New! Search for patents from more than 100 countries including Australia, Brazil, Sweden and more

WO2003003984A2 - Novel proteins and nucleic acids encoding same - Google Patents

Novel proteins and nucleic acids encoding same Download PDF


Publication number
WO2003003984A2 PCT/US2002/021268 US0221268W WO03003984A2 WO 2003003984 A2 WO2003003984 A2 WO 2003003984A2 US 0221268 W US0221268 W US 0221268W WO 03003984 A2 WO03003984 A2 WO 03003984A2
Prior art keywords
nucleic acid
Prior art date
Application number
Other languages
French (fr)
Other versions
WO2003003984A8 (en
WO2003003984A9 (en
Elma R. Fernandes
Corine A. M. Vernet
Richard A. Shimkets
David W. Anderson
Muralidhara Padigaru
Ferenc L. Boldog
Li Li
Suresh G. Shenoy
Stacie J. Casman
Luca Rastelli
John P. Ii Alsobrook
Catherine E. Burgess
William M. Grosse
Vladimir Y. Gusev
Weizhen Ji
Denise M. Lepley
Xiaohong Liu
Amanda J. Mezick
Meera Patturajan
Lei Shen
Steven K. Spaderna
Kimberly A. Spytek
Edward S. Szekeres, Jr.
Raymond J. Taupier, Jr.
Velizar T. Tchernev
Bryan D. Zerhusen
Edward Z. Voss
Original Assignee
Curagen Corporation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US30316801P priority Critical
Priority to US30324101P priority
Priority to US60/303,168 priority
Priority to US60/303,241 priority
Priority to US09/966,545 priority patent/US20020172999A1/en
Priority to US09/966,545 priority
Priority to US09/966,546 priority
Priority to US09/966,546 priority patent/US20020168716A1/en
Priority to US09/965,212 priority patent/US20030003462A1/en
Priority to US09/965,212 priority
Priority to US60/368,996 priority
Priority to US36906502P priority
Priority to US36899602P priority
Priority to US60/369,065 priority
Priority to US60/378,730 priority
Priority to US37873002P priority
Priority to US60/384,327 priority
Priority to US38432702P priority
Priority to US60/386,816 priority
Priority to US38681602P priority
Priority to US10/174,372 priority
Priority to US17437202A priority
Application filed by Curagen Corporation filed Critical Curagen Corporation
Priority claimed from AU2002327198A external-priority patent/AU2002327198A1/en
Publication of WO2003003984A2 publication Critical patent/WO2003003984A2/en
Publication of WO2003003984A9 publication Critical patent/WO2003003984A9/en
Publication of WO2003003984A8 publication Critical patent/WO2003003984A8/en



    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals


Disclosed herein are nucleic acid sequences that encode novel polypeptides. Also disclosed are polypeptides encoded by these nucleic acid sequences, and antibodies, which immunospecifically-bind to the polypeptide, as well as derivatives, variants, mutants, or fragments of the aforementioned polypeptide, polynucleotide, or antibody. The invention further discloses therapeutic, diagnostic and research methods for diagnosis, treatment, and prevention of disorders involving anyone of these novel human nucleic acids and proteins.




The invention generally relates to nucleic acids and polypeptides. More particularly, the invention relates to nucleic acids encoding novel molecule (MOL) polypeptides, as well as vectors, host cells, antibodies, and recombinant methods for producing these nucleic acids and polypeptides.


The invention is based in part upon the discovery of nucleic acid sequences encoding novel polypeptides. The novel nucleic acids and polypeptides are referred to herein as MOLX, or MOL1, MOL2, MOL3, MOL4, MOL5, MOL6, MOL7, MOL8, MOL9, MOL10, MOL1 1, MOL12, MOL13, MOL14, MOL15, MOL16, MOL17, MOL18, MOL19, MOL20, MOL21, MOL22, and MOL23 nucleic acids and polypeptides. These nucleic acids and polypeptides, as well as derivatives, homologs, analogs and fragments thereof, will hereinafter be collectively designated as "MOLX" nucleic acid or polypeptide sequences.

In one aspect, the invention provides an isolated MOLX nucleic acid molecule encoding a MOLX polypeptide that includes a nucleic acid sequence that has identity to the nucleic acids disclosed in SEQ ID NOS: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101 , 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166. In some embodiments, the MOLX nucleic acid molecule will hybridize under stringent conditions to a nucleic acid sequence complementary to a nucleic acid molecule that includes a protein-coding sequence of a MOLX nucleic acid sequence. The invention also includes an isolated nucleic acid that encodes a MOLX polypeptide, or a fragment, homolog, analog or derivative thereof. For example, the nucleic acid can encode a polypeptide at least 80% identical to a polypeptide comprising the amino acid sequences of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1 , 114, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167. The nucleic acid can be, for example, a genomic DNA fragment or a cDNA molecule that includes the nucleic acid sequence of any of SEQ ID NOS:l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 1 15, 117, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166.

Also included in the invention is an oligonucleotide, e.g., an oligonucleotide which includes at least 6 contiguous nucleotides of a MOLX nucleic acid (e.g., SEQ ID NOS:l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 115, 117, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166) or a complement of said oligonucleotide.

Also included in the invention are substantially purified MOLX polypeptides (SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 11 1, 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167). In certain embodiments, the MOLX polypeptides include an amino acid sequence that is substantially identical to the amino acid sequence of a human MOLX polypeptide. The invention also features antibodies that immunoselectively bind to MOLX polypeptides, or fragments, homologs, analogs or derivatives thereof.

In another aspect, the invention includes pharmaceutical compositions that include therapeutically- or prophylactically-effective amounts of a therapeutic and a pharmaceutically-acceptable carrier. The therapeutic can be, e.g., a MOLX nucleic acid, a MOLX polypeptide, or an antibody specific for a MOLX polypeptide. In a further aspect, the invention includes, in one or more containers, a therapeutically- or prophylactically- effective amount of this pharmaceutical composition.

In a further aspect, the invention includes a method of producing a polypeptide by culturing a cell that includes a MOLX nucleic acid, under conditions allowing for expression ofthe MOLX polypeptide encoded by the DNA. If desired, the MOLX polypeptide can then be recovered.

In another aspect, the invention includes a method of detecting the presence of a MOLX polypeptide in a sample. In the method, a sample is contacted with a compound that selectively binds to the polypeptide under conditions allowing for formation of a complex between the polypeptide and the compound. The complex is detected, if present, thereby identifying the MOLX polypeptide within the sample.

The invention also includes methods to identify specific cell or tissue types based on their expression of a MOLX. Also included in the invention is a method of detecting the presence of a MOLX nucleic acid molecule in a sample by contacting the sample with a MOLX nucleic acid probe or primer, and detecting whether the nucleic acid probe or primer bound to a MOLX nucleic acid molecule in the sample. In a further aspect, the invention provides a method for modulating the activity of a

MOLX polypeptide by contacting a cell sample that includes the MOLX polypeptide with a compound that binds to the MOLX polypeptide in an amount sufficient to modulate the activity of said polypeptide. The compound can be, e.g., a small molecule, such as a nucleic acid, peptide, polypeptide, peptidomimetic, carbohydrate, lipid or other organic (carbon-containing) or inorganic molecule, as further described herein.

Also within the scope ofthe invention is the use of a therapeutic in the manufacture of a medicament for treating or preventing disorders or syndromes including, e.g., endometriosis, fertility disorders, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, systemic lupus erythematosus, asthma, emphysema, scleroderma, allergy, ARDS, Von Hippel-Lindau (VHL) syndrome, Alzheimer's disease, stroke, tuberous sclerosis, hypercalceimia, Parkinson's disease, Huntington's disease, cerebral palsy, epilepsy, multiple sclerosis, ulcers, ataxia-telangiectasia, leukodystrophies, behavioral disorders, addiction, anxiety, pain, neuroprotection, osteoporosis, arthritis, ankylosing spondylitis, scoliosis, diabetes, autoimmune disease, myasthenia gravis, muscular dystrophy, renal artery stenosis, interstitial nephritis, glomerulonephritis, polycystic kidney disease, systemic lupus erythematosus, renal tubular acidosis, IgA nephropathy, Lesch-Nyhan syndrome, developmental disorders, growth disorders, and/or wounds, cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventricular (A-V) canal defect, ductus arteriosus , pulmonary stenosis , subaortic stenosis, ventricular septal defect (VSD), valve diseases, obesity, transplantation, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, graft versus host disease (GVHD), lymphaedema, adrenoleukodystrophy, congenital adrenal hyperplasia, neuronal developmental, organizational, mediated and interactive disorders and disease; endocrine dysfunctions, growth and reproductive disorders, injury repair, cancer including but not limited to lung or breast cancer, endocrine disorders, inflammatory disorders, gastro-intestinal disorders and disorders of he respiratory system, Rheumatoid arthritis (RA), CNS disorders, Down syndrome, Schizophrenia, nutritional deficiencies, primary open-angle glaucoma (POAG), and bone disorders, hematopoietic disorders, or other disorders. The therapeutic can be, e.g., a MOLX nucleic acid, a MOLX polypeptide, or a MOLX-specific antibody, or biologically-active derivatives or fragments thereof.

