Industrial Technology Research Institute Linker-drug and antibody-drug conjugate (ADC) employing the same
CN115192732B (zh) * 2021-04-01 2025-02-18 成都百利多特生物药业有限责任公司 一种dna毒性二聚体化合物及其偶联物
AU2022447933A1 (en) * 2022-03-25 2023-11-09 Systimmune, Inc. Dna toxic dimer compound and conjugate thereof
WO2025247391A1 (en) * 2024-05-31 2025-12-04 Hutchmed Limited Novel pi3k and/or pikk inhibitors, antibody-drug conjugates comprising the same and uses thereof
CN118873667B (zh) * 2024-09-14 2025-08-05 哈尔滨医科大学 Lat1抑制剂在制备治疗动脉粥样硬化的药物中的应用

Citations (269)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
WO1991002536A1 (en) 1989-08-23 1991-03-07 Scripps Clinic And Research Foundation Compositions and methods for detection and treatment of epstein-barr virus infection and immune disorders
WO1992007574A1 (en) 1990-10-25 1992-05-14 Tanox Biosystems, Inc. Glycoproteins associated with membrane-bound immunoglobulins as antibody targets on b cells
WO1992017497A1 (en) 1991-03-29 1992-10-15 Genentech, Inc. Human pf4a receptors and their use
EP0522868A1 (en) 1991-07-12 1993-01-13 SHIONOGI SEIYAKU KABUSHIKI KAISHA trading under the name of SHIONOGI & CO. LTD. A human endothelin receptor
JPH053790B2 (cg-RX-API-DMAC7.html) 1983-11-02 1993-01-18 Canon Kk
WO1994010312A1 (fr) 1992-10-23 1994-05-11 Chugai Seiyaku Kabushiki Kaisha Codage de genes pour potentiateur de megacaryocyte
WO1994028931A1 (en) 1993-06-11 1994-12-22 Genentech, Inc. Methods for treating inflammatory disorders
US5440021A (en) 1991-03-29 1995-08-08 Chuntharapai; Anan Antibodies to human IL-8 type B receptor
WO1996030514A1 (en) 1995-03-31 1996-10-03 University Of Washington Intracellular domain of the her-2/neu protein for prevention or treatment of malignancies
US5583024A (en) 1985-12-02 1996-12-10 The Regents Of The University Of California Recombinant expression of Coleoptera luciferase
WO1997007198A2 (en) 1995-08-11 1997-02-27 Genetics Institute, Inc. Dna sequences and secreted proteins encoded thereby
US5644033A (en) 1992-12-22 1997-07-01 Health Research, Inc. Monoclonal antibodies that define a unique antigen of human B cell antigen receptor complex and methods of using same for diagnosis and treatment
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
WO1997044452A1 (en) 1996-05-17 1997-11-27 Schering Corporation Human b-cell antigens, related reagents
US5700670A (en) 1995-04-13 1997-12-23 Mitsubishi Chemical Corporation Method for producing optically active ester of γ-substituted-β-hydroxybutyric acid
US5773223A (en) 1993-09-02 1998-06-30 Chiron Corporation Endothelin B1, (ETB1) receptor polypeptide and its encoding nucleic acid methods, and uses thereof
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5792616A (en) 1990-05-29 1998-08-11 The United States Of America Antibodies to human cripto protein
WO1998037193A1 (en) 1997-02-20 1998-08-27 Zymogenetics, Inc. Zcytor7 cytokine receptor
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
WO1998040403A1 (en) 1997-03-10 1998-09-17 The Regents Of The University Of California Psca: prostate stem cell antigen
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
EP0875569A1 (en) 1997-04-28 1998-11-04 Smithkline Beecham Corporation A human sodium dependent phosphate transporter (IPT-1)
WO1998051824A1 (en) 1997-05-15 1998-11-19 Abbott Laboratories Reagents and methods useful for detecting disease of the urinary tract
WO1998051805A1 (en) 1997-05-15 1998-11-19 Abbott Laboratories Reagents and methods useful for detecting diseases of the prostate
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US5854399A (en) 1991-08-23 1998-12-29 The United States Of America As Represented By The Department Of Health And Human Services Antibodies specific for human cripto-related polypeptide CR-3
US5869445A (en) 1993-03-17 1999-02-09 University Of Washington Methods for eliciting or enhancing reactivity to HER-2/neu protein
WO1999028468A1 (en) 1997-12-02 1999-06-10 The Regents Of The University Of California Modulating b lymphocyte chemokine/receptor interactions
WO1999046284A2 (en) 1998-03-13 1999-09-16 The Burnham Institute Molecules that home to various selected organs or tissues
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US5976551A (en) 1991-11-15 1999-11-02 Institut Pasteur And Institut Nationale De La Sante Et De La Recherche Medicale Altered major histocompatibility complex (MHC) determinant and method of using the determinant
WO1999058658A2 (en) 1998-05-13 1999-11-18 Epimmune, Inc. Expression vectors for stimulating an immune response and methods of using the same
WO2000012130A1 (en) 1998-08-27 2000-03-09 Smithkline Beecham Corporation Rp105 agonists and antagonists
WO2000014228A1 (en) 1998-09-03 2000-03-16 Japan Science And Technology Corporation Neutral amino acid transporter and gene thereof
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
WO2000020579A1 (en) 1998-10-02 2000-04-13 Mcmaster University Spliced form of erbb-2/neu oncogene
WO2000022129A1 (en) 1998-10-13 2000-04-20 Arena Pharmaceuticals, Inc. Non-endogenous, constitutively activated human g protein-coupled receptors
WO2000032752A1 (en) 1998-12-02 2000-06-08 The Regents Of The University Of California Psca: prostate stem cell antigen and uses thereof
WO2000036107A2 (en) 1998-12-17 2000-06-22 Corixa Corporation Compositions and methods for therapy and diagnosis of ovarian cancer
WO2000040614A2 (en) 1998-12-30 2000-07-13 Beth Israel Deaconess Medical Center, Inc. Characterization of the soc/crac calcium channel protein family
WO2000044899A1 (en) 1999-01-29 2000-08-03 Corixa Corporation Her-2/neu fusion proteins
WO2000053216A2 (en) 1999-03-05 2000-09-14 Smithkline Beecham Biologicals S.A. Use of casb616 polypeptides and polynucleotides for cancer treatment
WO2000055351A1 (en) 1999-03-12 2000-09-21 Human Genome Sciences, Inc. Human colon cancer associated gene sequences and polypeptides
US6153408A (en) 1991-11-15 2000-11-28 Institut Pasteur And Institut National De La Sante Et De La Recherche Medicale Altered major histocompatibility complex (MHC) determinant and methods of using the determinant
WO2000075655A1 (fr) 1999-06-03 2000-12-14 Takeda Chemical Industries, Ltd. Procede de criblage avec cd100
WO2001000244A2 (en) 1999-06-25 2001-01-04 Genentech, Inc. METHODS OF TREATMENT USING ANTI-ErbB ANTIBODY-MAYTANSINOID CONJUGATES
WO2001016318A2 (en) 1999-09-01 2001-03-08 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US6214345B1 (en) 1993-05-14 2001-04-10 Bristol-Myers Squibb Co. Lysosomal enzyme-cleavable antitumor drug conjugates
WO2001038490A2 (en) 1999-11-29 2001-05-31 The Trustees Of Columbia University In The City Of New York ISOLATION OF FIVE NOVEL GENES CODING FOR NEW Fc RECEPTORS-TYPE MELANOMA INVOLVED IN THE PATHOGENESIS OF LYMPHOMA/MELANOMA
WO2001040269A2 (en) 1999-11-30 2001-06-07 Corixa Corporation Compositions and methods for therapy and diagnosis of breast cancer
WO2001040309A2 (en) 1999-10-29 2001-06-07 Genentech, Inc. Anti-prostate stem cell antigen (psca) antibody compositions and methods of use
WO2001041787A1 (en) 1999-12-10 2001-06-14 Epimmune Inc. INDUCING CELLULAR IMMUNE RESPONSES TO HER2/neu USING PEPTIDE AND NUCLEIC ACID COMPOSITIONS
WO2001046232A2 (en) 1999-12-23 2001-06-28 Zymogenetics, Inc. Soluble interleukin-20 receptor
WO2001046261A1 (en) 1999-12-23 2001-06-28 Zymogenetics, Inc. Method for treating inflammation
WO2001045746A2 (en) 1999-12-24 2001-06-28 Genentech, Inc. Methods and compositions for prolonging elimination half-times of bioactive compounds
WO2001048204A1 (en) 1999-12-23 2001-07-05 Agresearch Limited Mutated bmp1b receptor as regulator of ovulation rate
WO2001053463A2 (en) 2000-01-21 2001-07-26 Corixa Corporation COMPOUNDS AND METHODS FOR PREVENTION AND TREATMENT OF HER-2/neu ASSOCIATED MALIGNANCIES
WO2001057188A2 (en) 2000-02-03 2001-08-09 Hyseq, Inc. Novel nucleic acids and polypeptides
WO2001062794A2 (en) 2000-02-22 2001-08-30 Millennium Pharmaceuticals, Inc. 18607, a human calcium channel
WO2001066689A2 (en) 2000-03-07 2001-09-13 Hyseq, Inc. Novel nucleic acids and polypeptides
WO2001072830A2 (de) 2000-03-31 2001-10-04 Ipf Pharmaceuticals Gmbh Diagnostik- und arzneimittel zur untersuchung des zelloberflächenproteoms von tumor- und entzündungszellen sowie zur behandlung von tumorerkrankungen und entzündlichen erkrankungen vorzugsweise mit hilfe einer spezifischen chemokinrezeptor-analyse und der chemokinrezeptor-ligand-interaktion
WO2001072962A2 (en) 2000-03-24 2001-10-04 Fahri Saatcioglu Novel prostate-specific or testis-specific nucleic acid molecules, polypeptides, and diagnostic and therapeutic methods
WO2001075177A2 (en) 2000-04-03 2001-10-11 The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Tumor markers in ovarian cancer
WO2001077172A2 (en) 2000-04-07 2001-10-18 Arena Pharmaceuticals, Inc. Non-endogenous, constitutively activated known g protein-coupled receptors
WO2001088133A2 (en) 2000-05-18 2001-11-22 Lexicon Genetics Incorporated Human semaphorin homologs and polynucleotides encoding the same
WO2001090304A2 (en) 2000-05-19 2001-11-29 Human Genome Sciences, Inc. Nucleic acids, proteins, and antibodies
WO2001094641A2 (en) 2000-06-09 2001-12-13 Idec Pharmaceuticals Corporation Gene targets and ligands that bind thereto for treatment and diagnosis of ovarian carcinomas
US20010055751A1 (en) 1997-03-10 2001-12-27 Reiter Robert E PSCA: Prostate stem cell antigen and uses thereof
WO2001098351A2 (en) 2000-06-16 2001-12-27 Incyte Genomics, Inc. G-protein coupled receptors
WO2002002634A2 (en) 2000-06-30 2002-01-10 Incyte Genomics, Inc. Human extracellular matrix and cell adhesion polypeptides
WO2002002587A1 (en) 2000-06-30 2002-01-10 Human Genome Sciences, Inc. B7-like polynucleotides, polypeptides, and antibodies
WO2002002624A2 (en) 2000-06-30 2002-01-10 Amgen, Inc. B7-like molecules and uses thereof
WO2002006317A2 (en) 2000-07-17 2002-01-24 Corixa Corporation Compositions and methods for the therapy and diagnosis of ovarian cancer
WO2002006339A2 (en) 2000-07-03 2002-01-24 Curagen Corporation Proteins and nucleic acids encoding same
WO2002010382A2 (en) 2000-07-28 2002-02-07 Ulrich Wissenbach Trp8, trp9 and trp10, markers for cancer
WO2002010187A1 (en) 2000-07-27 2002-02-07 Mayo Foundation For Medical Education And Research B7-h3 and b7-h4, novel immunoregulatory molecules
WO2002012341A2 (en) 2000-08-03 2002-02-14 Corixa Corporation Her-2/neu fusion proteins
WO2002014503A2 (en) 2000-08-14 2002-02-21 Corixa Corporation Compositions and methods for the therapy and diagnosis of her-2/neu-associated malignancies
WO2002013847A2 (en) 2000-08-14 2002-02-21 Corixa Corporation Methods for diagnosis and therapy of hematological and virus-associated malignancies
WO2002016413A2 (en) 2000-08-24 2002-02-28 Glaxosmithkline Biologicals S.A. Cripto tumour polypeptide
WO2002016429A2 (en) 2000-08-24 2002-02-28 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
US20020034749A1 (en) 1997-11-18 2002-03-21 Billing-Medel Patricia A. Reagents and methods useful for detecting diseases of the breast
WO2002022808A2 (en) 2000-09-18 2002-03-21 Biogen, Inc. Cripto mutant and uses thereof
WO2002022153A2 (en) 2000-09-15 2002-03-21 Zymogenetics, Inc. Use of a polypeptide comprising the extracellular domains of il-20rb for the treatment of inflammation
WO2002022660A2 (en) 2000-09-11 2002-03-21 Hyseq, Inc. Novel nucleic acids and polypeptides
WO2002022636A1 (en) 2000-09-15 2002-03-21 Isis Pharmaceuticals, Inc. Antisense modulation of her-2 expression
WO2002024909A2 (en) 2000-09-18 2002-03-28 Biogen, Inc. Receptor nucleic acids and polypeptides
US20020042366A1 (en) 1999-12-23 2002-04-11 Penny Thompson Method for treating inflammation
WO2002030268A2 (en) 2000-10-13 2002-04-18 Eos Biotechnology, Inc. Methods of diagnosis of prostate cancer, compositions and methods of screening for modulators of prostate cancer
WO2002038766A2 (en) 2000-11-07 2002-05-16 Zymogenetics, Inc. Human tumor necrosis factor receptor
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
WO2002054940A2 (en) 2001-01-12 2002-07-18 University Of Medicine & Dentistry Of New Jersey Bone morphogenetic protein-2 in the treatment and diagnosis of cancer
WO2002059377A2 (en) 2001-01-24 2002-08-01 Protein Design Labs Methods of diagnosis of breast cancer, compositions and methods of screening for modulators of breast cancer
WO2002061087A2 (en) 2000-12-19 2002-08-08 Lifespan Biosciences, Inc. Antigenic peptides, such as for g protein-coupled receptors (gpcrs), antibodies thereto, and systems for identifying such antigenic peptides
WO2002060317A2 (en) 2001-01-30 2002-08-08 Corixa Corporation Compositions and methods for the therapy and diagnosis of pancreatic cancer
WO2002064798A1 (en) 2001-02-12 2002-08-22 Bionomics Limited Dna sequences differentially expressed in tumour cell lines
WO2002071928A2 (en) 2001-03-14 2002-09-19 Millennium Pharmaceuticals, Inc. Nucleic acid molecules and proteins for the identification, assessment, prevention, and therapy of ovarian cancer
WO2002072596A1 (en) 2001-03-09 2002-09-19 Incyte Genomics, Inc. Steap-related protein
WO2002078524A2 (en) 2001-03-28 2002-10-10 Zycos Inc. Translational profiling
US20020150573A1 (en) 2000-11-10 2002-10-17 The Rockefeller University Anti-Igalpha-Igbeta antibody for lymphoma therapy
WO2002081646A2 (en) 2001-04-06 2002-10-17 Mannkind Corporation Epitope sequences
WO2002083866A2 (en) 2001-04-17 2002-10-24 The Board Of Trustees Of The University Of Arkansas Repeat sequences of the ca125 gene and their use for diagnostic and therapeutic interventions
WO2002086443A2 (en) 2001-04-18 2002-10-31 Protein Design Labs, Inc Methods of diagnosis of lung cancer, compositions and methods of screening for modulators of lung cancer
WO2002088170A2 (en) 2001-04-26 2002-11-07 Biogen, Inc. Cripto blocking antibodies and uses thereof
WO2002089747A2 (en) 2001-05-09 2002-11-14 Corixa Corporation Compositions and methods for the therapy and diagnosis of prostate cancer
WO2002092836A2 (en) 2001-05-11 2002-11-21 Sloan-Kettering Institute For Cancer Research Nucleic acid sequence encoding ovarian antigen, ca125, and uses thereof
WO2002094852A2 (en) 2001-05-24 2002-11-28 Zymogenetics, Inc. Taci-immunoglobulin fusion proteins
WO2002098358A2 (en) 2001-06-04 2002-12-12 Eos Biotechnology, Inc. Methods of diagnosis and treatment of androgen-dependent prostate cancer, prostate cancer undergoing androgen-withdrawal, and androgen-independent prostate cancer
WO2002099122A1 (en) 2001-06-05 2002-12-12 Exelixis, Inc. Modifiers of the p53 pathway and methods of use
WO2002099074A2 (en) 2001-06-05 2002-12-12 Exelixis, Inc. Slc7s as modifiers of the p53 pathway and methods of use
WO2002101075A2 (en) 2001-06-13 2002-12-19 Millennium Pharmaceuticals, Inc. Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of cervical cancer
US20020193567A1 (en) 1995-08-11 2002-12-19 Genetics Institute, Inc. Secreted proteins and polynucleotides encoding them
WO2002102235A2 (en) 2001-06-18 2002-12-27 Eos Biotechnology Inc. Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer
WO2003000842A2 (en) 2001-06-04 2003-01-03 Curagen Corporation Novel proteins and nucleic acids encoding same
WO2003002717A2 (en) 2001-06-28 2003-01-09 Schering Corporation Biological activity of ak155
WO2003003984A2 (en) 2001-07-05 2003-01-16 Curagen Corporation Novel proteins and nucleic acids encoding same
WO2003003906A2 (en) 2001-07-03 2003-01-16 Eos Biotechnology, Inc. Diagnostic and screening methods for bladder cancer
WO2003004529A2 (en) 2001-07-02 2003-01-16 Licentia Ltd. Ephrin-tie receptor materials and methods
WO2003004989A2 (en) 2001-06-21 2003-01-16 Millennium Pharmaceuticals, Inc. Compositions, kits, and methods for identification, assessment, prevention, and therapy of breast cancer
WO2003009814A2 (en) 2001-07-25 2003-02-06 Millennium Pharmaceuticals, Inc. Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of prostate cancer
US6518404B1 (en) 1994-10-17 2003-02-11 Human Genome Sciences, Inc. Human endothelin-bombesin receptor antibodies
WO2003014294A2 (en) 2001-08-03 2003-02-20 Genentech, Inc. Tacis and br3 polypeptides and uses thereof
WO2003016494A2 (en) 2001-08-16 2003-02-27 Vitivity, Inc. Diagnosis and treatment of vascular disease
WO2003016475A2 (en) 2001-08-14 2003-02-27 The General Hospital Corporation Nucleic acid and amino acid sequences involved in pain
WO2003018621A2 (en) 2001-08-23 2003-03-06 Oxford Biomedica (Uk) Limited Genes
WO2003022995A2 (en) 2001-09-06 2003-03-20 Agensys, Inc. Nucleic acid and corresponding protein entitled steap-1 useful in treatment and detection of cancer
WO2003023013A2 (en) 2001-09-13 2003-03-20 Nuvelo, Inc. Novel nucleic acids and polypeptides
EP1295944A2 (en) 1996-03-19 2003-03-26 Otsuka Pharmaceutical Co., Ltd. GDP dissociation stimulating protein, brain-specific nucleosome assembly protein, skeletal muscle specific ubiquitin-conjugating enzyme, cell proliferation protein, phosphatidylinositolkinase, nel related proteins
WO2003024392A2 (en) 2001-09-18 2003-03-27 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
US20030060612A1 (en) 1997-10-28 2003-03-27 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