For example, the compositions ofthe present invention will have efficacy for treatment of patients suffering from: Cancer including endometriosis, fertility disorders, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, systemic lupus erythematosus, asthma, emphysema, scleroderma, allergy, ARDS, Von Hippel- Lindau (VHL) syndrome, Alzheimer's disease, stroke, tuberous sclerosis, hypercalceimia, Parkinson's disease, Huntington's disease, cerebral palsy, epilepsy, multiple sclerosis, ulcers, ataxia-telangiectasia, leukodystrophies, behavioral disorders, addiction, anxiety, pain, neuroprotection, osteoporosis, arthritis, ankylosing spondylitis, scoliosis, diabetes, autoimmune disease, myasthenia gravis, muscular dystrophy, renal artery stenosis, interstitial nephritis, glomerulonephritis, polycystic kidney disease, systemic lupus erythematosus, renal tubular acidosis, IgA nephropathy, Lesch-Nyhan syndrome, developmental disorders, growth disorders, and/or wounds, cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventricular (A-V) canal defect, ductus arteriosus , pulmonary stenosis , subaortic stenosis, ventricular septal defect (VSD), valve diseases, obesity, transplantation, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, graft versus host disease (GVHD), lymphaedema, adrenoleukodystrophy, congenital adrenal hyperplasia, neuronal developmental, organizational, mediated and interactive disorders and disease; endocrine dysfunctions, growth and reproductive disorders, injury repair, cancer including but not limited to lung or breast cancer, endocrine disorders, inflammatory disorders, gastro-intestinal disorders and disorders ofthe respiratory system, Rheumatoid arthritis (RA), CNS disorders, Down syndrome, Schizophrenia, nutritional deficiencies, primary open-angle glaucoma (POAG), and bone disorders, hematopoietic disorders and/or other pathologies and disorders ofthe like.

The polypeptides can be used as immunogens to produce antibodies specific for the invention and as vaccines. They can also be used to screen for potential agonist and antagonist compounds. For example, a cDNA encoding MOLX may be useful in gene therapy, and MOLX may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions ofthe present invention will have efficacy for treatment of patients suffering from endometriosis, fertility disorders, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, systemic lupus erythematosus, asthma, emphysema, scleroderma, allergy, ARDS, Von Hippel- Lindau (VHL) syndrome, Alzheimer's disease, stroke, tuberous sclerosis, hypercalceimia, Parkinson's disease, Huntington's disease, cerebral palsy, epilepsy, multiple sclerosis, ulcers, ataxia-telangiectasia, leukodystrophies, behavioral disorders, addiction, anxiety, pain, neuroprotection, osteoporosis, arthritis, ankylosing spondylitis, scoliosis, diabetes, autoimmune disease, myasthenia gravis, muscular dystrophy, renal artery stenosis, interstitial nephritis, glomerulonephritis, polycystic kidney disease, systemic lupus erythematosus, renal tubular acidosis, IgA nephropathy, Lesch-Nyhan syndrome, developmental disorders, growth disorders, and/or wounds, cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventricular (A-V) canal defect, ductus arteriosus , pulmonary stenosis , subaortic stenosis, ventricular septal defect (VSD), valve diseases, obesity, transplantation, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, graft versus host disease (GVHD), lymphaedema, adrenoleukodystrophy, congenital adrenal hyperplasia, neuronal developmental, organizational, mediated and interactive disorders and disease; endocrine dysfunctions, growth and reproductive disorders, injury repair, cancer including but not limited to lung or breast cancer, endocrine disorders, inflammatory disorders, gastro-intestinal disorders and disorders ofthe respiratory system, Rheumatoid arthritis (RA), CNS disorders, Down syndrome, Schizophrenia, nutritional deficiencies, primary open-angle glaucoma (POAG), and bone disorders, hematopoietic disorders and/or other pathologies and disorders.

The invention further includes a method for screening for a modulator of disorders or syndromes including, e.g., endometriosis, fertility disorders, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, systemic lupus erythematosus, asthma, emphysema, scleroderma, allergy, ARDS, Von Hippel-Lindau (VHL) syndrome, Alzheimer's disease, stroke, tuberous sclerosis, hypercalceimia,

Parkinson's disease, Huntington's disease, cerebral palsy, epilepsy, multiple sclerosis, ulcers, ataxia-telangiectasia, leukodystrophies, behavioral disorders, addiction, anxiety, pain, neuroprotection, osteoporosis, arthritis, ankylosing spondylitis, scoliosis, diabetes, autoimmune disease, myasthenia gravis, muscular dystrophy, renal artery stenosis, interstitial nephritis, glomerulonephritis, polycystic kidney disease, systemic lupus erythematosus, renal tubular acidosis, IgA nephropathy, Lesch-Nyhan syndrome, developmental disorders, growth disorders, and/or wounds, cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septal defect

(ASD), atrioventricular (A-V) canal defect, ductus arteriosus , pulmonary stenosis , subaortic stenosis, ventricular septal defect (VSD), valve diseases, obesity, transplantation, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, graft versus host disease (GVHD), lymphaedema, adrenoleukodystrophy, congenital adrenal hyperplasia, neuronal developmental, organizational, mediated and interactive disorders and disease; endocrine dysfunctions, growth and reproductive disorders, injury repair, cancer including but not limited to lung or breast cancer, endocrine disorders, inflammatory disorders, gastro-intestinal disorders and disorders ofthe respiratory system, Rheumatoid arthritis (RA), CNS disorders, Down syndrome, Schizophrenia, nutritional deficiencies, primary open-angle glaucoma (POAG), and bone disorders, hematopoietic disorders or other disorders related to cell signal processing and metabolic pathway modulation. The method includes contacting a test compound with a MOLX polypeptide and determining if the test compound binds to said MOLX polypeptide. Binding ofthe test compound to the MOLX polypeptide indicates the test compound is a modulator of activity, or of latency or predisposition to the aforementioned disorders or syndromes.

Also within the scope ofthe invention is a method for screening for a modulator of activity, or of latency or predisposition to an disorders or syndromes including, e.g., endometriosis, fertility disorders, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, systemic lupus erythematosus, asthma, emphysema, scleroderma, allergy, ARDS, Von Hippel-Lindau (VHL) syndrome, Alzheimer's disease, stroke, tuberous sclerosis, hypercalceimia, Parkinson's disease, Huntington's disease, cerebral palsy, epilepsy, multiple sclerosis, ulcers, ataxia-telangiectasia, leukodystrophies, behavioral disorders, addiction, anxiety, pain, neuroprotection, osteoporosis, arthritis, ankylosing spondylitis, scoliosis, diabetes, autoimmune disease, myasthenia gravis, muscular dystrophy, renal artery stenosis, interstitial nephritis, glomerulonephritis, polycystic kidney disease, systemic lupus erythematosus, renal tubular acidosis, IgA nephropathy, Lesch-Nyhan syndrome, developmental disorders, growth disorders, and/or wounds, cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septa! defect (ASD), atrioventricular (A-V) canal defect, ductus arteriosus , pulmonary stenosis , subaortic stenosis, ventricular septal defect (VSD), valve diseases, obesity, transplantation, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, graft versus host disease (GVHD), lymphaedema, adrenoleukodystrophy, congenital adrenal hyperplasia, neuronal developmental, organizational, mediated and interactive disorders and disease; endocrine dysfunctions, growth and reproductive disorders, injury repair, cancer including but not limited to lung or breast cancer, endocrine disorders, inflammatory disorders, gastro-intestinal disorders and disorders ofthe respiratory system, Rheumatoid arthritis (RA), CNS disorders, Down syndrome, Schizophrenia, nutritional deficiencies, primary open-angle glaucoma (POAG), and bone disorders, hematopoietic disorders or other disorders related to cell signal processing and metabolic pathway modulation by administering a test compound to a test animal at increased risk for the aforementioned disorders or syndromes. The test animal expresses a recombinant polypeptide encoded by a MOLX nucleic acid. Expression or activity of MOLX polypeptide is then measured in the test animal, as is expression or activity ofthe protein in a control animal which recombinantly-expresses MOLX polypeptide and is not at increased risk for the disorder or syndrome. Next, the expression of MOLX polypeptide in both the test animal and the control animal is compared. A change in the activity of MOLX polypeptide in the test animal relative to the control animal indicates the test compound is a modulator of latency ofthe disorder or syndrome. In yet another aspect, the invention includes a method for determining the presence of or predisposition to a disease associated with altered levels of a MOLX polypeptide, a MOLX nucleic acid, or both, in a subject (e.g., a human subject). The method includes measuring the amount ofthe MOLX polypeptide in a test sample from the subject and comparing the amount ofthe polypeptide in the test sample to the amount ofthe MOLX polypeptide present in a control sample. An alteration in the level ofthe MOLX polypeptide in the test sample as compared to the control sample indicates the presence of or predisposition to a disease in the subject. Preferably, the predisposition includes, e.g., endometriosis, fertility disorders, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, systemic lupus erythematosus, asthma, emphysema, scleroderma, allergy, ARDS, Von Hippel-Lindau (VHL) syndrome, Alzheimer's disease, stroke, tuberous sclerosis, hypercalceimia, Parkinson's disease, Huntington's disease, cerebral palsy, epilepsy, multiple sclerosis, ulcers, ataxia-telangiectasia, leukodystrophies, behavioral disorders, addiction, anxiety, pain, neuroprotection, osteoporosis, arthritis, ankylosing spondylitis, scoliosis, diabetes, autoimmune disease, myasthenia gravis, muscular dystrophy, renal artery stenosis, interstitial nephritis, glomerulonephritis, polycystic kidney disease, systemic lupus erythematosus, renal tubular acidosis, IgA nephropathy, Lesch-Nyhan syndrome, developmental disorders, growth disorders, and/or wounds, cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventricular (A-V) canal defect, ductus arteriosus , pulmonary stenosis , subaortic stenosis, ventricular septal defect (VSD), valve diseases, obesity, transplantation, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, graft versus host disease (GVHD), lymphaedema, adrenoleukodystrophy, congenital adrenal hyperplasia, neuronal developmental, organizational, mediated and interactive disorders and disease; endocrine dysfunctions, growth and reproductive disorders, injury repair, cancer including but not limited to lung or breast cancer, endocrine disorders, inflammatory disorders, gastro-intestinal disorders and disorders ofthe respiratory system, Rheumatoid arthritis (RA), CNS disorders, Down syndrome, Schizophrenia, nutritional deficiencies, primary open-angle glaucoma (POAG), and bone disorders, hematopoietic disorders. Also, the expression levels ofthe new polypeptides ofthe invention can be used in a method to screen for various cancers as well as to determine the stage of cancers.

In a further aspect, the invention includes a method of treating or preventing a pathological condition associated with a disorder in a mammal by administering to the subject a MOLX polypeptide, a MOLX nucleic acid, or a MOLX-specific antibody to a subject (e.g., a human subject), in an amount sufficient to alleviate or prevent the pathological condition. In preferred embodiments, the disorder, includes, e.g., endometriosis, fertility disorders, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, systemic lupus erythematosus, asthma, emphysema, scleroderma, allergy, ARDS, Von Hippel-Lindau (VHL) syndrome, Alzheimer's disease, stroke, tuberous sclerosis, hypercalceimia, Parkinson's disease, Huntington's disease, cerebral palsy, epilepsy, multiple sclerosis, ulcers, ataxia-telangiectasia, leukodystrophies, behavioral disorders, addiction, anxiety, pain, neuroprotection, osteoporosis, arthritis, ankylosing spondylitis, scoliosis, diabetes, autoimmune disease, myasthenia gravis, muscular dystrophy, renal artery stenosis, interstitial nephritis, glomerulonephritis, polycystic kidney disease, systemic lupus erythematosus, renal tubular acidosis, IgA nephropathy, Lesch-Nyhan syndrome, developmental disorders, growth disorders, and/or wounds, cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventricular (A-V) canal defect, ductus arteriosus , pulmonary stenosis , subaortic stenosis, ventricular septal defect (VSD), valve diseases, obesity, transplantation, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, graft versus host disease (GVHD), lymphaedema, adrenoleukodystrophy, congenital adrenal hyperplasia, neuronal developmental, organizational, mediated and interactive disorders and disease; endocrine dysfunctions, growth and reproductive disorders, injury repair, cancer including but not limited to lung or breast cancer, endocrine disorders, inflammatory disorders, gastro-intestinal disorders and disorders ofthe respiratory system, Rheumatoid arthritis (RA), CNS disorders, Down syndrome, Schizophrenia, nutritional deficiencies, primary open-angle glaucoma (POAG), and bone disorders, hematopoietic disorders, and/or other diseases or disorders.

In yet another aspect, the invention can be used in a method to identity the cellular receptors and downstream effectors ofthe invention by any one of a number of techniques commonly employed in the art. These include but are not limited to the two-hybrid system, affinity purification, co-precipitation with antibodies or other specific-interacting molecules.

Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing ofthe present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In the case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. Other features and advantages ofthe invention will be apparent from the following detailed description and claims.


The invention is based, in part, upon the discovery of novel nucleic acid sequences that encode novel polypeptides. The novel nucleic acids and their encoded polypeptides are referred to individually as MOL1-MOL23. The nucleic acids, and their encoded polypeptides, are collectively designated herein as "MOLX".

The novel MOLX nucleic acids ofthe invention include the nucleic acids whose sequences are provided in the tables herein, or a fragment, derivative, analog or homolog thereof. The novel MOLX proteins ofthe invention include the protein fragments whose sequences are provided in the tables herein The individual MOLX nucleic acids and proteins are described below. Within the scope of this invention is a method of using these nucleic acids and peptides in the treatment or prevention of a disorder related to cell signaling or metabolic pathway modulation.



A disclosed Notch-like nucleic acid of 7410 nucleotides, MOLla, alternatively referred to as SC29674552_EXT, is shown in Table 1 A. The disclosed MOLla open reading frame ("ORF") begins at the ATG initiation codon at nucleotides 1-3 and terminates at a TGA codon at nucleotides 7408-7410. In Table 1A, the start and stop codons are depicted with bold letters.

Table 1A. MOLla nucleotide sequence (SEQ ID NO:l).


The disclosed MOLla nucleotide encodes a protein which has 2469 amino acid residues, referred to as the MOLla protein. The MOLla protein was analyzed for signal peptide prediction and cellular localization. SignalP results predict that MOLla is cleaved between position 25 and 26 (AHA-LQ) of SEQ ID NO:2. Psort and Hydropathy profiles also predict that MOLla contains a signal peptide and is likely to be localized in the plasma membrane (Certainty=0.4600). A disclosed MOLla polypeptide sequence is presented in Table IB using the one-letter amino acid code.

Table IB. Encoded MOLla protein sequence (SEQ ID NO:2).


A region ofthe MOLla nucleic acid sequence has 6436 of 7416 bases (86%) identical to a Rattits norvegictis Notch-like protein mRNA (GENBANK- ID:RATNOTCHX | acc:M93661), with an E-value of 0.0. In all BLAST alignments herein, the "E-value" or "Expect" value is a numeric indication ofthe probability that the aligned sequences could have achieved their similarity to the BLAST query sequence by chance alone, within the database that was searched. For example, the probability that the subject ("Sbjct") retrieved from the MOLla BLAST analysis, e.g., the Raltus norvegiciis Notch-like protein mRNA, matched the Query MOLla sequence purely by chance is 0.0. MOLla also has 2443 of 2471 amino acid residues (98%) positive with patp:AAY06816 . Human Notch2 (humN2) protein sequence - Homo sapiens, 2471 aa. The Expect value is used as a convenient way to create a significance threshold for reporting results. The default value used for blasting is typically set to 0.0001. In BLAST 2.0, the Expect value is also used instead ofthe P value (probability) to report the significance of matches. For example, an E value of one assigned to a hit can be interpreted as meaning that in a database ofthe current size one might expect to see one match with a similar score simply by chance. An E value of zero means that one would not expect to see any matches with a similar score simply by chance. See, e.g., Occasionally, a string of X's or N's will result from a BLAST search. This is a result of automatic filtering ofthe query for low-complexity sequence that is performed to prevent artifactual hits. The filter substitutes any low-complexity sequence that it finds with the letter "N" in nucleotide sequence (e.g., "N NNNNNNNN NN'1) or the letter "X" in protein sequences (e.g., "XXXXXXXXX"). Low-complexity regions can result in high scores that reflect compositional bias rather than significant position-by-position alignment. Wootton and Federhen, Methods Enzymol 266:554-571, 1996.

Utilities for the MOLX nucleic acids and their encoded polypeptides can be inferred based on the homology ofthe disclosed MOLX nucleic acids and/or polypeptides (including domains ofthe encoded polypeptides) to previously described sequences.

MOLla expression in different tissues was examined through TaqMan as described below in Example 1.