WO2003025138A2 (en) 2001-09-17 2003-03-27 Protein Design Labs, Inc. Methods of diagnosis of cancer compositions and methods of screening for modulators of cancer
WO2003025148A2 (en) 2001-09-19 2003-03-27 Nuvelo, Inc. Novel nucleic acids and polypeptides
WO2003025228A1 (en) 2001-09-18 2003-03-27 Proteologics, Inc. Methods and compositions for treating hcap associated diseases
WO2003026493A2 (en) 2001-09-28 2003-04-03 Bing Yang Diagnosis and treatment of diseases caused by mutations in cd72
US20030064397A1 (en) 1998-05-22 2003-04-03 Incyte Genomics, Inc. Transmembrane protein differentially expressed in prostate and lung tumors
US20030065143A1 (en) 1998-12-30 2003-04-03 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2003029277A2 (en) 2001-10-03 2003-04-10 Rigel Pharmaceuticals, Inc. Modulators of lymphocyte activation and migration
WO2003029262A2 (en) 2001-08-29 2003-04-10 Vanderbilt University The human mob-5 (il-24) receptors and uses thereof
WO2003029421A2 (en) 2001-10-03 2003-04-10 Origene Technologies, Inc. Regulated breast cancer genes
WO2003035846A2 (en) 2001-10-24 2003-05-01 National Jewish Medical And Research Center Structure of tall-1 and its cognate receptor
WO2003034984A2 (en) 2001-10-19 2003-05-01 Genentech, Inc. Compositions and methods for the diagnosis and treatment of inflammatory bowel disorders
US20030091580A1 (en) 2001-06-18 2003-05-15 Mitcham Jennifer L. Compositions and methods for the therapy and diagnosis of ovarian cancer
US20030096961A1 (en) 2001-06-01 2003-05-22 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2003042661A2 (en) 2001-11-13 2003-05-22 Protein Design Labs, Inc. Methods of diagnosis of cancer, compositions and methods of screening for modulators of cancer
WO2003045422A1 (en) 2001-11-29 2003-06-05 Genset S.A. Agonists and antagonists of prolixin for the treatment of metabolic disorders
WO2003048202A2 (en) 2001-12-03 2003-06-12 Asahi Kasei Pharma Corporation Nf-kappab activating genes
US20030119122A1 (en) 1999-05-11 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030119131A1 (en) 2000-01-20 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030119125A1 (en) 2001-01-16 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030118592A1 (en) 2001-01-17 2003-06-26 Genecraft, Inc. Binding domain-immunoglobulin fusion proteins
US20030119121A1 (en) 2000-09-15 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030119129A1 (en) 1999-08-10 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030119130A1 (en) 1999-08-17 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030119126A1 (en) 2001-01-16 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030119128A1 (en) 1999-07-20 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030124140A1 (en) 1998-12-17 2003-07-03 Corixa Corporation Compositions and methods for the therapy and diagnosis of ovarian cancer
US20030124579A1 (en) 2001-09-05 2003-07-03 Eos Biotechnology, Inc. Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer
WO2003054152A2 (en) 2001-12-10 2003-07-03 Nuvelo, Inc. Novel nucleic acids and polypeptides
WO2003055439A2 (en) 2001-07-18 2003-07-10 The Regents Of The University Of California Her2/neu target antigen and use of same to stimulate an immune response
US20030129192A1 (en) 1999-09-10 2003-07-10 Corixa Corporation Compositions and methods for the therapy and diagnosis of ovarian cancer
WO2003055443A2 (en) 2001-10-31 2003-07-10 Alcon, Inc. Bone morphogenic proteins (bmp), bmp receptors and bmp binding proteins and their use in the diagnosis and treatment of glaucoma
US20030134790A1 (en) 2002-01-11 2003-07-17 University Of Medicine And Dentistry Of New Jersey Bone Morphogenetic Protein-2 And Bone Morphogenetic Protein-4 In The Treatment And Diagnosis Of Cancer
US20030143557A1 (en) 2002-01-25 2003-07-31 Reinhold Penner Methods of screening for TRPM4b modulators
WO2003062401A2 (en) 2002-01-22 2003-07-31 Corixa Corporation Compositions and methods for the detection, diagnosis and therapy of hematological malignancies
US6602677B1 (en) 1997-09-19 2003-08-05 Promega Corporation Thermostable luciferases and methods of production
US20030157089A1 (en) 1997-02-25 2003-08-21 Corixa Corporation Compositions and methods for the therapy and diagnosis of prostate cancer
WO2003072035A2 (en) 2002-02-22 2003-09-04 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
US20030165504A1 (en) 1999-09-24 2003-09-04 Retter Marc W. Compositions and methods for the therapy and diagnosis of ovarian cancer
WO2003072036A2 (en) 2002-02-21 2003-09-04 Duke University Treatment methods using anti-cd22 antibodies
EP1347046A1 (en) 2002-03-22 2003-09-24 Research Association for Biotechnology Full-length cDNA sequences
WO2003077836A2 (en) 2001-11-06 2003-09-25 Corixa Corporation Compositions and methods for the detection, diagnosis and therapy of hematological malignancies
US20030185830A1 (en) 1997-02-25 2003-10-02 Corixa Corporation Compositions and methods for the therapy and diagnosis of prostate cancer
US20030186372A1 (en) 2000-02-11 2003-10-02 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2003081210A2 (en) 2002-03-21 2003-10-02 Sunesis Pharmaceuticals, Inc. Identification of kinase inhibitors
WO2003083047A2 (en) 2002-03-01 2003-10-09 Exelixis, Inc. MP53s AS MODIFIERS OF THE p53 PATHWAY AND METHODS OF USE
WO2003083074A2 (en) 2002-03-28 2003-10-09 Idec Pharmaceuticals Corporation Novel gene targets and ligands that bind thereto for treatment and diagnosis of colon carcinomas
WO2003083041A2 (en) 2002-03-22 2003-10-09 Biogen, Inc. Cripto-specific antibodies
US20030194704A1 (en) 2002-04-03 2003-10-16 Penn Sharron Gaynor Human genome-derived single exon nucleic acid probes useful for gene expression analysis two
WO2003087306A2 (en) 2002-04-05 2003-10-23 Agensys, Inc. Nucleic acid and corresponding protein entitled 98p4b6 useful in treatment and detection of cancer
WO2003087768A2 (en) 2002-04-12 2003-10-23 Mitokor Targets for therapeutic intervention identified in the mitochondrial proteome
WO2003089624A2 (en) 2002-03-25 2003-10-30 Uab Research Foundation Fc receptor homolog, reagents, and uses thereof
WO2003089904A2 (en) 2002-04-17 2003-10-30 Baylor College Of Medicine Aib1 as a prognostic marker and predictor of resistance to encocrine therapy
WO2003088808A2 (en) 2002-04-16 2003-10-30 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
US20030206918A1 (en) 1999-09-10 2003-11-06 Corixa Corporation Compositions and methods for the therapy and diagnosis of ovarian cancer
WO2003093444A2 (en) 2002-05-03 2003-11-13 Incyte Corporation Transporters and ion channels
WO2003097803A2 (en) 2002-05-15 2003-11-27 Avalon Pharmaceuticals Cancer-linked gene as target for chemotherapy
US20030219806A1 (en) 2000-02-22 2003-11-27 Millennium Pharmaceuticals, Inc. Novel 18607, 15603, 69318, 12303, 48000, 52920, 5433, 38554, 57301, 58324, 55063, 52991, 59914, 59921 and 33751 molecules and uses therefor
US20030224454A1 (en) 2002-05-30 2003-12-04 Ryseck Rolf Peter Human solute carrier family 7, member 11 (hSLC7A11)
US20030224411A1 (en) 2003-03-13 2003-12-04 Stanton Lawrence W. Genes that are up- or down-regulated during differentiation of human embryonic stem cells
WO2003101400A2 (en) 2002-06-04 2003-12-11 Avalon Pharmaceuticals, Inc. Cancer-linked gene as target for chemotherapy
WO2003101283A2 (en) 2002-06-04 2003-12-11 Incyte Corporation Diagnostics markers for lung cancer
US20030232350A1 (en) 2001-11-13 2003-12-18 Eos Biotechnology, Inc. Methods of diagnosis of cancer, compositions and methods of screening for modulators of cancer
US20030232056A1 (en) 1999-09-10 2003-12-18 Corixa Corporation Compositions and methods for the therapy and diagnosis of ovarian cancer
WO2003104275A2 (en) 2002-06-06 2003-12-18 Oncotherapy Science, Inc. Genes and polypeptides relating to human colon cancers
WO2003104270A2 (en) 2002-06-06 2003-12-18 Ingenium Pharmaceuticals Ag Dudulin 2 genes, expression products, non-human animal model: uses in human hematological disease
WO2003104399A2 (en) 2002-06-07 2003-12-18 Avalon Pharmaceuticals, Inc Cancer-linked gene as target for chemotherapy
WO2003105758A2 (en) 2002-06-12 2003-12-24 Avalon Pharmaceuticals, Inc. Cancer-linked gene as target for chemotherapy
WO2004000997A2 (en) 2002-03-19 2003-12-31 Curagen Corporation Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2004000221A2 (en) 2002-06-20 2003-12-31 The Regents Of The University Of California Compositions and methods for modulating lymphocyte activity
WO2004001004A2 (en) 2002-06-21 2003-12-31 Johns Hopkins University School Of Medicine Membrane associated tumor endothelium markers
US20040001827A1 (en) 2002-06-28 2004-01-01 Dennis Mark S. Serum albumin binding peptides for tumor targeting
US20040005538A1 (en) 2001-04-11 2004-01-08 Xiaojiang Chen Three-dimensional structure of complement receptor type 2 and uses thereof
US20040005563A1 (en) 2001-06-18 2004-01-08 Eos Biotechnology, Inc. Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer
WO2004009622A2 (en) 2002-07-19 2004-01-29 Cellzome Ag Protein complexes of cellular networks underlying the development of cancer and other diseases
US20040022727A1 (en) 2002-06-18 2004-02-05 Martin Stanton Aptamer-toxin molecules and methods for using same
WO2004011611A2 (en) 2002-07-25 2004-02-05 Genentech, Inc. Taci antibodies and uses thereof
WO2004015426A1 (en) 2002-08-06 2004-02-19 Bayer Healthcare Ag Diagnostics and therapeutics for diseases associated with human cxc chemokine receptor 5(cxcr5)
WO2004016225A2 (en) 2002-08-19 2004-02-26 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
EP1394274A2 (en) 2002-08-06 2004-03-03 Genox Research, Inc. Methods of testing for bronchial asthma or chronic obstructive pulmonary disease
US20040044179A1 (en) 2000-07-25 2004-03-04 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2004020595A2 (en) 2002-08-29 2004-03-11 Five Prime Therapeutics, Inc. Novel human polypeptides encoded by polynucleotides
WO2004020583A2 (en) 2002-08-27 2004-03-11 Bristol-Myers Squibb Company Polynucleotide predictor set for identifying protein tyrosine kinase modulators
WO2004022778A1 (en) 2002-09-05 2004-03-18 Garvan Institute Of Medical Research Methods of diagnosis and prognosis of ovarian cancer
WO2004022709A2 (en) 2002-09-06 2004-03-18 Mannkind Corporation Epitope sequences
WO2004027049A2 (en) 2002-09-20 2004-04-01 Astral, Inc. Methods and compositions to generate and control the effector profile of t cells by simultaneous loading and activation of selected subsets of antigen presenting cells
WO2004031238A2 (en) 2002-10-03 2004-04-15 Mcgill Univeristy Antibodies and cyclic peptides which bind cea (carcinoembryonic antigen) and their use as cancer therapeutics
JP2004113151A (ja) 2002-09-27 2004-04-15 Sankyo Co Ltd 癌遺伝子及びその用途
WO2004032842A2 (en) 2002-10-04 2004-04-22 Van Andel Research Institute Molecular sub-classification of kidney tumors and the discovery of new diagnostic markers
WO2004040000A2 (en) 2002-09-09 2004-05-13 Nura, Inc G protein coupled receptors and uses thereof
WO2004042346A2 (en) 2002-04-24 2004-05-21 Expression Diagnostics, Inc. Methods and compositions for diagnosing and monitoring transplant rejection
WO2004043361A2 (en) 2002-11-08 2004-05-27 Genentech, Inc. Compositions and methods for the treatment of natural killer cell related diseases
WO2004044178A2 (en) 2002-11-13 2004-05-27 Genentech, Inc. Methods and compositions for diagnosing dysplasia
WO2004045520A2 (en) 2002-11-15 2004-06-03 Musc Foundation For Research Development Complement receptor 2 targeted complement modulators
WO2004045516A2 (en) 2002-11-15 2004-06-03 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
WO2004045553A2 (en) 2002-11-15 2004-06-03 The Board Of Trustees Of The University Of Arkansas Ca125 gene and its use for diagnostic and therapeutic interventions
WO2004046342A2 (en) 2002-11-20 2004-06-03 Biogen Idec Inc. Novel gene targets and ligands that bind thereto for treatment and diagnosis of carcinomas
WO2004048938A2 (en) 2002-11-26 2004-06-10 Protein Design Labs, Inc. Methods of detecting soft tissue sarcoma, compositions and methods of screening for soft tissue sarcoma modulators
WO2004047749A2 (en) 2002-11-21 2004-06-10 University Of Utah Research Foundation Purinergic modulation of smell
WO2004053079A2 (en) 2002-12-06 2004-06-24 Diadexus, Inc. Compositions, splice variants and methods relating to ovarian specific genes and proteins
WO2004058309A1 (en) 2002-12-23 2004-07-15 Human Genome Sciences, Inc. Neutrokine-alpha conjugate, neutrokine-alpha complex, and uses thereof
EP1439393A2 (en) 2002-12-13 2004-07-21 Bayer Healthcare LLC Detection methods using TIMP 1 for colon cancer diagnosis
WO2004063362A2 (en) 2003-01-10 2004-07-29 Cyclacel Limited Cell cycle progression proteins
WO2004063355A2 (en) 2003-01-10 2004-07-29 Protein Design Labs, Inc. Novel methods of diagnosis of metastatic cancer, compositions and methods of screening for modulators of matastatic cancer
WO2004063709A2 (en) 2003-01-08 2004-07-29 Bristol-Myers Squibb Company Biomarkers and methods for determining sensitivity to epidermal growth factor receptor modulators
WO2004065491A1 (en) 2003-01-24 2004-08-05 Schering Ag Hydrophilic, thiol-reactive cyanine dyes and conjugates thereof with biomolecules for fluorescence diagnosis
WO2004065577A2 (en) 2003-01-14 2004-08-05 Bristol-Myers Squibb Company Polynucleotides and polypeptides associated with the nf-kb pathway
WO2004065576A2 (en) 2003-01-15 2004-08-05 Millennium Pharmaceuticals, Inc. Methods and compositions for the treatment of urological disorder using differential expressed polypeptides
WO2004074320A2 (en) 2003-02-14 2004-09-02 Sagres Discovery, Inc. Therapeutic targets in cancer
US20040197325A1 (en) 2002-12-20 2004-10-07 Debbie Law Antibodies against GPR64 and uses thereof
US20040229310A1 (en) 2003-01-23 2004-11-18 Genentech, Inc. Methods for producing humanized antibodies and improving yield of antibodies or antigen binding fragments in cell culture
US20040249130A1 (en) 2002-06-18 2004-12-09 Martin Stanton Aptamer-toxin molecules and methods for using same
US20050048572A1 (en) 2002-10-31 2005-03-03 Genentech, Inc. Methods and compositions for increasing antibody production
US7049311B1 (en) 1998-08-27 2006-05-23 Spirogen Limited Pyrrolbenzodiazepines
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
WO2007001851A2 (en) 2005-06-20 2007-01-04 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
US20070049758A1 (en) 2005-09-01 2007-03-01 Roche Palo Alto Llc Diaminopyrimidines as P2X3 and P2X2/3 modulators
WO2008083312A2 (en) * 2006-12-28 2008-07-10 Medarex, Inc. Chemical linkers and cleavable substrates and conjugates thereof
US20090018086A1 (en) 2005-07-07 2009-01-15 Seattle Genetics, Inc. Monomethylvaline Compounds Having Phenylalanine Side-Chain Replacements at the C-Terminus
US20090036431A1 (en) 2006-01-25 2009-02-05 Sanofi-Aventis Cytotoxic Agents Comprising New Tomaymycin Derivatives
US7498298B2 (en) 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
US7511032B2 (en) 2003-10-22 2009-03-31 The United States Of America As Represented By The Secretary, Department Of Health And Human Services Pyrrolobenzodiazepine derivatives, compositions comprising the same and methods related thereto
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
WO2009052249A1 (en) 2007-10-19 2009-04-23 Genentech, Inc. Cysteine engineered anti-tenb2 antibodies and antibody drug conjugates
US20090111756A1 (en) 2005-07-07 2009-04-30 Seattle Genectics, Inc. Monomethylvaline Compounds Having Phenylalanine Carboxy Modifications at the C-Terminus
US7528126B2 (en) 2004-03-09 2009-05-05 Spirogen Limited Pyrrolobenzodiazepines
US7557099B2 (en) 2004-03-01 2009-07-07 Spirogen Limited Pyrrolobenzodiazepines as key intermediates in the synthesis of dimeric cytotoxic pyrrolobenzodiazepines
US20090304710A1 (en) 2006-10-19 2009-12-10 Sanofi-Aventis Novel anti-cd38 antibodies for the treatment of cancer
US7659241B2 (en) 2002-07-31 2010-02-09 Seattle Genetics, Inc. Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease
US20100047257A1 (en) 2006-07-18 2010-02-25 Sanofi-Aventis Antagonist antibody for the treatment of cancer
US7723485B2 (en) 2007-05-08 2010-05-25 Genentech, Inc. Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates
US7862817B2 (en) 1999-06-25 2011-01-04 Genentech, Inc. Humanized anti-ErbB2 antibodies and treatment with anti-ErbB2 antibodies
DE102009051799A1 (de) * 2009-11-03 2011-05-05 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Bifunktionale Prodrugs und Drugs
WO2011130598A1 (en) 2010-04-15 2011-10-20 Spirogen Limited Pyrrolobenzodiazepines and conjugates thereof
WO2011130616A1 (en) 2010-04-15 2011-10-20 Spirogen Limited Pyrrolobenzodiazepines used to treat proliferative diseases
US8226945B2 (en) 2006-05-30 2012-07-24 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
WO2012113847A1 (en) 2011-02-25 2012-08-30 Lonza Ltd Branched linker for protein drug conjugates
US20130028919A1 (en) 2010-04-15 2013-01-31 Spirogen Developments Sàrl Targeted pyrrolobenzodiazapine conjugates