MOLla is expressed in at least the following tissues: kidney, brain, lymph node, muscle, hippocampus, bone marrow, placenta, thyroid, para-thyroid, prostate, testis, epidermis, ovary, coronary artery, liver, lung, spinal cord, stomach, breast, lung, uterus, and colon. It is likely that Notch proteins are expressed in all tissues, so the widespread expression of MOLla agrees with its homology with Notch.

One or more consensus positions (Cons. Pos.) ofthe nucleotide sequence of MOLla have been identified as single nucleotide polymorphisms (SNPs) as shown in Table IC. A dash ("-"), when shown, means that a base is not present. The sign ">" means "is changed to". SNPs were identified using the techniques disclosed in Example 3.

Figure imgf000015_0001
Figure imgf000016_0001


MOLla was subjected to the exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case ofthe reverse primer, until the stop codon was reached. Such primers were designed based on in silico predictions for the full length cDNA, part (one or more exons) ofthe DNA or protein sequence ofthe target sequence, or by translated homology ofthe predicted exons to closely related human sequences sequences from other species. These primers were then employed in PCR amplification based on the following pool of human cDNAs: adrenal gland, bone marrow, brain - amygdala, brain - cerebellum, brain - hippocampus, brain - substantia nigra, brain - thalamus, brain -whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. Usually the resulting amplicons were gel purified, cloned and sequenced to high redundancy. The resulting sequences from all clones were assembled with themselves, with other fragments in CuraGen Corporation's database and with public ESTs. Fragments and ESTs were included as components for an assembly when the extent of their identity with another component ofthe assembly was at least 95% over 50 bp. In addition, sequence traces were evaluated manually and edited for corrections if appropriate. These procedures provide the sequence reported below, which is designated MOLlb, or alternatively Accession Number CG56250-02. This differs from the previously identified sequence in lacking 996 internal amino acids in addition to a few minor changes.

A disclosed Notch-like nucleic acid of 6728 nucleotides, MOLl b, is shown in Table IC. The disclosed MOLlb open reading frame ("ORF") begins at the ATG initiation codon at nucleotides 13-15, and terminates at a TGA codon at nucleotides 4431- 4434. In Table 1 D the start and stop codons are in bold letters, and the untranslated regions are underlined.

Table ID. MOLlb nucleotide sequence (SEQ ID NO:3).


The protein encoded by the MOLlb nucleic acid sequence has 2469 amino acid residues, and is disclosed in Table IE. The MOLlb protein was analyzed for signal peptide prediction and cellular localization. SignalP results predict that MOLlb is cleaved between position 25 and 26 (AHA-LQ) of SEQ ID NO:4. Psort and Hydropathy profiles also predict that MOLlb contains a signal peptide and is likely to be localized extracellularly (Certainty=0.7666).

Table IE. Encoded MOLlb protein sequence (SEQ ID NO:4).


The amino acid sequence of MOLlb has 1340 of 1343 amino acid residues (99%) identical to, and 1340 of 1343 amino acid residues (99%) similar to, the 2471 amino acid residue ptnr:TREMBLNEW-ACC:AAG37073 protein from Homo sapiens (Human) (NOTCH2 PROTEIN).

MOLlb expressed in at least the following tissues: adrenal gland, bone marrow, brain - amygdala, brain - cerebellum, brain - hippocampus, brain - substantia nigra, brain - thalamus, brain -whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus, Aorta, Ascending Colon, Bone, Cartilage, Cochlea, Colon, Coronary Artery, Epidermis, Foreskin, Liver, Lung, Lymph node, Lymphoid tissue, Muscle, Nasoepithelium, Ovary, Parathyroid Gland, Parotid Salivary glands, Peripheral Blood, Respiratory Bronchiole, Retina, Synovium/Synovial membrane, Thymus, Tonsils, Umbilical Vein, Vein, Whole Organism.

One or more consensus positions (Cons. Pos.) ofthe nucleotide sequence of MOLlb have been identified as single nucleotide polymorphisms (SNPs) as shown in Table I F. "Depth" represents the number of clones covering the region ofthe SNP. The Putative Allele Frequency (PAF) is the fraction of all the clones containing the SNP. A dash ("-"), when shown, means that a base is not present. The sign ">" means "is changed to".

Figure imgf000019_0001

The amino acid sequence of MOLla also had high homology to other proteins as shown in table 1 G.

Figure imgf000020_0001

A ClustalW analysis comparing disclosed proteins ofthe invention with related OR protein sequences is given in Table I H, with MOLla shown on line 1 and MOLl b on line 2.

In the ClustalW alignment ofthe MOLla and MOLlb proteins, as well as all other ClustalW analyses herein, the black outlined amino acid residues indicate regions of conserved sequence (i.e., regions that may be required to preserve structural or functional properties), whereas non-highlighted amino acid residues are less conserved and can potentially be mutated to a much broader extent without altering protein structure or function. Residue differences between any MOLX variant sequences herein are written to show the residue in the "a" variant and the residue position with respect to the "a" variant. MOL residues in all following sequence alignments that differ between the individual MOL variants are highlighted with a box and marked with the (o) symbol above the variant residue in all alignments herein. Table IH. ClustalW Analysis of MOLla

1) Novel MOLla (SEQ ID NO.-2)

2) Novel MOLlb (SEQ ID NO : 4 )

3) gi|lθ I252|pir| ]A35844 Xotch protein African clawed frog (SEQ ID

NO: 25)

4) gi|66 79096 |ref |NP_032742. I| Notch gene homolog 3, (Drosophila) [Mus musculus ] (SEQ ID NO: 26)

5) gi|l3 242247|ref |NP_077334.l| Notch gene homolog 2, (Drosophila) [Rattus norvegicus] (SEQ ID NO: 27)

6) gi|22 09059 [dbj |BAA20535. l| Notch 2 [Takifugu rubripes] (SEQ ID NO: 28)


Figure imgf000021_0001

210 220 230 240 90


H U α.

Figure imgf000022_0001

Figure imgf000022_0002
Figure imgf000022_0003

Figure imgf000022_0004
Figure imgf000022_0005

Figure imgf000023_0001
gi|6093542| EgγSD!3 SLlES5 M§H!^j^_|Ai__, DS MBigSaDBA - ϊ

Figure imgf000024_0001
Figure imgf000025_0001


Figure imgf000025_0002
Figure imgf000026_0001

oi oi oi oi oi

Figure imgf000026_0002
Figure imgf000026_0003

> o o o o

IQ IQ IQ IQ IQ IQ IQ IQ IQ IQ g IQ CQ (Q (Q (Q g IQ IQ IQ (fl CQ (Q IQ IQ IQ IQ g g g IQ 10 (Q (Q (Q μ- μ- μ- μ- μ- o μ. μ. μ. μ. μ. g o o μ- μ- μ- μ- μ- O 0 O t-i F oi u μ m p t (ri l-i l-i

H H I-1 H

0" (u o t to CO o t to rr P> tr

ID O t ~J ID O tO -J il- ID O tO vo o t -J *» vo t

CO vo rf- vo to vo . vo t CO VO rf- VO t to Vo ifc. vo t to vo f *. o to tπ o to o cn tπ o to o tπ tπ o to o tπ tπ t ro- *. tπ * i*- Lπ to vo to > tπ to vo to il- tπ to vo to φ. tπ to o to to vo ifc. σi — to VO Ifc. CO t 10 it* co — t vo *. ~J — —

Figure imgf000027_0001

2S50 1860 1870 1880



Figure imgf000028_0001

2090 2100 2110 2120


MOLlb ^^S ^^^ ^ S^M>mS sm^ S

Figure imgf000028_0002
gi| 6093542 I

Figure imgf000029_0001

2250 2260 2270 2280



2290 2300 2310 2320



Figure imgf000029_0002

2370 2380 2390 2400


2420 2420 2430 2440



2450 2460 2470 2480





Figure imgf000030_0001

Figure imgf000030_0002

2610 2620 2630


MOLlb AGGGQRG|GTHMSE@PHNNMQVYA- gi 1104252 I TSMQPQRTHIBEAFK gij 6679096] ASGALPAQPHPISVPSLPQSQTQLGPQSEVTPKRQVMA gij 13242247 I GGGGQRG|GTHMSE!PHSNMQVYA- giJ2209059| THCRLHTAHTFQSRCSCSPS NRFSRA1SSLSWGTCR- gi] 6093542 — - TSM SQITHI@EAFK - When the sequences ofthe invention are referred to as MOLl, this refers to the sequences disclosed as MOLla and MOLlb.

The presence of identifiable domains in MOLl, as well as all other MOLX proteins, was determined by searches using software algorithms such as P OSITE, DOMAIN, Blocks, Pfam, ProDomain, and Prints, and then determining the Interpro number by crossing the domain match (or numbers) using the Interpro website ( interpro). DOMAIN results, e.g., for MOLl as disclosed in Table II, were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST analyses. This BLAST analysis software samples domains found in the Smart and Pfam collections. For Table II and all successive DOMAIN sequence alignments, fully conserved single residues are indicated by black shading and "strong" semi-conserved residues are indicated by grey shading. The "strong" group of conserved amino acid residues may be any one ofthe following groups of amino acids: STA, NEQK, NHQK, NDEQ, QHRK, MILV, MILF, HY, FYW. Tables II- IN list the domain description from DOMAIN analysis results against

MOLl . The region from amino acid residue 1416 through 1454 (SEQ ID NO:2) most probably (E = l e"6) contains a domain found in Notch and Lin- 12, aligned here in table II. Notch and Lin- 12 are both involved in organismal development, cell cycle, and apoptosis. The region from amino acid residue 1504 through 1532 (SEQ ID NO:2) most probably (E = 2e"4) also contains a domain found in Notch and Lin- 12, aligned here in table 1 J. The region from amino acid residue 1875 through 1906 (SEQ ID NO:2) most probably (E = 6e" 3) contains an Ank repeat, aligned here in table IK. Ank repeats are markers for the protein ankyrin which is involved in cell adhesion and contact inhibition. The region from amino acid residue 1974 through 2006 (SEQ ID NO:2) most probably (E = 2e"4) also contains an Ank repeat, aligned here in table IL. The region from amino acid residue 182 through 215 (SEQ ID NO:2) most probably (E = le"4) contains a Calcium binding EGF- like domain, aligned here in table 1M. EGF is a growth factor that modulates the proliferation of many cell types. The region from amino acid residue 872 through 908 (SEQ ID NO:2) most probably (E = 9e" ) also contains a Calcium binding EGF-like domain, aligned here in table IN. This indicates that the MOLl sequence has properties similar to those of other proteins known to contain these domains. Table II. Domain Analysis of MOLl gnl I Smart 1 smart00004, NL, Domain found in Notch and Lin-12; The Notch protein is essential for the proper differentiation of the Drosophila ectoderm. This protein contains 3 NL domain CD-Length = 39 residues, 100.0% aligned Score = 50.1 bits (118), Expect = le-06

Figure imgf000032_0001

Table IK. Domain Analysis of MOLl gnl ] Pfam]pfam00023 , ank, Ank repeat

CD-Length = 33 residues, 97.0% aligned

Score = 44.7 bits (104), Expect = 6e-05

Figure imgf000032_0002

Figure imgf000032_0003

Smart | smart00179 (SEQ ID NO : 87 )

Figure imgf000033_0001

MOLl_8 B Smart] smart00179 B (SEQ ID NO:88)

Uses of the Compositions of the Invention

The protein similarity information, expression pattern, cellular localization, and map location for the protein and nucleic acid disclosed herein suggest that MOLl may have important structural and/or physiological functions characteristic ofthe EGF-like domain containing protein family. Therefore, the nucleic acids and proteins ofthe invention are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount ofthe nucleic acid or the protein are to be assessed. These also include potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), (v) an agent promoting tissue regeneration in vitro and in vivo, and (vi) a biological defense weapon.

The MOLl nucleic acids and proteins have applications in the diagnosis and/or treatment of various diseases and disorders. For example, the compositions of MOLl may have efficacy for the treatment of patients suffering from endometriosis, fertility disorders, cancer, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, systemic lupus erythematosus, asthma, emphysema, scleroderma, allergy, ARDS, Von Hippel-Lindau (VHL) syndrome, Alzheimer's disease, stroke, tuberous sclerosis, hypercalceimia, Parkinson's disease, Huntington's disease, cerebral palsy, epilepsy, multiple sclerosis, ulcers, ataxia-telangiectasia, leukodystrophies, behavioral disorders, addiction, anxiety, pain, neuroprotection, osteoporosis, hypercalceimia, arthritis, ankylosing spondylitis, scoliosis, diabetes, autoimmune disease, myasthenia gravis, muscular dystrophy, renal artery stenosis, interstitial nephritis, glomerulonephritis, polycystic kidney disease, systemic lupus erythematosus, renal tubular acidosis, IgA nephropathy, hypercalceimia, Lesch-Nyhan syndrome, developmental disorders, growth disorders, and/or wounds, as well as other diseases, disorders and conditions. The reactivation ofthe Notch signaling pathway during wound healing has been demonstrated and the similarity between developmental and regenerative processes has been suggested (Exp Cell Res 1999 Feb l;246(2):312-8).

These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel MOLl substances for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-MOLX Antibodies" section below. The disclosed MOLl protein has multiple hydrophilic regions, each of which can be used as an immunogen. In one embodiment, a contemplated MOLl epitope is from about amino acids 10 to 150. In another embodiment, a MOLl epitope is from about amino acids 160 to 190. In additional embodiments, MOLl epitopes are from about amino acids 195 to 350, 400 to 525, 550 to 575, 590 to 600, 610 to 650, 780 to 880, 900 to 1000, 1100 to 1150, 1175 to 1200, 1225 to 1300, and from about amino acids 1380 to 1500. These novel proteins can also be used to develop assay systems for functional analysis.




An open reading frame (ORF) for MOL2a was identified from nucleotides 1 to 2628. The disclosed MOL2a polypeptide (SEQ ID NO:6) encoded by SEQ ID NO:5 has 876 amino acid residues and is presented using the one-letter code in Table 2B. The SignalP, Psort and Hydropathy profile ofMOL2a indicate that this sequence does have a signal peptide localized between amino acids 57 and 58 (TNA-DS) and is likely to be localized to the plasma membrane (0.4600 certajnty). Therefore it is likely that MOL2a is available at the appropriate sub-cellular localization and hence accessible for the therapeutic uses described in this application.

Table 2B. Encoded MOL2a protein sequence (SEQ ID NO:6).


The MOL2a nucleic acid sequence, localized on the q26.3-28 region ofthe X chromosome, has 532 of 854 bases (62%) identical to a Homo sapiens Insulin-like growth factor binding protein-like protein mRNA (GENBANK-ID:AB020655|acc:AB020655).

The full amino acid sequence ofthe protein ofthe invention was found to have 318 of 672 amino acid residues (47%) identical to, and 445 of 672 residues (66%) similar to, the 977 amino acid residue Insulin-like growth factor binding protein-like protein from Homo sapiens (SPTREMBL-ACC:094933).

MOL2a expression in different tissues was examined through TaqMan as described below in Example 1.


MOL2b is a novel insulin-like growth factor binding protein-like protein. The novel nucleic acid of 1800 nucleotides, (191999007, SEQ ID NO:101) encoding a novel insulin-like growth factor binding protein-like protein is shown in Table 2C. The start and stop codons are in bold. Since the start and stop codons are not traditional initiation and termination codons, MOL2b could be a partial reading frame that could extend in the 5' and/or 3' directions.

Table 2C. MOL2b Nucleotide Sequence (SEQ ID NO:101)


Table 2D. Encoded MOL2b protein sequence (SEQ ID NO:102).



MOL2c is a novel insulin-like growth factor binding protein-like protein. The novel nucleic acid of 1800 nucleotides, (192586956, SEQ ID NO: 103) encoding a novel insulin-like growth factor binding protein-like protein is shown in Table 2E. The start and stop codons are in bold. Since the start and stop codons are not traditional initiation and termination codons, MOL2c could be a partial reading frame that could extend in the 5' and/or 3 ' directions.

Table 2E. MOL2c Nucleotide Sequence (SEQ ID NO:103)


Table 2F. Encoded MOL2c protein sequence (SEQ ID NO:104).


Table 2G shows a ClustalW alignment ofthe MOL2 variants.

Table 2G. ClustalW alignment of MOL2 variants

Figure imgf000038_0001

70 30 90 100 110 120


130 140 150 160 170 180


190 200 210 220 230 240


250 260 270 280 290 300



310 320 330 340 350 360


370 380 390 400 410 420


430 440 450 460 470 480

MOL2a LHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVI!___G_.D-V-FIHNLTNLRRLYLNGNQIERL 480 MOL2b njwrøW2"M____I______I___i______l__^^ KiWΪMM 425 MOL2C n?ϊwιewS-κϊπTO*fit»)a-«»)MMe)ni)nn:ι«ιewiv;ι»>ι<w<«: e)titia:iι W^. .^W 425

490 500 510 520 530 540


550 560 570 580 590 S00


Figure imgf000039_0001

670 680 690 700 710 720


730 740 750 760 770 780


790 300 810 820 830 340


850 860 870


Other BLAST results including the sequences used for ClustalW analysis are presented in Table 2H

Figure imgf000040_0002

This information is presented graphically in the multiple sequence alignment given in Table 2I(with MOL2a being shown on line 1) as a ClustalW analysis comparing MOL2a with related protein sequences.