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7091186B2 (en) * 2001-09-24 2006-08-15 Seattle Genetics, Inc. p-Amidobenzylethers in drug delivery agents
US20090068178A1 (en) 2002-05-08 2009-03-12 Genentech, Inc. Compositions and Methods for the Treatment of Tumor of Hematopoietic Origin
DK2295073T3 (da) 2003-11-17 2014-07-28 Genentech Inc Antistof mod cd22 til behandling af tumor af hæmatopoietisk oprindelse
SI2019104T1 (sl) 2007-07-19 2013-12-31 Sanofi Citotoksična sredstva, ki obsegajo nove tomaimicinske derivate, in njihova terapevtska uporaba
RU2683325C2 (ru) 2009-02-05 2019-03-28 Иммьюноджен, Инк. Новые производные бензодиазепина
PH12012500982A1 (en) 2009-11-30 2019-07-10 Genentech Inc Antibodies for treating and diagnosing tumors expressing slc34a2 (tat211=seqid2)
PT3056203T (pt) 2010-04-21 2018-02-15 Syntarga Bv Conjugados de análogos de cc-1065 e ligantes bifuncionais
US8852599B2 (en) 2011-05-26 2014-10-07 Bristol-Myers Squibb Company Immunoconjugates, compositions for making them, and methods of making and use
BR112014009050B1 (pt) 2011-10-14 2022-06-21 Medimmune Limited Conjugado anticorpo-fármaco de pirrolbenzodiazepinas, composição farmacêutica que compreende o mesmo, bem como compostos de pirrolbenzodiazepinas
CN104428007B (zh) 2012-07-09 2018-03-16 基因泰克公司 包含抗cd22抗体的免疫缀合物
AR091703A1 (es) 2012-07-09 2015-02-25 Genentech Inc Anticuerpos e inmunoconjugados que comprenden anticuerpos anti-cd22
WO2015095227A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
EP3082876B1 (en) 2013-12-16 2018-01-17 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment

Patent Citations (291)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
JPH053790B2 (cg-RX-API-DMAC7.html) 1983-11-02 1993-01-18 Canon Kk
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US5674713A (en) 1985-12-02 1997-10-07 The Regents Of The University Of California DNA sequences encoding coleoptera luciferase activity
US5583024A (en) 1985-12-02 1996-12-10 The Regents Of The University Of California Recombinant expression of Coleoptera luciferase
WO1991002536A1 (en) 1989-08-23 1991-03-07 Scripps Clinic And Research Foundation Compositions and methods for detection and treatment of epstein-barr virus infection and immune disorders
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6417429B1 (en) 1989-10-27 2002-07-09 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US5792616A (en) 1990-05-29 1998-08-11 The United States Of America Antibodies to human cripto protein
WO1992007574A1 (en) 1990-10-25 1992-05-14 Tanox Biosystems, Inc. Glycoproteins associated with membrane-bound immunoglobulins as antibody targets on b cells
WO1992017497A1 (en) 1991-03-29 1992-10-15 Genentech, Inc. Human pf4a receptors and their use
US5440021A (en) 1991-03-29 1995-08-08 Chuntharapai; Anan Antibodies to human IL-8 type B receptor
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
EP0522868A1 (en) 1991-07-12 1993-01-13 SHIONOGI SEIYAKU KABUSHIKI KAISHA trading under the name of SHIONOGI & CO. LTD. A human endothelin receptor
US5854399A (en) 1991-08-23 1998-12-29 The United States Of America As Represented By The Department Of Health And Human Services Antibodies specific for human cripto-related polypeptide CR-3
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US6153408A (en) 1991-11-15 2000-11-28 Institut Pasteur And Institut National De La Sante Et De La Recherche Medicale Altered major histocompatibility complex (MHC) determinant and methods of using the determinant
US6011146A (en) 1991-11-15 2000-01-04 Institut Pasteur Altered major histocompatibility complex (MHC) determinant and methods of using the determinant
US5976551A (en) 1991-11-15 1999-11-02 Institut Pasteur And Institut Nationale De La Sante Et De La Recherche Medicale Altered major histocompatibility complex (MHC) determinant and method of using the determinant
WO1994010312A1 (fr) 1992-10-23 1994-05-11 Chugai Seiyaku Kabushiki Kaisha Codage de genes pour potentiateur de megacaryocyte
US5644033A (en) 1992-12-22 1997-07-01 Health Research, Inc. Monoclonal antibodies that define a unique antigen of human B cell antigen receptor complex and methods of using same for diagnosis and treatment
US5869445A (en) 1993-03-17 1999-02-09 University Of Washington Methods for eliciting or enhancing reactivity to HER-2/neu protein
US6214345B1 (en) 1993-05-14 2001-04-10 Bristol-Myers Squibb Co. Lysosomal enzyme-cleavable antitumor drug conjugates
WO1994028931A1 (en) 1993-06-11 1994-12-22 Genentech, Inc. Methods for treating inflammatory disorders
US5773223A (en) 1993-09-02 1998-06-30 Chiron Corporation Endothelin B1, (ETB1) receptor polypeptide and its encoding nucleic acid methods, and uses thereof
US6518404B1 (en) 1994-10-17 2003-02-11 Human Genome Sciences, Inc. Human endothelin-bombesin receptor antibodies
US20030109676A1 (en) 1994-10-17 2003-06-12 Human Genome Sciences, Inc. Human endothelin-bombesin receptor
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
WO1996030514A1 (en) 1995-03-31 1996-10-03 University Of Washington Intracellular domain of the her-2/neu protein for prevention or treatment of malignancies
US5700670A (en) 1995-04-13 1997-12-23 Mitsubishi Chemical Corporation Method for producing optically active ester of γ-substituted-β-hydroxybutyric acid
US20020193567A1 (en) 1995-08-11 2002-12-19 Genetics Institute, Inc. Secreted proteins and polynucleotides encoding them
WO1997007198A2 (en) 1995-08-11 1997-02-27 Genetics Institute, Inc. Dna sequences and secreted proteins encoded thereby
EP1295944A2 (en) 1996-03-19 2003-03-26 Otsuka Pharmaceutical Co., Ltd. GDP dissociation stimulating protein, brain-specific nucleosome assembly protein, skeletal muscle specific ubiquitin-conjugating enzyme, cell proliferation protein, phosphatidylinositolkinase, nel related proteins
WO1997044452A1 (en) 1996-05-17 1997-11-27 Schering Corporation Human b-cell antigens, related reagents
WO1998037193A1 (en) 1997-02-20 1998-08-27 Zymogenetics, Inc. Zcytor7 cytokine receptor
US20030185830A1 (en) 1997-02-25 2003-10-02 Corixa Corporation Compositions and methods for the therapy and diagnosis of prostate cancer
US20030157089A1 (en) 1997-02-25 2003-08-21 Corixa Corporation Compositions and methods for the therapy and diagnosis of prostate cancer
US20010055751A1 (en) 1997-03-10 2001-12-27 Reiter Robert E PSCA: Prostate stem cell antigen and uses thereof
WO1998040403A1 (en) 1997-03-10 1998-09-17 The Regents Of The University Of California Psca: prostate stem cell antigen
US6555339B1 (en) 1997-04-14 2003-04-29 Arena Pharmaceuticals, Inc. Non-endogenous, constitutively activated human protein-coupled receptors
US20030105292A1 (en) 1997-04-14 2003-06-05 Liaw Chen W. Non-endogenous, constitutively activated human G protein-coupled receptors
EP0875569A1 (en) 1997-04-28 1998-11-04 Smithkline Beecham Corporation A human sodium dependent phosphate transporter (IPT-1)
WO1998051824A1 (en) 1997-05-15 1998-11-19 Abbott Laboratories Reagents and methods useful for detecting disease of the urinary tract
US20040018553A1 (en) 1997-05-15 2004-01-29 Patricia A. Billing-Medel Reagents and methods useful for detecting diseases of the prostate
WO1998051805A1 (en) 1997-05-15 1998-11-19 Abbott Laboratories Reagents and methods useful for detecting diseases of the prostate
US6602677B1 (en) 1997-09-19 2003-08-05 Promega Corporation Thermostable luciferases and methods of production
US20030060612A1 (en) 1997-10-28 2003-03-27 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
US20020034749A1 (en) 1997-11-18 2002-03-21 Billing-Medel Patricia A. Reagents and methods useful for detecting diseases of the breast
WO1999028468A1 (en) 1997-12-02 1999-06-10 The Regents Of The University Of California Modulating b lymphocyte chemokine/receptor interactions
WO1999046284A2 (en) 1998-03-13 1999-09-16 The Burnham Institute Molecules that home to various selected organs or tissues
US6534482B1 (en) 1998-05-13 2003-03-18 Epimmune, Inc. Expression vectors for stimulating an immune response and methods of using the same
WO1999058658A2 (en) 1998-05-13 1999-11-18 Epimmune, Inc. Expression vectors for stimulating an immune response and methods of using the same
US20030064397A1 (en) 1998-05-22 2003-04-03 Incyte Genomics, Inc. Transmembrane protein differentially expressed in prostate and lung tumors
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US7049311B1 (en) 1998-08-27 2006-05-23 Spirogen Limited Pyrrolbenzodiazepines
WO2000012130A1 (en) 1998-08-27 2000-03-09 Smithkline Beecham Corporation Rp105 agonists and antagonists
US7067511B2 (en) 1998-08-27 2006-06-27 Spirogen Limited Pyrrolobenzodiazepines
US7265105B2 (en) 1998-08-27 2007-09-04 Spirogen Limited Pyrrolobenzodiazepines
WO2000014228A1 (en) 1998-09-03 2000-03-16 Japan Science And Technology Corporation Neutral amino acid transporter and gene thereof
WO2000020579A1 (en) 1998-10-02 2000-04-13 Mcmaster University Spliced form of erbb-2/neu oncogene
WO2000022129A1 (en) 1998-10-13 2000-04-20 Arena Pharmaceuticals, Inc. Non-endogenous, constitutively activated human g protein-coupled receptors
WO2000032752A1 (en) 1998-12-02 2000-06-08 The Regents Of The University Of California Psca: prostate stem cell antigen and uses thereof
US20030124140A1 (en) 1998-12-17 2003-07-03 Corixa Corporation Compositions and methods for the therapy and diagnosis of ovarian cancer
WO2000036107A2 (en) 1998-12-17 2000-06-22 Corixa Corporation Compositions and methods for therapy and diagnosis of ovarian cancer
WO2000040614A2 (en) 1998-12-30 2000-07-13 Beth Israel Deaconess Medical Center, Inc. Characterization of the soc/crac calcium channel protein family
US20030065143A1 (en) 1998-12-30 2003-04-03 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2000044899A1 (en) 1999-01-29 2000-08-03 Corixa Corporation Her-2/neu fusion proteins
WO2000053216A2 (en) 1999-03-05 2000-09-14 Smithkline Beecham Biologicals S.A. Use of casb616 polypeptides and polynucleotides for cancer treatment
WO2000055351A1 (en) 1999-03-12 2000-09-21 Human Genome Sciences, Inc. Human colon cancer associated gene sequences and polypeptides
US20030119122A1 (en) 1999-05-11 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2000075655A1 (fr) 1999-06-03 2000-12-14 Takeda Chemical Industries, Ltd. Procede de criblage avec cd100
US7862817B2 (en) 1999-06-25 2011-01-04 Genentech, Inc. Humanized anti-ErbB2 antibodies and treatment with anti-ErbB2 antibodies
WO2001000244A2 (en) 1999-06-25 2001-01-04 Genentech, Inc. METHODS OF TREATMENT USING ANTI-ErbB ANTIBODY-MAYTANSINOID CONJUGATES
US20030119128A1 (en) 1999-07-20 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030119129A1 (en) 1999-08-10 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030119130A1 (en) 1999-08-17 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2001016318A2 (en) 1999-09-01 2001-03-08 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030129192A1 (en) 1999-09-10 2003-07-10 Corixa Corporation Compositions and methods for the therapy and diagnosis of ovarian cancer
US20030232056A1 (en) 1999-09-10 2003-12-18 Corixa Corporation Compositions and methods for the therapy and diagnosis of ovarian cancer
US20030206918A1 (en) 1999-09-10 2003-11-06 Corixa Corporation Compositions and methods for the therapy and diagnosis of ovarian cancer
US20030165504A1 (en) 1999-09-24 2003-09-04 Retter Marc W. Compositions and methods for the therapy and diagnosis of ovarian cancer
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
WO2001040309A2 (en) 1999-10-29 2001-06-07 Genentech, Inc. Anti-prostate stem cell antigen (psca) antibody compositions and methods of use
WO2001038490A2 (en) 1999-11-29 2001-05-31 The Trustees Of Columbia University In The City Of New York ISOLATION OF FIVE NOVEL GENES CODING FOR NEW Fc RECEPTORS-TYPE MELANOMA INVOLVED IN THE PATHOGENESIS OF LYMPHOMA/MELANOMA
US20040101899A1 (en) 1999-11-30 2004-05-27 Corixa Corporation Compositions and methods for the therapy and diagnosis of breast cancer
WO2001040269A2 (en) 1999-11-30 2001-06-07 Corixa Corporation Compositions and methods for therapy and diagnosis of breast cancer
WO2001041787A1 (en) 1999-12-10 2001-06-14 Epimmune Inc. INDUCING CELLULAR IMMUNE RESPONSES TO HER2/neu USING PEPTIDE AND NUCLEIC ACID COMPOSITIONS
WO2001046232A2 (en) 1999-12-23 2001-06-28 Zymogenetics, Inc. Soluble interleukin-20 receptor
US20040005320A1 (en) 1999-12-23 2004-01-08 Penny Thompson Method for treating inflammation
US20020042366A1 (en) 1999-12-23 2002-04-11 Penny Thompson Method for treating inflammation
WO2001046261A1 (en) 1999-12-23 2001-06-28 Zymogenetics, Inc. Method for treating inflammation
WO2001048204A1 (en) 1999-12-23 2001-07-05 Agresearch Limited Mutated bmp1b receptor as regulator of ovulation rate
WO2001045746A2 (en) 1999-12-24 2001-06-28 Genentech, Inc. Methods and compositions for prolonging elimination half-times of bioactive compounds
US20030119131A1 (en) 2000-01-20 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2001053463A2 (en) 2000-01-21 2001-07-26 Corixa Corporation COMPOUNDS AND METHODS FOR PREVENTION AND TREATMENT OF HER-2/neu ASSOCIATED MALIGNANCIES
WO2001057188A2 (en) 2000-02-03 2001-08-09 Hyseq, Inc. Novel nucleic acids and polypeptides
US20030186372A1 (en) 2000-02-11 2003-10-02 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2001062794A2 (en) 2000-02-22 2001-08-30 Millennium Pharmaceuticals, Inc. 18607, a human calcium channel
US20030219806A1 (en) 2000-02-22 2003-11-27 Millennium Pharmaceuticals, Inc. Novel 18607, 15603, 69318, 12303, 48000, 52920, 5433, 38554, 57301, 58324, 55063, 52991, 59914, 59921 and 33751 molecules and uses therefor
WO2001066689A2 (en) 2000-03-07 2001-09-13 Hyseq, Inc. Novel nucleic acids and polypeptides
WO2001072962A2 (en) 2000-03-24 2001-10-04 Fahri Saatcioglu Novel prostate-specific or testis-specific nucleic acid molecules, polypeptides, and diagnostic and therapeutic methods
WO2001072830A2 (de) 2000-03-31 2001-10-04 Ipf Pharmaceuticals Gmbh Diagnostik- und arzneimittel zur untersuchung des zelloberflächenproteoms von tumor- und entzündungszellen sowie zur behandlung von tumorerkrankungen und entzündlichen erkrankungen vorzugsweise mit hilfe einer spezifischen chemokinrezeptor-analyse und der chemokinrezeptor-ligand-interaktion
WO2001075177A2 (en) 2000-04-03 2001-10-11 The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Tumor markers in ovarian cancer
WO2001077172A2 (en) 2000-04-07 2001-10-18 Arena Pharmaceuticals, Inc. Non-endogenous, constitutively activated known g protein-coupled receptors
WO2001088133A2 (en) 2000-05-18 2001-11-22 Lexicon Genetics Incorporated Human semaphorin homologs and polynucleotides encoding the same
WO2001090304A2 (en) 2000-05-19 2001-11-29 Human Genome Sciences, Inc. Nucleic acids, proteins, and antibodies
WO2001094641A2 (en) 2000-06-09 2001-12-13 Idec Pharmaceuticals Corporation Gene targets and ligands that bind thereto for treatment and diagnosis of ovarian carcinomas
WO2001098351A2 (en) 2000-06-16 2001-12-27 Incyte Genomics, Inc. G-protein coupled receptors
WO2002002587A1 (en) 2000-06-30 2002-01-10 Human Genome Sciences, Inc. B7-like polynucleotides, polypeptides, and antibodies
WO2002002624A2 (en) 2000-06-30 2002-01-10 Amgen, Inc. B7-like molecules and uses thereof
WO2002002634A2 (en) 2000-06-30 2002-01-10 Incyte Genomics, Inc. Human extracellular matrix and cell adhesion polypeptides
WO2002006339A2 (en) 2000-07-03 2002-01-24 Curagen Corporation Proteins and nucleic acids encoding same
WO2002006317A2 (en) 2000-07-17 2002-01-24 Corixa Corporation Compositions and methods for the therapy and diagnosis of ovarian cancer
US20040044179A1 (en) 2000-07-25 2004-03-04 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2002010187A1 (en) 2000-07-27 2002-02-07 Mayo Foundation For Medical Education And Research B7-h3 and b7-h4, novel immunoregulatory molecules
WO2002010382A2 (en) 2000-07-28 2002-02-07 Ulrich Wissenbach Trp8, trp9 and trp10, markers for cancer
WO2002012341A2 (en) 2000-08-03 2002-02-14 Corixa Corporation Her-2/neu fusion proteins
WO2002014503A2 (en) 2000-08-14 2002-02-21 Corixa Corporation Compositions and methods for the therapy and diagnosis of her-2/neu-associated malignancies
WO2002013847A2 (en) 2000-08-14 2002-02-21 Corixa Corporation Methods for diagnosis and therapy of hematological and virus-associated malignancies
WO2002016429A2 (en) 2000-08-24 2002-02-28 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
WO2002016413A2 (en) 2000-08-24 2002-02-28 Glaxosmithkline Biologicals S.A. Cripto tumour polypeptide
WO2002022660A2 (en) 2000-09-11 2002-03-21 Hyseq, Inc. Novel nucleic acids and polypeptides
US20030186373A1 (en) 2000-09-15 2003-10-02 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030119121A1 (en) 2000-09-15 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2002022153A2 (en) 2000-09-15 2002-03-21 Zymogenetics, Inc. Use of a polypeptide comprising the extracellular domains of il-20rb for the treatment of inflammation
WO2002022636A1 (en) 2000-09-15 2002-03-21 Isis Pharmaceuticals, Inc. Antisense modulation of her-2 expression
WO2002022808A2 (en) 2000-09-18 2002-03-21 Biogen, Inc. Cripto mutant and uses thereof
WO2002024909A2 (en) 2000-09-18 2002-03-28 Biogen, Inc. Receptor nucleic acids and polypeptides
US20040005598A1 (en) 2000-09-26 2004-01-08 Genentech, Inc. PUMPCn compositions and uses thereof
WO2002026822A2 (en) 2000-09-26 2002-04-04 Genentech, Inc. Pumpcn compositions and uses thereof
WO2002030268A2 (en) 2000-10-13 2002-04-18 Eos Biotechnology, Inc. Methods of diagnosis of prostate cancer, compositions and methods of screening for modulators of prostate cancer
WO2002038766A2 (en) 2000-11-07 2002-05-16 Zymogenetics, Inc. Human tumor necrosis factor receptor
US20020150573A1 (en) 2000-11-10 2002-10-17 The Rockefeller University Anti-Igalpha-Igbeta antibody for lymphoma therapy
WO2002061087A2 (en) 2000-12-19 2002-08-08 Lifespan Biosciences, Inc. Antigenic peptides, such as for g protein-coupled receptors (gpcrs), antibodies thereto, and systems for identifying such antigenic peptides
WO2002054940A2 (en) 2001-01-12 2002-07-18 University Of Medicine & Dentistry Of New Jersey Bone morphogenetic protein-2 in the treatment and diagnosis of cancer
US20030119125A1 (en) 2001-01-16 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030119126A1 (en) 2001-01-16 2003-06-26 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030118592A1 (en) 2001-01-17 2003-06-26 Genecraft, Inc. Binding domain-immunoglobulin fusion proteins
WO2002059377A2 (en) 2001-01-24 2002-08-01 Protein Design Labs Methods of diagnosis of breast cancer, compositions and methods of screening for modulators of breast cancer
WO2002060317A2 (en) 2001-01-30 2002-08-08 Corixa Corporation Compositions and methods for the therapy and diagnosis of pancreatic cancer
WO2002064798A1 (en) 2001-02-12 2002-08-22 Bionomics Limited Dna sequences differentially expressed in tumour cell lines
WO2002072596A1 (en) 2001-03-09 2002-09-19 Incyte Genomics, Inc. Steap-related protein
WO2002071928A2 (en) 2001-03-14 2002-09-19 Millennium Pharmaceuticals, Inc. Nucleic acid molecules and proteins for the identification, assessment, prevention, and therapy of ovarian cancer
WO2002078524A2 (en) 2001-03-28 2002-10-10 Zycos Inc. Translational profiling
WO2003008537A2 (en) 2001-04-06 2003-01-30 Mannkind Corporation Epitope sequences
WO2002081646A2 (en) 2001-04-06 2002-10-17 Mannkind Corporation Epitope sequences
US20040005538A1 (en) 2001-04-11 2004-01-08 Xiaojiang Chen Three-dimensional structure of complement receptor type 2 and uses thereof