Table 21 Information for the ClustalW proteins:

1) Novel MOL2a (SEQ ID NO: 6)

2) gi| 6691962|emb|CAB65788.l] (AL080239) insulin-like growth factor binding protein, acid labile subunit)) [Homo sapiens] (SEQ ID NO:30)

3) gi| 14424224 |sp|θ9499l| Y918_HUMAN HYPOTHETICAL PROTEIN KIAA0918 [Homo Sapiens] (SEQ ID NO:31)

4) gi|ll877257|emb|CAC18888.l| (AL109653) bG115 3.1 (novel protein) [Homo sapiens] (SEQ ID NO: 32)

5) gi 112733935 |re |XP_011654.11 KIAA0848 protein [Homo sapiens] (SEQ ID NO: 33)

6) gi|7662336|ref |NP_055741.l| KIAA0848 protein [Homo sapiens] (SEQ ID NO: 34)

Figure imgf000040_0001

Figure imgf000041_0001
Figure imgf000042_0001
Figure imgf000043_0001

Table 2Jlists the domain description from DOMAIN analysis results against MOL2a. The region from amino acid residue 252 through 302 (SEQ ID NO:6) most probably (E = le-6) contains a "leucine rich repeat C-terminal" domain, aligned here in Table 2J This indicates that the MOL2a sequence has properties similar to those of other proteins known to contain this domain.

Figure imgf000043_0002


Smart I smart00082

Figure imgf000043_0003
ID N0:89)

Chromosomal information

The Insulin-like growth factor binding protein-like protein disclosed in this invention maps to chromosome Xq26.3-28.

Tissue expression

MOL2 is expressed in at least the following tissues: adrenal gland, lymphatic tissues, and heart. Other tissues known to express insulin-like growth factor binding proteins are likely. Uses of the Compositions of the Invention

The expression pattern, map location and protein similarity information for MOL2 suggest that this a Insulin-like growth factor binding protein-like protein may function as a member ofthe Insulin-like growth factor binding protein-like protein family. Therefore, the MOL2 nucleic acids and proteins are useful in potential therapeutic applications implicated, for example but not limited to, in various pathologies /disorders as described below and/or other pathologies/disorders. Potential therapeutic uses for MOL2 are, for example but not limited to, the following: (i) Protein therapeutic, (ii) small molecule drug target, (iii) antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) diagnostic and/or prognostic marker, (v) gene therapy (gene delivery/gene ablation), (vi) research tools, and (vii) tissue regeneration in vitro and in vivo (regeneration for all these tissues and cell types composing these tissues and cell types derived from these tissues). The MOL2 nucleic acids and proteins are useful in potential therapeutic applications implicated in various diseases and disorders described below and/or other pathologies and disorders. For example, but not limited to, a cDNA encoding the a Insulin-like growth factor binding protein-like protein may be useful in gene therapy, and the a Insulin-like growth factor binding protein-like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions ofthe present invention will have efficacy for treatment of patients suffering from cancer, diabetes, cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventricular (A-V) canal defect, ductus arteriosus, pulmonary stenosis, subaortic stenosis, ventricular septal defect (VSD), valve diseases, tuberous sclerosis, scleroderma, obesity, transplantation, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, autoimmume disease, allergies, immunodeficiencies, graft versus host disease (GVHD), lymphaedema, adrenoleukodystrophy, and/or congenital adrenal hyperplasia. MOL2, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount ofthe nucleic acid or the protein are to be assessed. These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel MOL2 substances for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-MOLX Antibodies" section below. The disclosed MOL2 protein has multiple hydrophilic regions, each of which can be used as an immunogen. In one embodiment, a contemplated MOL2 epitope is from about amino acids 75 to 120. In another embodiment, a MOL2 epitope is from about amino acids 180 to 200. In additional embodiments, MOL2 epitopes are from about amino acids 280 to 380, 400 to 450, 475 to 500, and from about amino acids 680 to 850. These novel proteins can also be used to develop assay systems for functional analysis.



An additional protein ofthe invention, referred to herein as MOL3a, is a human Semaphorin B-like protein. The novel nucleic acid of 2271 nucleotides (SC85516573_EXT, SEQ ID NO:7) encoding a novel olfactory receptor-like protein is shown in Table 3A. An open reading frame (ORF) was identified beginning with an ATG initiation codon at nucleotides 1-3 and ending with a TAA codon at nucleotides 2269- 2271. The nucleotide sequence is presented in Table 3A with the start and stop codons are in bold letters.

Table 3A. MOL3a Nucleotide Sequence (SEQ ID NO:7)


The disclosed MOL3a polypeptide (SEQ ID NO: 8) encoded by SEQ ID NO:7 has 756 amino acid residues, and is presented using the one-letter code in Table 3B. The MOL3a protein was analyzed for signal peptide prediction and cellular localization. SignalP results predict that MOL3a is cleaved between position 31 and 32 (TTA-GG) of SEQ ID NO: 8. Psort and Hydropathy profiles also predict that MOL3a is likely to be localized at the plasma membrane (certainty of 0.7300).

Table 3B. Encoded MOL3a protein sequence (SEQ ID NO:8).


The MOL3a nucleic acid sequence has 1398/1672 (83%) identical to a mouse Semaphorin B mRNA (GENBANK-ID: X85991 ).

The full amino acid sequence of MOL3a was found to have 628 of 760 (82%) identical to, and 674 of 760 residues (88%) homologous with, the 760 amino acid residue Semaphorin B protein from mouse (ptnr: SWISSNEW-ACC:Q62178).

MOL3a expression in different tissues was examined through TaqMan as described below in Example 1.

MOL3a also has high homology to the proteins disclosed in the BLASTP searches ofthe proprietary PATP database shown in Table 3C.

Figure imgf000046_0001
Figure imgf000047_0001

Tissue Localization

MOL3a is expressed in at least the following tissues: Pituitary Gland, Thalamus Chromosomal Localization MOL3a maps to chromosome 1 .


In the present invention, the target sequence identified previously, MOL3a, was subjected to the exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case ofthe reverse primer, until the stop codon was reached. Such primers were designed based on in silico predictions for the full length cDNA, part (one or more exons) ofthe DNA or protein sequence ofthe target sequence, or by translated homology ofthe predicted exons to closely related human sequences sequences from other species. These primers were then employed in PCR amplification based on the following pool of human cDNAs: adrenal gland, bone marrow, brain - amygdala, brain - cerebellum, brain - hippocampus, brain - substantia nigra, brain - thalamus, brain -whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. Usually the resulting amplicons were gel purified, cloned and sequenced to high redundancy. The resulting sequences from all clones were assembled with themselves, with other fragments in CuraGen Corporation's database and with public ESTs. Fragments and ESTs were included as components for an assembly when the extent of their identity with another component ofthe assembly was at least 95% over 50 bp. In addition, sequence traces were evaluated manually and edited for corrections if appropriate. These procedures provide the sequence reported below, which is designated MOL3b, or alternatively Accession Number CG53027-02. This is a spliced variant ofthe previously identified sequence (Accession Number SC85516573_EXT) at amino acids 293-329.

A protein ofthe invention, referred to herein as MOL3b, is a human Semaphorin B-like protein. The novel nucleic acid of 2281 nucleotides (CG53027-02, SEQ ID NO:9) encoding a Semaphorin B-like protein is shown in Table 3D. An open reading frame (ORF) was identified beginning with a non-initiating codon for the mature protein at nucleotides 2-4 and ending with non-stop codon at nucleotides 2264-2266. The open reading frame may be extendable in both the 5' and 3' directions because ofthe lack of traditional start and stop codons. The nucleotide sequence is presented in Table 3D with the start and stop codons in bold letters and the 5' and 3' untranslated regions underlined.

Table 3D. MOL3b Nucleotide Sequence (SEQ ID NO:9)


The disclosed MOL3b polypeptide (SEQ ID NO: 10) encoded by SEQ ID NO:9 has

754 amino acid residues, and is presented using the one-letter code in Table 3E. The MOL3b protein was analyzed for signal peptide prediction and cellular localization. SignalP results predict that MOL3b is cleaved between position 24 and 25 (TTA-GG) of SEQ ID NO: 10. Psort and Hydropathy profiles also predict that MOL3b is likely to be localized at the plasma membrane (certainty of 0.7300).

Table 3E. Encoded MOL3b protein sequence (SEQ TD NO:10).


The MOL3b nucleic acid sequence has 1910 of 2279 bases (83%>) identical to a gb:GENBANK-ID:MMRNASEMB|acc:X85991.1 mRNA from Mus musculus (M.muscuhis mRNA for semaphorin B).

The full amino acid sequence ofthe protein ofthe invention was found to have 722 of 755 amino acid residues (95%) identical to, and 723 of 755 amino acid residues (95%) similar to, the 762 amino acid residue ptnr:TREMBLNEW-ACC:BAB20087 protein from Homo sapiens (Human) (SEMB).