WO2002083866A2 (en) 2001-04-17 2002-10-24 The Board Of Trustees Of The University Of Arkansas Repeat sequences of the ca125 gene and their use for diagnostic and therapeutic interventions
WO2002086443A2 (en) 2001-04-18 2002-10-31 Protein Design Labs, Inc Methods of diagnosis of lung cancer, compositions and methods of screening for modulators of lung cancer
WO2002088170A2 (en) 2001-04-26 2002-11-07 Biogen, Inc. Cripto blocking antibodies and uses thereof
WO2002089747A2 (en) 2001-05-09 2002-11-14 Corixa Corporation Compositions and methods for the therapy and diagnosis of prostate cancer
WO2002092836A2 (en) 2001-05-11 2002-11-21 Sloan-Kettering Institute For Cancer Research Nucleic acid sequence encoding ovarian antigen, ca125, and uses thereof
WO2002094852A2 (en) 2001-05-24 2002-11-28 Zymogenetics, Inc. Taci-immunoglobulin fusion proteins
US20040044180A1 (en) 2001-06-01 2004-03-04 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030096961A1 (en) 2001-06-01 2003-05-22 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
WO2003000842A2 (en) 2001-06-04 2003-01-03 Curagen Corporation Novel proteins and nucleic acids encoding same
WO2002098358A2 (en) 2001-06-04 2002-12-12 Eos Biotechnology, Inc. Methods of diagnosis and treatment of androgen-dependent prostate cancer, prostate cancer undergoing androgen-withdrawal, and androgen-independent prostate cancer
WO2002099074A2 (en) 2001-06-05 2002-12-12 Exelixis, Inc. Slc7s as modifiers of the p53 pathway and methods of use
WO2002099122A1 (en) 2001-06-05 2002-12-12 Exelixis, Inc. Modifiers of the p53 pathway and methods of use
WO2002101075A2 (en) 2001-06-13 2002-12-19 Millennium Pharmaceuticals, Inc. Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of cervical cancer
US20040005563A1 (en) 2001-06-18 2004-01-08 Eos Biotechnology, Inc. Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer
WO2002102235A2 (en) 2001-06-18 2002-12-27 Eos Biotechnology Inc. Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer
US20030091580A1 (en) 2001-06-18 2003-05-15 Mitcham Jennifer L. Compositions and methods for the therapy and diagnosis of ovarian cancer
WO2003004989A2 (en) 2001-06-21 2003-01-16 Millennium Pharmaceuticals, Inc. Compositions, kits, and methods for identification, assessment, prevention, and therapy of breast cancer
WO2003002717A2 (en) 2001-06-28 2003-01-09 Schering Corporation Biological activity of ak155
WO2003004529A2 (en) 2001-07-02 2003-01-16 Licentia Ltd. Ephrin-tie receptor materials and methods
WO2003003906A2 (en) 2001-07-03 2003-01-16 Eos Biotechnology, Inc. Diagnostic and screening methods for bladder cancer
WO2003003984A2 (en) 2001-07-05 2003-01-16 Curagen Corporation Novel proteins and nucleic acids encoding same
WO2003055439A2 (en) 2001-07-18 2003-07-10 The Regents Of The University Of California Her2/neu target antigen and use of same to stimulate an immune response
WO2003009814A2 (en) 2001-07-25 2003-02-06 Millennium Pharmaceuticals, Inc. Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of prostate cancer
WO2003014294A2 (en) 2001-08-03 2003-02-20 Genentech, Inc. Tacis and br3 polypeptides and uses thereof
WO2003016475A2 (en) 2001-08-14 2003-02-27 The General Hospital Corporation Nucleic acid and amino acid sequences involved in pain
WO2003016494A2 (en) 2001-08-16 2003-02-27 Vitivity, Inc. Diagnosis and treatment of vascular disease
WO2003018621A2 (en) 2001-08-23 2003-03-06 Oxford Biomedica (Uk) Limited Genes
WO2003029262A2 (en) 2001-08-29 2003-04-10 Vanderbilt University The human mob-5 (il-24) receptors and uses thereof
US20030124579A1 (en) 2001-09-05 2003-07-03 Eos Biotechnology, Inc. Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer
WO2003022995A2 (en) 2001-09-06 2003-03-20 Agensys, Inc. Nucleic acid and corresponding protein entitled steap-1 useful in treatment and detection of cancer
WO2003023013A2 (en) 2001-09-13 2003-03-20 Nuvelo, Inc. Novel nucleic acids and polypeptides
WO2003025138A2 (en) 2001-09-17 2003-03-27 Protein Design Labs, Inc. Methods of diagnosis of cancer compositions and methods of screening for modulators of cancer
WO2003025228A1 (en) 2001-09-18 2003-03-27 Proteologics, Inc. Methods and compositions for treating hcap associated diseases
WO2003024392A2 (en) 2001-09-18 2003-03-27 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
WO2003025148A2 (en) 2001-09-19 2003-03-27 Nuvelo, Inc. Novel nucleic acids and polypeptides
WO2003026493A2 (en) 2001-09-28 2003-04-03 Bing Yang Diagnosis and treatment of diseases caused by mutations in cd72
WO2003029421A2 (en) 2001-10-03 2003-04-10 Origene Technologies, Inc. Regulated breast cancer genes
WO2003029277A2 (en) 2001-10-03 2003-04-10 Rigel Pharmaceuticals, Inc. Modulators of lymphocyte activation and migration
WO2003034984A2 (en) 2001-10-19 2003-05-01 Genentech, Inc. Compositions and methods for the diagnosis and treatment of inflammatory bowel disorders
WO2003035846A2 (en) 2001-10-24 2003-05-01 National Jewish Medical And Research Center Structure of tall-1 and its cognate receptor
WO2003055443A2 (en) 2001-10-31 2003-07-10 Alcon, Inc. Bone morphogenic proteins (bmp), bmp receptors and bmp binding proteins and their use in the diagnosis and treatment of glaucoma
WO2003077836A2 (en) 2001-11-06 2003-09-25 Corixa Corporation Compositions and methods for the detection, diagnosis and therapy of hematological malignancies
US20030232350A1 (en) 2001-11-13 2003-12-18 Eos Biotechnology, Inc. Methods of diagnosis of cancer, compositions and methods of screening for modulators of cancer
WO2003042661A2 (en) 2001-11-13 2003-05-22 Protein Design Labs, Inc. Methods of diagnosis of cancer, compositions and methods of screening for modulators of cancer
WO2003045422A1 (en) 2001-11-29 2003-06-05 Genset S.A. Agonists and antagonists of prolixin for the treatment of metabolic disorders
WO2003048202A2 (en) 2001-12-03 2003-06-12 Asahi Kasei Pharma Corporation Nf-kappab activating genes
WO2003054152A2 (en) 2001-12-10 2003-07-03 Nuvelo, Inc. Novel nucleic acids and polypeptides
US20030134790A1 (en) 2002-01-11 2003-07-17 University Of Medicine And Dentistry Of New Jersey Bone Morphogenetic Protein-2 And Bone Morphogenetic Protein-4 In The Treatment And Diagnosis Of Cancer
WO2003062401A2 (en) 2002-01-22 2003-07-31 Corixa Corporation Compositions and methods for the detection, diagnosis and therapy of hematological malignancies
US20030143557A1 (en) 2002-01-25 2003-07-31 Reinhold Penner Methods of screening for TRPM4b modulators
WO2003072036A2 (en) 2002-02-21 2003-09-04 Duke University Treatment methods using anti-cd22 antibodies
WO2003072035A2 (en) 2002-02-22 2003-09-04 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
WO2003083047A2 (en) 2002-03-01 2003-10-09 Exelixis, Inc. MP53s AS MODIFIERS OF THE p53 PATHWAY AND METHODS OF USE
WO2004000997A2 (en) 2002-03-19 2003-12-31 Curagen Corporation Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2003081210A2 (en) 2002-03-21 2003-10-02 Sunesis Pharmaceuticals, Inc. Identification of kinase inhibitors
WO2003083041A2 (en) 2002-03-22 2003-10-09 Biogen, Inc. Cripto-specific antibodies
EP1347046A1 (en) 2002-03-22 2003-09-24 Research Association for Biotechnology Full-length cDNA sequences
WO2003089624A2 (en) 2002-03-25 2003-10-30 Uab Research Foundation Fc receptor homolog, reagents, and uses thereof
WO2003083074A2 (en) 2002-03-28 2003-10-09 Idec Pharmaceuticals Corporation Novel gene targets and ligands that bind thereto for treatment and diagnosis of colon carcinomas
US20030194704A1 (en) 2002-04-03 2003-10-16 Penn Sharron Gaynor Human genome-derived single exon nucleic acid probes useful for gene expression analysis two
WO2003087306A2 (en) 2002-04-05 2003-10-23 Agensys, Inc. Nucleic acid and corresponding protein entitled 98p4b6 useful in treatment and detection of cancer
US20040101874A1 (en) 2002-04-12 2004-05-27 Mitokor Inc. Targets for therapeutic intervention identified in the mitochondrial proteome
WO2003087768A2 (en) 2002-04-12 2003-10-23 Mitokor Targets for therapeutic intervention identified in the mitochondrial proteome
WO2003088808A2 (en) 2002-04-16 2003-10-30 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
US20030228319A1 (en) 2002-04-16 2003-12-11 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
WO2003089904A2 (en) 2002-04-17 2003-10-30 Baylor College Of Medicine Aib1 as a prognostic marker and predictor of resistance to encocrine therapy
WO2004042346A2 (en) 2002-04-24 2004-05-21 Expression Diagnostics, Inc. Methods and compositions for diagnosing and monitoring transplant rejection
WO2003093444A2 (en) 2002-05-03 2003-11-13 Incyte Corporation Transporters and ion channels
WO2003097803A2 (en) 2002-05-15 2003-11-27 Avalon Pharmaceuticals Cancer-linked gene as target for chemotherapy
US20030224454A1 (en) 2002-05-30 2003-12-04 Ryseck Rolf Peter Human solute carrier family 7, member 11 (hSLC7A11)
WO2003101400A2 (en) 2002-06-04 2003-12-11 Avalon Pharmaceuticals, Inc. Cancer-linked gene as target for chemotherapy
WO2003101283A2 (en) 2002-06-04 2003-12-11 Incyte Corporation Diagnostics markers for lung cancer
WO2003104270A2 (en) 2002-06-06 2003-12-18 Ingenium Pharmaceuticals Ag Dudulin 2 genes, expression products, non-human animal model: uses in human hematological disease
WO2003104275A2 (en) 2002-06-06 2003-12-18 Oncotherapy Science, Inc. Genes and polypeptides relating to human colon cancers
WO2003104399A2 (en) 2002-06-07 2003-12-18 Avalon Pharmaceuticals, Inc Cancer-linked gene as target for chemotherapy
WO2003105758A2 (en) 2002-06-12 2003-12-24 Avalon Pharmaceuticals, Inc. Cancer-linked gene as target for chemotherapy
US20040022727A1 (en) 2002-06-18 2004-02-05 Martin Stanton Aptamer-toxin molecules and methods for using same
US20040249130A1 (en) 2002-06-18 2004-12-09 Martin Stanton Aptamer-toxin molecules and methods for using same
WO2004000221A2 (en) 2002-06-20 2003-12-31 The Regents Of The University Of California Compositions and methods for modulating lymphocyte activity
WO2004001004A2 (en) 2002-06-21 2003-12-31 Johns Hopkins University School Of Medicine Membrane associated tumor endothelium markers
US20040001827A1 (en) 2002-06-28 2004-01-01 Dennis Mark S. Serum albumin binding peptides for tumor targeting
WO2004009622A2 (en) 2002-07-19 2004-01-29 Cellzome Ag Protein complexes of cellular networks underlying the development of cancer and other diseases
WO2004011611A2 (en) 2002-07-25 2004-02-05 Genentech, Inc. Taci antibodies and uses thereof
US7659241B2 (en) 2002-07-31 2010-02-09 Seattle Genetics, Inc. Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease
EP1394274A2 (en) 2002-08-06 2004-03-03 Genox Research, Inc. Methods of testing for bronchial asthma or chronic obstructive pulmonary disease
WO2004015426A1 (en) 2002-08-06 2004-02-19 Bayer Healthcare Ag Diagnostics and therapeutics for diseases associated with human cxc chemokine receptor 5(cxcr5)
WO2004016225A2 (en) 2002-08-19 2004-02-26 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
WO2004020583A2 (en) 2002-08-27 2004-03-11 Bristol-Myers Squibb Company Polynucleotide predictor set for identifying protein tyrosine kinase modulators
WO2004020595A2 (en) 2002-08-29 2004-03-11 Five Prime Therapeutics, Inc. Novel human polypeptides encoded by polynucleotides
WO2004022778A1 (en) 2002-09-05 2004-03-18 Garvan Institute Of Medical Research Methods of diagnosis and prognosis of ovarian cancer
WO2004022709A2 (en) 2002-09-06 2004-03-18 Mannkind Corporation Epitope sequences
WO2004040000A2 (en) 2002-09-09 2004-05-13 Nura, Inc G protein coupled receptors and uses thereof
WO2004027049A2 (en) 2002-09-20 2004-04-01 Astral, Inc. Methods and compositions to generate and control the effector profile of t cells by simultaneous loading and activation of selected subsets of antigen presenting cells
JP2004113151A (ja) 2002-09-27 2004-04-15 Sankyo Co Ltd 癌遺伝子及びその用途
WO2004031238A2 (en) 2002-10-03 2004-04-15 Mcgill Univeristy Antibodies and cyclic peptides which bind cea (carcinoembryonic antigen) and their use as cancer therapeutics
WO2004032842A2 (en) 2002-10-04 2004-04-22 Van Andel Research Institute Molecular sub-classification of kidney tumors and the discovery of new diagnostic markers
US20050048572A1 (en) 2002-10-31 2005-03-03 Genentech, Inc. Methods and compositions for increasing antibody production
WO2004043361A2 (en) 2002-11-08 2004-05-27 Genentech, Inc. Compositions and methods for the treatment of natural killer cell related diseases
WO2004044178A2 (en) 2002-11-13 2004-05-27 Genentech, Inc. Methods and compositions for diagnosing dysplasia
WO2004045553A2 (en) 2002-11-15 2004-06-03 The Board Of Trustees Of The University Of Arkansas Ca125 gene and its use for diagnostic and therapeutic interventions
WO2004045516A2 (en) 2002-11-15 2004-06-03 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
WO2004045520A2 (en) 2002-11-15 2004-06-03 Musc Foundation For Research Development Complement receptor 2 targeted complement modulators
WO2004046342A2 (en) 2002-11-20 2004-06-03 Biogen Idec Inc. Novel gene targets and ligands that bind thereto for treatment and diagnosis of carcinomas
WO2004047749A2 (en) 2002-11-21 2004-06-10 University Of Utah Research Foundation Purinergic modulation of smell
WO2004048938A2 (en) 2002-11-26 2004-06-10 Protein Design Labs, Inc. Methods of detecting soft tissue sarcoma, compositions and methods of screening for soft tissue sarcoma modulators
WO2004053079A2 (en) 2002-12-06 2004-06-24 Diadexus, Inc. Compositions, splice variants and methods relating to ovarian specific genes and proteins
EP1439393A2 (en) 2002-12-13 2004-07-21 Bayer Healthcare LLC Detection methods using TIMP 1 for colon cancer diagnosis
US20040197325A1 (en) 2002-12-20 2004-10-07 Debbie Law Antibodies against GPR64 and uses thereof
WO2004058309A1 (en) 2002-12-23 2004-07-15 Human Genome Sciences, Inc. Neutrokine-alpha conjugate, neutrokine-alpha complex, and uses thereof
WO2004063709A2 (en) 2003-01-08 2004-07-29 Bristol-Myers Squibb Company Biomarkers and methods for determining sensitivity to epidermal growth factor receptor modulators
WO2004063362A2 (en) 2003-01-10 2004-07-29 Cyclacel Limited Cell cycle progression proteins
WO2004063355A2 (en) 2003-01-10 2004-07-29 Protein Design Labs, Inc. Novel methods of diagnosis of metastatic cancer, compositions and methods of screening for modulators of matastatic cancer
WO2004065577A2 (en) 2003-01-14 2004-08-05 Bristol-Myers Squibb Company Polynucleotides and polypeptides associated with the nf-kb pathway
WO2004065576A2 (en) 2003-01-15 2004-08-05 Millennium Pharmaceuticals, Inc. Methods and compositions for the treatment of urological disorder using differential expressed polypeptides
US20040229310A1 (en) 2003-01-23 2004-11-18 Genentech, Inc. Methods for producing humanized antibodies and improving yield of antibodies or antigen binding fragments in cell culture
WO2004065491A1 (en) 2003-01-24 2004-08-05 Schering Ag Hydrophilic, thiol-reactive cyanine dyes and conjugates thereof with biomolecules for fluorescence diagnosis
WO2004074320A2 (en) 2003-02-14 2004-09-02 Sagres Discovery, Inc. Therapeutic targets in cancer
US20030224411A1 (en) 2003-03-13 2003-12-04 Stanton Lawrence W. Genes that are up- or down-regulated during differentiation of human embryonic stem cells
US7511032B2 (en) 2003-10-22 2009-03-31 The United States Of America As Represented By The Secretary, Department Of Health And Human Services Pyrrolobenzodiazepine derivatives, compositions comprising the same and methods related thereto
US7498298B2 (en) 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
US7557099B2 (en) 2004-03-01 2009-07-07 Spirogen Limited Pyrrolobenzodiazepines as key intermediates in the synthesis of dimeric cytotoxic pyrrolobenzodiazepines
US7528126B2 (en) 2004-03-09 2009-05-05 Spirogen Limited Pyrrolobenzodiazepines
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US7989595B2 (en) 2005-06-20 2011-08-02 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
US8449883B2 (en) 2005-06-20 2013-05-28 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
WO2007001851A2 (en) 2005-06-20 2007-01-04 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
US20090018086A1 (en) 2005-07-07 2009-01-15 Seattle Genetics, Inc. Monomethylvaline Compounds Having Phenylalanine Side-Chain Replacements at the C-Terminus
US20090111756A1 (en) 2005-07-07 2009-04-30 Seattle Genectics, Inc. Monomethylvaline Compounds Having Phenylalanine Carboxy Modifications at the C-Terminus
US20070049758A1 (en) 2005-09-01 2007-03-01 Roche Palo Alto Llc Diaminopyrimidines as P2X3 and P2X2/3 modulators
US20090036431A1 (en) 2006-01-25 2009-02-05 Sanofi-Aventis Cytotoxic Agents Comprising New Tomaymycin Derivatives
US8226945B2 (en) 2006-05-30 2012-07-24 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
US20100047257A1 (en) 2006-07-18 2010-02-25 Sanofi-Aventis Antagonist antibody for the treatment of cancer
US20090304710A1 (en) 2006-10-19 2009-12-10 Sanofi-Aventis Novel anti-cd38 antibodies for the treatment of cancer
WO2008083312A2 (en) * 2006-12-28 2008-07-10 Medarex, Inc. Chemical linkers and cleavable substrates and conjugates thereof
US7723485B2 (en) 2007-05-08 2010-05-25 Genentech, Inc. Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates
WO2009052249A1 (en) 2007-10-19 2009-04-23 Genentech, Inc. Cysteine engineered anti-tenb2 antibodies and antibody drug conjugates
DE102009051799A1 (de) * 2009-11-03 2011-05-05 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Bifunktionale Prodrugs und Drugs
US20110256157A1 (en) * 2010-04-15 2011-10-20 Spirogen Limited Pyrrolobenzodiazepines and conjugates thereof
WO2011130616A1 (en) 2010-04-15 2011-10-20 Spirogen Limited Pyrrolobenzodiazepines used to treat proliferative diseases
WO2011130598A1 (en) 2010-04-15 2011-10-20 Spirogen Limited Pyrrolobenzodiazepines and conjugates thereof
US20130028919A1 (en) 2010-04-15 2013-01-31 Spirogen Developments Sàrl Targeted pyrrolobenzodiazapine conjugates
WO2012113847A1 (en) 2011-02-25 2012-08-30 Lonza Ltd Branched linker for protein drug conjugates

Non-Patent Citations (237)

* Cited by examiner, † Cited by third party
Title
"The Chemistry of Heterocyclic Compounds, A series of Monographs", 1950, JOHN WILEY & SONS, article "Volumes 13, 14, 16, 19, and 28"
ALMAGRO; FRANSSON, FRONT. BIOSCI., vol. 13, 2008, pages 1619 - 1633
AM. J. HUM. GENET., vol. 49, no. 3, 1991, pages 555 - 565
AMIEL J. ET AL., HUM. MOL. GENET., vol. 5, 1996, pages 355 - 357
ANNU. REV. NEUROSCI., vol. 21, 1998, pages 309 - 345
ARAI H. ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 3463 - 3470
ARAI H. ET AL., JPN. CIRC. J., vol. 56, 1992, pages 1303 - 1307
ATTIE T. ET AL., HUM. MOL. GENET., vol. 4, 1995, pages 2407 - 2409
ATWELL ET AL., J. MED. CHEM., vol. 42, 1999, pages 3400
AURICCHIO A. ET AL., HUM. MOL. GENET., vol. 5, 1996, pages 351 - 354
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1993, GREENE PUBLISHING AND WILEY-INTERSCIENCE
BAREL M. ET AL., MOL. IMMUNOL., vol. 35, 1998, pages 1025 - 1031
BARELLA ET AL., BIOCHEM. J., vol. 309, 1995, pages 773 - 779
BARNETT T. ET AL., GENOMICS, vol. 3, 1988, pages 59 - 66
BECK ET AL., J. MOL. BIOL., vol. 228, 1992, pages 433 - 441
BECK ET AL., J. MOL. BIOL., vol. 255, 1996, pages 1 - 13
BERNHARD ET AL., BIOCONJUGATE CHEM., vol. 5, 1994, pages 126 - 132
BIOCHEM. BIOPHYS. RES. COMMUN., vol. 255, no. 2, 1999, pages 283 - 288
BIOCHEM. BIOPHYS. RES. COMMUN., vol. 275, no. 3, 2000, pages 783 - 788
BIOORG. MED. CHEM. LETT., vol. 21, 2011, pages 4985 - 4988
BISHOP, D.T. ET AL., NAT. GENET., vol. 41, no. 8, 2009, pages 920 - 925
BLOOD, vol. 100, no. 9, 2002, pages 3068 - 3076
BLOOD, vol. 99, no. 8, 2002, pages 2662 - 2669
BLUMBERG H. ET AL., CELL, vol. 104, 2001, pages 9 - 19
BOGER D.; ISHIZAKILB T.; KITOS P.; SUNTORNWAT 0., J. ORG. CHEM., vol. 55, 1990, pages 5823 - 5832
BOSE ET AL., J. AM. CHEM. SOC., vol. 114, 1992, pages 4939 - 4941
BOURGEOIS C. ET AL., J. CLIN. ENDOCRINOL. METAB., vol. 82, 1997, pages 3116 - 3123
CANCER RES., vol. 61, no. 15, 2001, pages 5857 - 5860
CARTER ET AL., NUCLEIC ACIDS RES., vol. 13, 1985, pages 4431 - 4443
CARTER, P.; SENTER, P., THE CANCER JOUR, vol. 14, no. 3, 2008, pages 154 - 169
CELL, vol. 109, no. 3, 2002, pages 397 - 407
CHAN,J.; WATT, V.M., ONCOGENE, vol. 6, no. 6, 1991, pages 1057 - 1061
CHARLTON: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 245 - 254
CHEM. EUR. J., vol. 12, 2006, pages 3655 - 3671
CHEN ET AL., CANCER RES, vol. 67, 2007, pages 4924 - 4932
CHEN ET AL., CANCER RES., vol. 67, no. 10, 2007, pages 4924 - 4932
CHO H.-S. ET AL., NATURE, vol. 421, 2003, pages 756 - 760
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CICCODICOLA, A. ET AL., EMBO J., vol. 8, no. 7, 1989, pages 1987 - 1991
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLARK H.F. ET AL., GENOME RES., vol. 13, 2003, pages 2265 - 2270
CLARK, H.F. ET AL., GENOME RES., vol. 13, no. 10, 2003, pages 2265 - 2270
CLARKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
COUSSENS L. ET AL., SCIENCE, vol. 230, no. 4730, 1985, pages 1132 - 1139
CREE ET AL., ANTICANCER DRUGS, vol. 6, 1995, pages 398 - 404
CROUCH ET AL., J. IMMUNOL. METH., vol. 160, 1993, pages 81 - 88
DAVIS ET AL., PROC. NATL. ACAD. SCI USA, vol. 98, no. 17, 2001, pages 9772 - 9777
DE NOOIJ-VAN DALEN, A.G. ET AL., INT. J. CANCER, vol. 103, no. 6, 2003, pages 768 - 774
DENNIS ET AL., J BIOL CHEM., vol. 277, 2002, pages 35035 - 35043
DENNIS ET AL.: "Albumin Binding As A General Strategy For Improving The Pharmacokinetics Of Proteins", J BIOL CHEM., vol. 277, 2002, pages 35035 - 35043
DOBNER ET AL., EUR. J. IMMUNOL., vol. 22, 1992, pages 2795 - 2799
DORNAN ET AL., BLOOD, vol. 114, no. 13, 2009, pages 2721 - 2729
DOYLE ET AL., JOUR. ANTIMICROB. CHEMO., vol. 65, no. 5, 2009, pages 949 - 959
DUBOWCHIK ET AL., BIOCONJ. CHEM., vol. 13, 2002, pages 855 - 869
DUBOWCHIK ET AL., BIOCONJUGATE CHEM., vol. 13, no. 4, 2002, pages 855 - 869
DUMOUTIER L. ET AL., J. IMMUNOL., vol. 167, 2001, pages 3545 - 3549
EDELMAN ET AL., PROC. NATL. ACAD. OF SCI., vol. 63, no. 1, 1969, pages 78 - 85
EHSANI A. ET AL., GENOMICS, vol. 15, 1993, pages 426 - 429
ELIEL, E.; WILEN, S.: "Stereochemistry oforganic Compounds", 1994, JOHN WILEY & SONS, INC.
ELSHOURBAGY N.A. ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 3873 - 3879
ERICSSON, T.A. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 100, no. 11, 2003, pages 6759 - 6764
FEILD, J.A. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 258, no. 3, 1999, pages 578 - 582
FUCHS S. ET AL., MOL. MED., vol. 7, 2001, pages 115 - 124
FUJISAKU ET AL., J. BIOL. CHEM., vol. 264, no. 4, 1989, pages 2118 - 2125
FURUSHIMA, K. ET AL., DEV. BIOL., vol. 306, no. 2, 2007, pages 480 - 492
GARY S.C. ET AL., GENE, vol. 256, 2000, pages 139 - 147
GAUGITSCH, H.W. ET AL., J. BIOL. CHEM., vol. 267, no. 16, 1992, pages 11267 - 11273
GENE CHROMOSOME, vol. 17, pages 13.3
GENE CHROMOSOME, vol. 6, pages 21.3
GENOME RES., vol. 13, no. 10, 2003, pages 2265 - 2270
GENOMICS, vol. 62, no. 2, 1999, pages 281 - 284
GERHARD, D.S. ET AL., GENOME RES., vol. 14, no. 10B, 2004, pages 2121 - 2127
GERNGROSS, NAT. BIOTECH., vol. 22, 2004, pages 1409 - 1414
GERY, S. ET AL., ONCOGENE, vol. 22, no. 18, 2003, pages 2723 - 2727
GETZ ET AL.: "Anal. Biochem.", vol. 273, 1999, SOLTEC VENTURES, pages: 73 - 80
GLYNNE-JONES ET AL., INT J CANCER., vol. 94, no. 2, 15 October 2001 (2001-10-15), pages 178 - 84
GOMEZ ET AL., BIOTECHNOL. PROG., vol. 26, 2010, pages 1438 - 1445
GOMEZ ET AL., BIOTECHNOLOGY AND BIOENG, vol. 105, no. 4, 2010, pages 748 - 760
GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59
GREGSON ET AL., JOUR. MED. CHEM., vol. 47, no. 5, 2004, pages 1161 - 1174
GU Z. ET AL., ONCOGENE, vol. 19, 2000, pages 1288 - 1296
HA ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1526 - 1531
HADJIVASSILEVA ET AL., JOUR. ANTIMICROB. CHEMO., vol. 56, no. 3, 2005, pages 513 - 518
HAENDLER B. ET AL., J. CARDIOVASC. PHARMACOL., vol. 20, 1992
HAMBLETT ET AL., CLIN. CANCER RES., vol. 10, 2004, pages 7063 - 7070
HARMS, P.W., GENES DEV., vol. 17, no. 21, 2003, pages 2624 - 2629
HARTLEY ET AL., CANCER RES., vol. 64, no. 18, 2004, pages 6693 - 6699
HASHIMOTO ET AL., IMMUNOGENETICS, vol. 40, no. 4, 1994, pages 287 - 295
HATA, K. ET AL., ANTICANCER RES., vol. 29, no. 2, 2009, pages 617 - 623
HAY ET AL., J. MED. CHEM., vol. 46, 2003, pages 2456
HIGUCHI: "PCR Protocols", 1990, ACADEMIC PRESS, pages: 177 - 183
HO ET AL., GENE, vol. 77, 1989, pages 51 - 59
HOCHHAUSER ET AL., CLIN. CANCER RES., vol. 15, no. 6, 2009, pages 2140 - 2147
HOFSTRA R.M.W. ET AL., EUR. J. HUM. GENET., vol. 5, 1997, pages 180 - 185
HOFSTRA R.M.W. ET AL., NAT. GENET., vol. 12, 1996, pages 445 - 447
HORIE ET AL., GENOMICS, vol. 67, 2000, pages 146 - 152
HUBERT, R.S. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 96, no. 25, 1999, pages 14523 - 14528
IMMUNOGENETICS, vol. 54, no. 2, 2002, pages 87 - 95
INT. REV. CYTOL., vol. 196, 2000, pages 177 - 244
ISHIKAWA, N. ET AL., CANCER RES., vol. 67, no. 24, 2007, pages 11601 - 11611
ITO ET AL., GENE, vol. 102, 1991, pages 67 - 70
J. AM. CHEM. SOC., vol. 82, 1960, pages 5566
J. BIOL. CHEM., vol. 270, no. 37, 1995, pages 21984 - 21990
J. BIOL. CHEM., vol. 276, no. 29, 2001, pages 27371 - 27375
J. BIOL. CHEM., vol. 277, no. 22, 2002, pages 19665 - 19672
J. BIOL. CHEM., vol. 278, no. 33, 2003, pages 30813 - 30820
J. MED. CHEM., vol. 46, 2003, pages 2132 - 2151
JANEWAY, C.; TRAVERS, P.; WALPORT, M.; SHLOMCHIK: "Immuno Biology, 5th Ed.,", 2001, GARLAND PUBLISHING
JANEWAY, C.; TRAVERS, P.; WALPORT, M.; SHLOMCHIK: "Immunobiology, 5th Ed.,", 2001, GARLAND PUBLISHING
JEFFREY ET AL., J. MED. CHEM., vol. 48, 2005, pages 1344
JONSSON ET AL., IMMUNOGENETICS, vol. 29, no. 6, 1989, pages 411 - 413
JUNUTULA ET AL., JOUR OF IMMUN. METHODS, vol. 332, 2008, pages 41 - 52
JUNUTULA ET AL., NATURE BIOTECH., vol. 26, no. 8, 2008, pages 925 - 932
KABAT ET AL.: "Sequences of proteins of immunological interest 5th Ed.,", 1991, US DEPT OF HEALTH AND HUMAN SERVICE, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences ofProteins of Immunological Interest, 5th Ed.,", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences ofProteins of Immunological Interest, 5th Ed.,", vol. 1-3, 1991, NIH PUBLICATION 91-3242
KASAHARA ET AL., IMMUNOGENETICS, vol. 30, no. 1, 1989, pages 66 - 68
KIM, M.H. ET AL., MOL. CELL. BIOL., vol. 29, no. 8, 2009, pages 2264 - 2277
KINDT ET AL.: "Kuby Immunology, 6th ed.,", 2007, W.H. FREEMAN AND CO., pages: 91
KOHLER ET AL., NATURE, vol. 256, 1975, pages 495
KUHNS J.J. ET AL., J. BIOL. CHEM., vol. 274, 1999, pages 36422 - 36427
KUMMER, M.P. ET AL., J. BIOL. CHEM., vol. 284, no. 4, 2009, pages 2296 - 2306
KUNKEL ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1987, pages 488
L. F. TIETZE; J. M. VON HOF; M. MÜLLER; B. KREWER; I. SCHUBERTH, ANGEW. CHEM. INT. ED., vol. 49, 2010, pages 7336 - 7339
L. LÁZÁR; E. MEZ6; M. HERCZEG; A. LIPTÁK; S. ANTUS; A. BORBÁS, TETRAHEDRON, vol. 68, 2012, pages 7386 - 7399
L. TIETZE; H. SCHUSTER; K. SCHMUCK; 1. SCHUBERTH; F. ALVES, BIOORG. & MED. CHEM., vol. 16, 2008, pages 6312 - 6318
LAB. INVEST., vol. 82, no. 11, 2002, pages 1573 - 1582
LAJINESS J.; BOGER D., J. ORG. CHEM., vol. 76, 2011, pages 583 - 587
LARHAMMAR ET AL., J. BIOL. CHEM., vol. 260, no. 26, 1985, pages 14111 - 14119
LE ET AL., FEBS LETT., vol. 418, no. 1-2, 1997, pages 195 - 199
LI ET AL., NAT. BIOTECH., vol. 24, 2006, pages 210 - 215
LIANG ET AL., CANCER RES., vol. 60, 2000, pages 4907 - 12
LIU ET AL., J. BIOL. CHEM., vol. 273, 1998, pages 20252 - 20260
LUND ET AL., EUR. J. BIOCHEM., vol. 267, 2000, pages 7246 - 7256
LYON, R. ET AL., METHODS IN ENZYM., vol. 502, 2012, pages 123 - 138
MALLYA, M. ET AL., GENOMICS, vol. 80, no. 1, 2002, pages 113 - 123
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
MATHER ET AL.: "Annals N. Y Acad. Sci.", vol. 383, 1982, pages: 44 - 68
MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251
MCGLINCHEY, R.P. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 106, no. 33, 2009, pages 13731 - 13736
MENDOZA ET AL., CANCER RES., vol. 62, 2002, pages 5485 - 5488
MILLER ET AL., JOUR. OF IMMUNOLOGY, vol. 170, 2003, pages 4854 - 4861
MIURA ET AL., BLOOD, vol. 92, 1998, pages 2815 - 2822
MIURA ET AL., GENOMICS, vol. 38, no. 3, 1996, pages 299 - 304
MONTPETIT, A.; SINNETT, D., HUM. GENET., vol. 105, no. 1-2, 1999, pages 162 - 164
MOORE M. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 84, 1987, pages 9194 - 9198
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
MUELLER ET AL., EUR. J. BIOCHEM., vol. 22, 1992, pages 1621 - 1625
MULLER ET AL., EUR. J. IMMUNOL., vol. 22, no. 6, 1992, pages 1621 - 1625
MUNGALL A.J. ET AL., NATURE, vol. 425, 2003, pages 805 - 811
NAGASE T. ET AL., DNA RES., vol. 7, no. 2, 2000, pages 143 - 150
NAKAMUTA M. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 177, 1991, pages 34 - 39
NAKAYAMA ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 277, no. 1, 2000, pages 124 - 127
NAN, H. ET AL., INT. J. CANCER, vol. 125, no. 4, 2009, pages 909 - 917
NARITA, N. ET AL., ONCOGENE, vol. 28, no. 34, 2009, pages 3058 - 3068
NARUSE ET AL., TISSUE ANTIGENS, vol. 59, 2002, pages 512 - 519
NATURE, vol. 395, no. 6699, 1998, pages 288 - 291
NAVENOT, J.M. ET AL., MOL. PHARMACOL., vol. 75, no. 6, 2009, pages 1300 - 1306
O'DOWD, B.F. ET AL., FEBS LETT., vol. 394, no. 3, 1996, pages 325 - 329
OGAWA Y. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 178, 1991, pages 248 - 255
OKAMOTO Y. ET AL., BIOL. CHEM., vol. 272, 1997, pages 21589 - 21596
OLAFSEN ET AL., PROTEIN ENG. DESIGN & SEL., vol. 17, no. 4, 2004, pages 315 - 323
ONCOGENE, vol. 10, no. 5, 1995, pages 897 - 905
ONCOGENE, vol. 14, no. 11, 1997, pages 1377 - 1382
OSOL, A.: "Remington's Pharmaceutical Sciences 16th edition,", 1980
PAQUETTE, LEO A.: "Principles of Modern Heterocyclic Chemistry", 1968, article "Chapters 1, 3, 4, 6, 7, and 9"
PARRISH-NOVAK J. ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 47517 - 47523
PEPPER ET AL., CANCER RES., vol. 64, no. 18, 2004, pages 6750 - 6755
PHILLIPS ET AL., CANCER RES., vol. 68, 2008, pages 9280 - 90
PHILLIPS GDL; LI GM; DUGGER DL ET AL.: "Targeting HER2-Positive Breast Cancer with Trastuzumab-DMl, an Antibody-Cytotoxic Drug Conjugate", CANCER RES., vol. 68, 2008, pages 9280 - 90, XP055013498, DOI: doi:10.1158/0008-5472.CAN-08-1776
PINGAULT V. ET AL., HUM. GENET., vol. 111, 2002, pages 198 - 206
PLETNEV S. ET AL., BIOCHEMISTRY, vol. 42, 2003, pages 12617 - 12624
POLAKIS, P., CURRENT OPINION IN PHARMACOLOGY, vol. 5, 2005, pages 382 - 387
PORTOLANO ET AL., J. IMMUNOL., vol. 150, 1993, pages 880 - 887
PREUD'HOMME ET AL., CLIN. EXP. IMMUNOL., vol. 90, no. 1, 1992, pages 141 - 146
PROC. NATL. ACAD. SCI. U.S.A., vol. 100, no. 7, 2003, pages 4126 - 4131
PROC. NATL. ACAD. SCI. U.S.A., vol. 93, no. 1, 1996, pages 136 - 140
PROC. NATL. ACAD. SCI. U.S.A., vol. 96, no. 20, 1999, pages 11531 - 11536
PROC. NATL. ACAD. SCI. U.S.A., vol. 98, no. 17, 2001, pages 9772 - 9777
PROC. NATL. ACAD. SCI. U.S.A., vol. 99, no. 26, 2002, pages 16899 - 16903
PUFFENBERGER E.G. ET AL., CELL, vol. 79, 1994, pages 1257 - 1266
RAHMAN ET AL., JOUR. AMER. CHEM. SOC., vol. 131, no. 38, 2009, pages 13756 - 13766
REITER R.E. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 95, 1998, pages 1735 - 1740
RIBAS, G. ET AL., J. IMMUNOL., vol. 163, no. 1, 1999, pages 278 - 287
ROSS ET AL., CANCER RES., vol. 62, 2002, pages 2546 - 2553
ROUX ET AL., J. IMMUNOL., vol. 161, 1998, pages 4083 - 4090
RUSS J ORG CHEM, vol. 43, 2007, pages 855 - 860
S. P. PARKER,: "McGraw-Hill Dictionary of Chemical Terms", 1984, MCGRAW-HILL BOOK COMPANY
SAKAGUCHI ET AL., EMBO J., vol. 7, no. 11, 1988, pages 3457 - 3464
SAKAMOTO A.; YANAGISAWA M. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 178, 1991, pages 656 - 663
SALANTI, G. ET AL., AM. J. EPIDEMIOL., vol. 170, no. 5, 2009, pages 537 - 545
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
SAMBROOK; RUSSEL: "Molecular Cloning: A Laboratory Manual, 3rd edition;", 2001
SANDERSON ET AL., CLIN. CANCER RES., vol. 11, 2005, pages 843 - 852
SCHERER, S.E. ET AL., NATURE, vol. 440, no. 7082, 2006, pages 346 - 351
SEMBA K. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 82, 1985, pages 6497 - 6501
SERVENIUS ET AL., J. BIOL. CHEM., vol. 262, 1987, pages 8759 - 8766
SHEIKH F. ET AL., J. IMMUNOL., vol. 172, 2004, pages 2006 - 2010
SHEN ET AL., NATURE BIOTECH., vol. 30, no. 2, 2012, pages 184 - 191
SINGLETON ET AL.: "Dictionary of Microbiology and Molecular Biology, 2nd Ed.,", 1994, J. WILEY & SONS
SINHA S.K. ET AL., J. IMMUNOL, vol. 150, 1993, pages 5311 - 5320
STRAUSBERG ET AL., PROC. NATL. ACAD. SCI USA, vol. 99, 2002, pages 16899 - 16903
STRAUSBERG R.L. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 99, 2002, pages 16899 - 16903
SVENSSON P.J. ET AL., HUM. GENET., vol. 103, 1998, pages 145 - 148
SWIERCZ J.M. ET AL., J. CELL BIOL., vol. 165, 2004, pages 869 - 880
TAKEDA, S. ET AL., FEBS LETT., vol. 520, no. 1-3, 2002, pages 97 - 101
TAWARAGI Y. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 150, 1988, pages 89 - 96
TEN DIJKE,P. ET AL., SCIENCE, vol. 264, no. 5155, 1994, pages 101 - 104
TERCEL ET AL., ANGEW. CHEM., INT. ED., vol. 50, 2011, pages 2606 - 2609
TERCEL ET AL., J. MED. CHEM, vol. 46, 2003, pages 2132 - 2151
TERCEL M: "UNSYMMETRICAL DNA CROSS-LINKING AGENTS", JOURNAL OF MEDICINAL CHEMISTRY, AMERICAN CHEMICAL SOCIETY, US, vol. 46, 1 January 2003 (2003-01-01), pages 2132 - 2151, XP008079149, ISSN: 0022-2623, DOI: 10.1021/JM020526P *
THOMPSON, J.S. ET AL., SCIENCE, vol. 293, no. 5537, 2001, pages 2108 - 2111
THURSTON ET AL., CHEM. REV., vol. 94, 1994, pages 433 - 465
TONNELLE ET AL., EMBO J., vol. 4, no. 11, 1985, pages 2839 - 2847
TOUCHMAN ET AL., GENOME RES., vol. 10, 2000, pages 165 - 173
TREANOR, J.J. ET AL., NATURE, vol. 382, no. 6586, 1996, pages 80 - 83
TSUKAMOTO, H. ET AL., CANCER SCI., vol. 100, no. 10, 2009, pages 1895 - 1901
TSUTSUMI M. ET AL., GENE, vol. 228, 1999, pages 43 - 49
UCHIDA ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 266, 1999, pages 593 - 602
URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216
VALLETTE ET AL., NUC. ACIDS RES., vol. 17, 1989, pages 723 - 733
VERHEIJ J.B. ET AL., AM. J. MED. GENET., vol. 108, 2002, pages 223 - 225
VON HOEGEN ET AL., J. IMMUNOL., vol. 144, no. 12, 1990, pages 4870 - 4877
WEIS J.J. ET AL., J. EXP. MED., vol. 167, 1988, pages 1047 - 1066
WEIS J.J. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 83, 1986, pages 5639 - 5643
WELLS ET AL., GENE, vol. 34, 1985, pages 315 - 323
WILSON ET AL., J. EXP. MED., vol. 173, 1991, pages 137 - 146
XU, M.J. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 280, no. 3, 2001, pages 768 - 775
XU, X.Z. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 98, no. 19, 2001, pages 10692 - 10697
YAMAGUCHI, N. ET AL., BIOL. CHEM., vol. 269, no. 2, 1994, pages 805 - 808
YAMAMOTO T. ET AL., NATURE, vol. 319, 1986, pages 230 - 234
YAMAMOTO, Y. ET AL., HEPATOLOGY, vol. 37, no. 3, 2003, pages 528 - 533
YAZAKI; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 255 - 268
YU ET AL., J. IMMUNOL., vol. 148, no. 2, 1992, pages 633 - 637
ZAMMIT, D.J. ET AL., MOL. CELL. BIOL., vol. 22, no. 3, 2002, pages 946 - 952
ZOLLER ET AL., METHODS ENZYMOL., vol. 100, 1983, pages 468 - 500
ZOLLER, M.J.; SMITH, M., NUCL. ACIDS RES., vol. 10, 1982, pages 6487 - 6500