The presence of identifiable domains in the protein disclosed herein was determined by searches versus domain databases such as Pfam, PROSITE, ProDom, Blocks or Prints and then identified by the Interpro domain accession number. Significant domains are summarized in Table 3F.

Table 3F Domain search for MOL3b

HM ER is freely distributed under the GNU General Public License (GPL) .

HMM file: pfamHMMs

Sequence file :

/data4/genetools/ spytek35060Cg53027_01ProteinFasta.txt

Query: CG53027_01

Scores for sequence family classi ication (score includes all domains) : Model Description Score E-value N

Sema Sema domain 618.4 4.2e-182 1

Plexin_repeat Plexin repeat 22.0 0.013 1 integrin_B Integrins, beta chain 6.5 0.063 1

Parsed for domains :

Model Domain seq-f seq-t hmm-f hmm-t score E-value Sema 1/1 57 471 1 490 [] 618 . 4 4 . 2e- 182 integrin_B 1/1 495 509 1 14 [ . 6 . 5 0 . 063

Plexin_repeat 1/1 489 555 1 67 [] 22 . 0 0 . 013

Tissue Localization

MOL3b is expressed in at least the following tissues: thalamus and Pituitary Gland. Expression information was derived from the tissue sources ofthe sequences that were included in the derivation ofthe sequence of MOL3b. Chromosomal Localization OL3b maps to chromosome 1. This assignment was made using mapping information associated with genomic clones, public genes and ESTs sharing sequence identity with the disclosed sequence and CuraGen Corporation's Electronic Northern bioinformatic tool.

The disclosed MOL3a protein (SEQ ID NO:8) also has good identity with a number of other proteins, as shown in Table 3G.

Figure imgf000050_0001
This information is presented graphically in the multiple sequence alignment given in Table 3H (with MOL3a being shown on line 1 and MOL3b on line 2) as a ClustalW analysis comparing MOL3 with related protein sequences.

Table 3H. Information for the ClustalW proteins:

1) MOL3a (SEQ ID NO : 8 )

2) MOL3b (SEQ ID NO: 10)

3) gi| 12248382 |dbj |BAB20087.l| (AB029394) SEMB [Homo sapiens] (SEQ ID NO : 35 )

4) gi| 7305469|ref |NP_038686. l| sema domain, immunoglobulin domain (Ig) , transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A [Mus musculus] (SEQ ID NO : 36 )

5) gi| 1164129l|ref |NP_071762.l] hypothetical protein FLJ12287 similar to semaphorins [Homo sapiens] (SEQ ID NO: 37)

6) gi] 12698035|dbj ]BAB21836.l| (AB051532) KIAA1745 protein [Homo sapiens] (SEQ ID NO: 38)

7) gi|8134698|sp|Q62179|SM4B_MOUSE SEMAPHORIN 4B (SEMAPHORIN C) (SEMA C) (SEQ ID NO:39)

Figure imgf000051_0001
Figure imgf000052_0001

gi|l2698035| ^^^HRg gEG^SSvSTMKg Q^SsgL^3' ® ^QQ giJ8134698| S^^HR§ §EG^IgV§TMN§VQK gD ^^V§ ^QQ

450 460 470 480

■ - ■ ■ I - -

Figure imgf000053_0001

M0L3b Si røi lii^HWitipl^M^®!

Figure imgf000053_0002

610 620 630



Figure imgf000054_0001

Table 31 lists the domain description from DOMAIN analysis results against MOL3. The region from amino acid residue 64 through 478 (SEQ ID NO:8) most probably (E = le"121) contains a PSI, domain found in Plexins, Semaphorins and Integrins, aligned here in Table 31. Semaphorins are involved in growth cone guidance as well as other developmental processes. Plexins and integrins are involved in developmental processes. The MOLl sequence likely has properties similar to those of other proteins known to contain this domain

Table 31. Domain Analysis of MOL3 gnl | Smart ] smart00423 , PSI , domain found in Plexins , Semaphorins and Integrins

CD-Length = 431 residues , 100 .0% aligned

Score = 430 bits (1106) , Expect = le-121

10 20 30 50


Smart | smart00423 g-mCSSQGRgTSG-

60 70


Smart| smart00423 ERCDI Slfe ssS GBP (SEQ IDNO:90)

The protein similarity information, expression pattern, cellular localization, and map location for the protein and nucleic acid for MOL3 suggest that this Semaphorin B- like protein may have important structural and/or physiological functions characteristic of the Semaphorin B family. This family is involved in developmental processes including growth cone guidance. MOL3 likely plays a similar role in those developmental processes. Therefore, the MOL3 nucleic acids and proteins are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount ofthe nucleic acid or the protein are to be assessed. These also include potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), (v) an agent promoting tissue regeneration in vitro and in vivo, and (vi) a biological defense weapon.

The MOL3 nucleic acids and proteins have applications in the diagnosis and/or treatment of various diseases and disorders. For example, the compositions ofthe present invention will have efficacy for the treatment of patients suffering from: neuronal developmental, organizational, mediated and interactive disorders and disease; endocrine dysfunctions, diabetes, obesity, growth and reproductive disorders, injury repair as well as other diseases, disorders and conditions. These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel MOL3 substances for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-MOLX Antibodies" section below. The disclosed MOL3 protein has multiple hydrophilic regions, each of which can be used as an immunogen. In one embodiment, a contemplated MOL3 epitope is from about amino acids 30 to 100. In another embodiment, a MOL3 epitope is from about amino acids 1 10 to 150. In additional embodiments, MOL3 epitopes are from about amino acids 160 to 200, 210 to 230, 250 to 300, 350 to 400, 450 to 475, 500 to 575, 620 to 630, and from about amino acids 700 to 750. These novel proteins can also be used to develop assay systems for functional analysis.


MOL4a The disclosed novel semaphorin-like protein, MOL4a (also referred to herein as SC_111750277_A), is encoded by a nucleic acid, 6408 nucleotides long (SEQ ID NO:l 1). An open reading frame was identified beginning with an ATG initiation codon at nucleotides 1400-1402 and ending with a TGA codon at nucleotides 5456-5458. Putative untranslated regions upstream from the initiation codon and downstream from the termination codon are underlined in Table 4A, and the start and stop codons are in bold letters.

Table 4A. MOL4a Nucleotide Sequence (SEQ ID NO:11).


Table 4B. MOL4a protein sequence (SEQ ID NO:12)


The disclosed nucleic acid MOL4a sequence has 3226 of 3664 bases (88%) identical to a musculus semaphorin mRNA (GENBANK-ID: ACC: X97818).

The full amino acid sequence ofthe disclosed MOL4a polypeptide has 1021 of 1093 amino acid residues (93%) identical to, and 1053 of 1093 residues (96%) positive with, the 1093 amino acid residue semaphorin 5B precursor protein from Mus musculus (ptnr:SPTREMBL-ACC:O60519), and 971 of 973 amino acid residues (99%) identical to, and 972 of 973 residues (99%) positive with patp:AAY94990 Human secreted protein vb21_l, having 999 aa. The C-terminal 1202 amino acid residues of MOL4a are 100% identical to human IAA 1445 PROTEIN (TREMBLNEW-ACC:BAA95969).

MOL4a expression in different tissues was examined through TaqMan as described below in Example 1.

A SNP for MOL4a and the corresponding amino acid change it would cause is shown in Table 4C. The SNP was identified using the techniques disclosed in Example 3.

Table 4C: SNP for MOL4a

Consensus Base AA Residue Position Change Change Change Position

Figure imgf000059_0001

In a search of CuraGen's proprietary human expressed sequence assembly database, assemblies 11 1750277 (589 nucleotides) and 87739769 (896 nucleotides) were identified as having >95% homology to this predicted semaphorin sequence (Fig 3A2). This database is composed ofthe expressed sequences (as derived from isolated mRNA) from more than 96 different tissues. The mRNA is converted to cDNA and then sequenced. These expressed DNA sequences are then pooled in a database and those exhibiting a defined level of homology are combined into a single assembly with a common consensus sequence. The consensus sequence is representative of all member components. Since the nucleic acid ofthe described invention has >95% sequence identity with the CuraGen assembly, the nucleic acid ofthe invention likely represents an expressed semaphorin sequence.

The DNA assembly 111750277 has 3 components and was found by CuraGen to be expressed in the following tissues: Lymph node and Lung. The DNA assembly 87739769 has 7 components and was found by CuraGen to be expressed in the following tissues: Brain, Uterus, and Lung.