Cited By (73)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11147852B2 (en) 2011-12-23 2021-10-19 Pfizer Inc. Engineered antibody constant regions for site-specific conjugation and methods and uses therefor
US20170002074A1 (en) * 2013-12-13 2017-01-05 Genentech, Inc. Anti-cd33 antibodies and immunoconjugates
JP2017505604A (ja) * 2013-12-13 2017-02-23 ジェネンテック, インコーポレイテッド 抗cd33抗体とイムノコンジュゲート
US9951133B2 (en) * 2013-12-13 2018-04-24 Genentech, Inc. Anti-CD33 antibodies and immunoconjugates
US10556951B2 (en) 2013-12-13 2020-02-11 Genentech, Inc. Anti-CD33 antibodies and immunoconjugates
US10632210B2 (en) 2013-12-16 2020-04-28 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
US10533058B2 (en) 2013-12-16 2020-01-14 Genentech Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
US11692043B2 (en) 2013-12-16 2023-07-04 Medimmune Limited Peptidomimetic compounds and antibody-drug conjugates thereof
US10124069B2 (en) 2013-12-16 2018-11-13 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
US10544215B2 (en) 2013-12-16 2020-01-28 Genentech, Inc. 1-(Chloromethyl)-2,3-dihydro-1H-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
JP2018076307A (ja) * 2014-01-27 2018-05-17 ファイザー・インク 二官能性細胞毒性剤
US10973920B2 (en) 2014-06-30 2021-04-13 Glykos Finland Oy Saccharide derivative of a toxic payload and antibody conjugates thereof
US11084877B2 (en) 2014-09-12 2021-08-10 Genentech, Inc. Anti-CLL-1 antibodies and immunoconjugates
WO2016040856A2 (en) 2014-09-12 2016-03-17 Genentech, Inc. Cysteine engineered antibodies and conjugates
JP2017531620A (ja) * 2014-09-12 2017-10-26 ジェネンテック, インコーポレイテッド システイン操作抗体及びコンジュゲート
US9751946B2 (en) 2014-09-12 2017-09-05 Genentech, Inc. Anti-CLL-1 antibodies and immunoconjugates
EP3693391A1 (en) 2014-09-12 2020-08-12 Genentech, Inc. Anti-cll-1 antibodies and immunoconjugates
EP3782654A1 (en) 2014-09-12 2021-02-24 Genentech, Inc. Anti-her2 antibodies and immunoconjugates
WO2016040868A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anti-cll-1 antibodies and immunoconjugates
US10266597B2 (en) 2014-09-12 2019-04-23 Genentech, Inc. Anti-CLL-1 antibodies and immunoconjugates
US10239947B2 (en) 2014-09-12 2019-03-26 Genentech, Inc. Anti-CLL-1 antibodies and immunoconjugates
US10227412B2 (en) 2014-09-12 2019-03-12 Genentech, Inc. Anti-CLL-1 antibodies and immunoconjugates
US10556895B2 (en) 2014-12-03 2020-02-11 Genentech, Inc. Quaternary amine compounds and antibody-drug conjugates thereof
US11104673B2 (en) 2014-12-03 2021-08-31 Genentech, Inc. Quaternary amine compounds and antibody-drug conjugates thereof
US20200087297A1 (en) * 2014-12-03 2020-03-19 Genentech, Inc. Quaternary amine compounds and antibody-drug conjugates thereof
JP2018513120A (ja) * 2015-03-09 2018-05-24 ハイデルベルク ファルマ ゲゼルシャフト ミット ベシュレンクテル ハフツング 新規アマトキシン−抗体コンジュゲート
US10842882B2 (en) 2015-03-09 2020-11-24 Heidelberg Pharma Gmbh Amatoxin-antibody conjugates
US10870706B2 (en) 2015-03-20 2020-12-22 Pfizer Inc. Bifunctional cytotoxic agents containing the CTI pharmacophore
WO2016151432A1 (en) 2015-03-20 2016-09-29 Pfizer Inc. Bifunctional cytotoxic agents containing the cti pharmacophore
US11365263B2 (en) 2015-03-20 2022-06-21 Pfizer Inc. Bifunctional cytotoxic agents containing the CTI pharmacophore
WO2016205176A1 (en) * 2015-06-15 2016-12-22 Genentech, Inc. Antibodies and immunoconjugates
US10017577B2 (en) 2015-06-15 2018-07-10 Genentech, Inc. Antibodies and immunoconjugates
US10501545B2 (en) 2015-06-16 2019-12-10 Genentech, Inc. Anti-CLL-1 antibodies and methods of use
US11466087B2 (en) 2015-06-16 2022-10-11 Genentech, Inc. Anti-CLL-1 antibodies and methods of use
JP2021006531A (ja) * 2015-07-12 2021-01-21 ハンジョウ ディーエーシー バイオテック シーオー.,エルティディ.Hangzhou Dac Biotech Co.,Ltd. 細胞結合分子の共役のための架橋連結体
CN111533778B (zh) * 2015-07-28 2023-04-25 上海皓元生物医药科技有限公司 一种抗体偶联药物连接子的工业化生产方法
CN111533778A (zh) * 2015-07-28 2020-08-14 上海皓元生物医药科技有限公司 一种抗体偶联药物连接子的工业化生产方法
CN106380508A (zh) * 2015-07-28 2017-02-08 上海皓元生物医药科技有限公司 一种抗体偶联药物连接子的工业化生产方法
US10632196B2 (en) 2015-10-02 2020-04-28 Genentech, Inc. Pyrrolobenzodiazepine antibody drug conjugates and methods of use
KR20180054849A (ko) * 2015-10-02 2018-05-24 제넨테크, 인크. 피롤로벤조디아제핀 항체 약물 콘쥬게이트 및 이의 사용 방법
US10639373B2 (en) 2015-10-02 2020-05-05 Genentech, Inc. Pyrrolobenzodiazepine antibody drug conjugates and methods of use
KR102111338B1 (ko) * 2015-10-02 2020-05-15 제넨테크, 인크. 피롤로벤조디아제핀 항체 약물 콘쥬게이트 및 이의 사용 방법
CN108472384B (zh) * 2015-10-16 2021-09-24 基因泰克公司 受阻二硫化物药物缀合物
JP2018537416A (ja) * 2015-10-16 2018-12-20 ジェネンテック, インコーポレイテッド 束縛ジスルフィド薬物コンジュゲート
WO2017064675A1 (en) 2015-10-16 2017-04-20 Genentech, Inc. Hindered disulfide drug conjugates
US10729738B2 (en) 2015-10-16 2020-08-04 Genentech, Inc. Hindered disulfide drug conjugates
CN108472384A (zh) * 2015-10-16 2018-08-31 基因泰克公司 受阻二硫化物药物缀合物
JP2018532780A (ja) * 2015-10-29 2018-11-08 ゲオルグ−アウグスト−ウニヴェルシタート・ゲッティンゲン・スティフツング・オーフェントリヒェン・レヒツ 二官能性プロドラッグ
US11622958B2 (en) 2015-10-29 2023-04-11 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Bifunctional prodrugs
DE102016105449A1 (de) 2015-10-29 2017-05-04 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Bifunktionale Prodrugs
JP7054387B2 (ja) 2015-10-29 2022-04-13 ゲオルグ-アウグスト-ウニヴェルシタート・ゲッティンゲン・スティフツング・オーフェントリヒェン・レヒツ 二官能性プロドラッグ
WO2017072295A1 (de) * 2015-10-29 2017-05-04 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Bifunktionale prodrugs
AU2016347606B2 (en) * 2015-10-29 2021-05-13 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Bifunctional prodrugs
CN108472387A (zh) * 2015-10-29 2018-08-31 乔治-奥古斯特-哥廷根公法基金会大学 双官能前药
US10689458B2 (en) 2015-11-30 2020-06-23 Pfizer Inc. Site specific HER2 antibody drug conjugates
EP3455225A1 (en) * 2016-05-13 2019-03-20 Femtogenix Limited Asymmetric conjugate compounds
WO2017201449A1 (en) 2016-05-20 2017-11-23 Genentech, Inc. Protac antibody conjugates and methods of use
WO2017205741A1 (en) 2016-05-27 2017-11-30 Genentech, Inc. Bioanalytical method for the characterization of site-specific antibody-drug conjugates
WO2017223275A1 (en) 2016-06-24 2017-12-28 Mersana Therapeutics, Inc. Pyrrolobenzodiazepines and conjugates thereof
WO2018031662A1 (en) 2016-08-11 2018-02-15 Genentech, Inc. Pyrrolobenzodiazepine prodrugs and antibody conjugates thereof
WO2019030367A1 (en) * 2017-08-11 2019-02-14 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts METHOD FOR SYNTHESIZING MONOPROTEGED BIFUNCTIONAL PRODRUGS AND MEDICINANT-BASED CONJUGATES THEREOF, METHOD FOR PREPARING ANTIBODY-MEDICINAL CONJUGATES, METHOD FOR SYNTHESIZING MONOPROTEGED BIFUNCTIONAL PRODRUGS AND MEDICINANT-BASED DRUG CONJUGATES BASED ON THE SAME, AND METHOD FOR PREPARING PREPARATION OF CONJUGATES ANTIBODY-MEDICINE
US11325888B2 (en) 2017-08-11 2022-05-10 Georg-August-Universitaet Goettingen Stiftung Oeffentlichen Rechts Method for the synthesis of monoprotected bifunctional prodrugs and antibody drug conjugates based thereon as well as a method for preparing antibody drug conjugates
AU2018315424B2 (en) * 2017-08-11 2022-03-17 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Method for the synthesis of monoprotected bifunctional prodrugs and antibody drug conjugates based thereon as well as a method for preparing antibody drug conjugates
EP3441386A1 (en) * 2017-08-11 2019-02-13 Georg-August-Universität Göttingen Method for the synthesis of monoprotected bifunctional prodrugs and antibody drug conjugates based thereon as well as a method for preparing antibody drug conjugates
US11364303B2 (en) 2017-09-29 2022-06-21 Pfizer Inc. Cysteine engineered antibody drug conjugates
WO2020089811A1 (en) 2018-10-31 2020-05-07 Novartis Ag Dc-sign antibody drug conjugates
WO2020123275A1 (en) 2018-12-10 2020-06-18 Genentech, Inc. Photocrosslinking peptides for site specific conjugation to fc-containing proteins
WO2020157491A1 (en) 2019-01-29 2020-08-06 Femtogenix Limited G-a crosslinking cytotoxic agents
EP3936151A4 (en) * 2019-03-07 2023-01-11 ABL Bio, Inc. ANTIBODY-DRUG CONJUGATE AND USE OF THE DRUG
WO2022020288A1 (en) 2020-07-21 2022-01-27 Genentech, Inc. Antibody-conjugated chemical inducers of degradation of brm and methods thereof
WO2023147328A1 (en) 2022-01-26 2023-08-03 Genentech, Inc. Antibody-conjugated chemical inducers of degradation with hydolysable maleimide linkers and methods thereof
WO2023147329A1 (en) 2022-01-26 2023-08-03 Genentech, Inc. Antibody-conjugated chemical inducers of degradation and methods thereof
WO2024224112A1 (en) * 2023-04-28 2024-10-31 Iksuda Therapeutics Limited Antibody-drug conjugate compounds, and methods of use and treatment

Also Published As

Publication number Publication date
US20150165063A1 (en) 2015-06-18
TWI636792B (zh) 2018-10-01
BR112016002829A2 (pt) 2017-09-19
CN105636612A (zh) 2016-06-01
CL2016000318A1 (es) 2016-08-19
US10442836B2 (en) 2019-10-15
HK1222544A1 (en) 2017-07-07
HK1222566A1 (zh) 2017-07-07
EP3033111A1 (en) 2016-06-22
KR20160042080A (ko) 2016-04-18
JP2020040954A (ja) 2020-03-19
AU2014307080B2 (en) 2018-06-07
CN105636612B (zh) 2020-01-14
MX2016001862A (es) 2016-08-03
IL243586A0 (en) 2016-02-29
TW201534327A (zh) 2015-09-16
AU2014307080A1 (en) 2016-02-11
JP6993084B2 (ja) 2022-02-03
CR20160125A (es) 2016-05-04
CA2918139A1 (en) 2015-02-19
JP2016530254A (ja) 2016-09-29
SG11201601005XA (en) 2016-03-30
EP3033111B1 (en) 2019-03-13
EA201690195A1 (ru) 2016-05-31
PH12016500246A1 (en) 2016-05-16

Similar Documents

Publication Publication Date Title
AU2014307080B2 (en) 1-(chloromethyl)-2,3-dihydro-1H-benzo(E)indole dimer antibody-drug conjugate compounds, and methods of use and treatment
EP3082876B1 (en) 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
EP3226909B1 (en) Quaternary amine compounds and antibody-drug conjugates thereof
US11090322B2 (en) Anthracycline disulfide intermediates, antibody-drug conjugates and methods
EP3082874A2 (en) Peptidomimetic compounds and antibody-drug conjugates thereof
AU2014364927A1 (en) Peptidomimetic compounds and antibody-drug conjugates thereof
HK1222544B (en) 1-(chloromethyl)-2, 3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
HK1222566B (zh) 抗體-藥物綴合物及使用和治療方法
HK1226330A1 (en) 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
HK1226330B (zh) 1-(氯甲基)-2,3-二氫-1h-苯並[e]吲哚二聚體抗體-藥物綴合物化合物及使用和治療方法
HK1238167B (en) Anthracycline disulfide intermediates, antibody-drug conjugates and methods

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14736243

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2014736243

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2918139

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 243586

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: DZP2016000028

Country of ref document: DZ

WWE Wipo information: entry into national phase

Ref document number: 38812

Country of ref document: MA

WWE Wipo information: entry into national phase

Ref document number: 12016500246

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 201690195

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 2016533294

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014307080

Country of ref document: AU

Date of ref document: 20140616

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 000246-2016

Country of ref document: PE

Ref document number: MX/A/2016/001862

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112016002829

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20167006280

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 16062667

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: CR2016-000125

Country of ref document: CR

WWE Wipo information: entry into national phase

Ref document number: A201601176

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 112016002829

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20160211