The disclosed novel semaphorin-like protein, MOL4b (also referred to herein as CG106951-02), is encoded by a nucleic acid, 4233 nucleotides long (SEQ ID NO:105). An open reading frame was identified beginning with an ATG initiation codon at nucleotides 2-4and ending with a TGA codon at nucleotides 3281-3283. Putative untranslated regions upstream from the initiation codon and downstream from the termination codon are underlined in Table 4D, and the start and stop codons are in bold letters.

Table 4D. MOL4b Nucleotide Sequence (SEQ ID NO:106).




The 1093 amino acid MOL4b polypeptide (SEQ ID NO: 106) encoded by SEQ ID NO: 105 is presented using the one-letter amino acid code in Table 4E. The Psort profile for MOL4b predicts that this sequence has no signal peptide and is likely to be a Type II (Ncyt Cexo) membrane protein with a certainty of0.7900.

Table 4E. MOL4b protein sequence (SEQ ID NO.106)


The disclosed nucleic acid MOL4b sequence has 3864 of 3873 (99%) identical to an alpha gene treating neurodegenerative disorders, autoimmune diseases and cancer (WO200011015-Al). The disclosed MOOL4b nucleic acid is also 100% identical to Kiaa 1445.

The full amino acid sequence ofthe disclosed MOL4b polypeptide has 972 of 973 amino acid residues (99%) identical to the alpha gene treating neurodegenerative disorders, autoimmune diseases and cancer (WO20001 1015-Al). The disclosed MOL4b polypeptide is also 100% identical to Kiaa 1445. The disclosed MOL4b polypeptide is also 93% identical to mouse semaphorin.

Analysis ofthe MOL4b sequence against the Pfam database showed that the sequence contains a Sema domain, a Thrombospondin type 1 domain, and a Plexin repeat


The disclosed novel semaphorin-like protein, MOL4c (also referred to herein as CG106951-04), is encoded by a nucleic acid, 3631 nucleotides long (SEQ ID NO:107). An open reading frame was identified beginning with an ATG initiation codon at nucleotides 154-156 and ending with a TGA codon at nucleotides 3544-3546. Putative untranslated regions upstream from the initiation codon and downstream from the termination codon are underlined in Table 4F, and the start and stop codons are in bold letters.

Table 4F. MOL4c Nucleotide Sequence (SEQ ED NO: 107).


The nucleic acid MOL4c ofthe invention , localized to human chromosome 3, was found, using a BLASTN search to have 31 17 of 3221 (99%) nucleotides identical to the 4559 nucleotide mRNA for KIAA 1445 protein from Homo sapiens (GENBANK- ID:AB040878|acc:AB040878) (E = 0.0). It also has 678 of 678 (100%) nucleotides identical to the 819 nucleotide sequence for NT2RM2 Homo sapiens cDNA clone NT2RM2001930 5', mRNA sequence (GENBANK-ID:AU 124266|acc:AU 124266.1 AU124266) (E = 5.2e"147).

The 1 130 amino acid MOL4c polypeptide (SEQ ID NO: 108) encoded by SEQ ID NO: 107 is presented using the one-letter amino acid code in Table 4G. The Psort profile for MOL4c predicts that this sequence has a signal peptide between amino acids 42 and 43 (VRG-LL). It is also likely to be localized to the plasma membrane with a certainty of 0.7900. In other embodiments, MOL4c could also be localized to the microbody (peroxisome) with a certainty of 0.3000, to the Golgi body with a certainty of 0.3000,or to the endoplasmic reticulum (membrane) with a certainty of 0.2000. Table 4G. MOL4c protein sequence (SEQ ID NO:108)


The disclosed amino acid MOL4c sequence has 964 of 1010 amino acids (95%) identical to and 971 of 1010 amino acids (96%) positive with the 1202 namino acid sequence for KIAA1445 Protein from Homo sapiens (Human) (SPTREMBL- ACC:Q9P283) (E = 0.0).

MOL4c is expressed in at least NT2 teratocarcinoma cell line. Expression information was derived from the tissue sources ofthe sequences that were included in the derivation ofthe sequence of MOL4c.

The presence of identifiable domains in the protein disclosed herein was determined by searches versus domain databases such as Pfam, PROSITE, ProDom,

Blocks or Prints and then identified by the Interpro domain accession number. Significant domains are summarized in Table 4H.

Table 4H Domain Searh for MOL4c

Scores for sequence family classification (score includes all domains) : Model Description Score E- value N

Sema (InterPro) Sema domain 682.4 2.3e- 201 1 tsp 1 (InterPro) Thrombospondin type 1 domain 119.4 6.5e-

32 6

Plexin repeat (InterPro) Plexin repeat 61.0 2.5e-

14 1

Note: Please compare the score with TC (trusted cutoff) and NC (noise cutoff) scores in each model to evaluate its significance. More on Pfam Scores

Parsed for domains :

Model Domain seq-f seq-t hmm- -f hmm-t score E- -value

Sema 1/1 126 537 . 1 490 [] 682.4 2.; 3e-201

Plexin repeat 1/1 555 602 . 1 67 [] 61 .0 2 .5e-14 tsp 1 1/6 613 661 . 1 54 π -3 .9 1.9 tsp_l 2/6 668 719 . 1 54 [] 55. .3 1 .4e-12 tsp_l 3 / 6 726 770 . . 1 54 [ ] 33 . 4 5 . 1e- 06 tsp_l 4 / 6 857 907 . . 1 54 [] 48 . 7 1 . 3e- 10 tsp_l 5 / 6 914 946 . . 1 54 [ ] 2 . 6 0 . 35 tsp_l 6/ 6 948 988 . . 1 54 [ ] 20 . 9 0 . 0027

The Sema domain occurs in semaphorins, which are a large family of secreted and transmembrane proteins, some of which function as repellent signals during axon guidance. Sema domains also occur in a hepatocyte growth factor receptor, in SEX protein and in viral proteins. Plexin repeats have been found in plexins, semaphorins and integrins. Plexin is involved in the development of neural and epithelial tissues; semaphorins induce the collapse and paralysis of neuronal growth cones; and integrins may mediate adhesive or migratory functions of epithelial cells.

Thrombospondin type 1 domain repeat was first found in the thrombospondin protein where it is repeated 3 times. Now a number of proteins involved in the complement pathway (properdin, C6, C7, C8A, C8B, C9) as well as extracellular matrix protein like mindin, F-spondin, SCO-spondin and even the circumsporozoite surface protein 2 and TRAP proteins of Plasmodium contain one or more instance of this repeat. It has been involved in cell-cell interraction, inhibition of angiogenesis, apoptosis. MOL4d

The disclosed novel semaphorin-like protein, MOL4d (also referred to herein as 209829549), is encoded by a nucleic acid, 1203 nucleotides long (SEQ ID NO: 109). An open reading frame was identified beginning with an GGA initiation codon at nucleotides 1-3 and ending after a GAC codon at nucleotides 1201-1203. In Table 41, the start codon is in bold letters. Because the start and stop codons are not traditional initiation and termination codons, MOL4d could be a partial reading frame that extends further in the 5' and/or 3' directions.

Table 41. MOL4d Nucleotide Sequence (SEQ ID NO: 109).


The reverse complement for MOL4d is shown in Table 4J.

Table 4J. MOL4d Nucleotide Sequence reverse complement (SEQ ID NO:110).


The 401 amino acid MOL4d polypeptide (SEQ ID NO:l l 1) encoded by SEQ ID NO: 109 is presented using the one-letter amino acid code in Table 4K.

Table 4K. MOL4d protein sequence (SEQ ID NO:lll)



The disclosed novel semaphorin-like protein, MOL4e (also referred to herein as 209829553), is encoded by a nucleic acid, 1203 nucleotides long (SEQ ID NO:l 12). An open reading frame was identified beginning with an GGA initiation codon at nucleotides 1-3 and ending after a GAC codon at nucleotides 1201-1203. In Table 4L, the start codon is in bold letters. Because the start and stop codons are not traditional initiation and termination codons, MOL4e could be a partial reading frame that extends further in the 5' and/or 3' directions. Table 4L. MOL4e Nucleotide Sequence (SEQ ID NO: 112).


The reverse complement for MOL4e is shown in Table 4M.

Table 4M. MOL4e Nucleotide Sequence reverse complement (SEQ ID



The 401 amino acid MOL4e polypeptide (SEQ ID NO: 114) encoded by SEQ ID 12 is presented using the one-letter amino acid code in Table 4N.

Table 4N. MOL4e protein sequence (SEQ ID NO: 114)



The disclosed novel semaphorin-like protein, MOL4f (also referred to herein as 9642), is encoded by a nucleic acid, 1203 nucleotides long (SEQ ID NO:l 15). An open reading frame was identified beginning with an GGA initiation codon at nucleotides 1-3 and ending after a GAC codon at nucleotides 1201-1203. In Table 4O, the start codon is in bold letters. Because the start and stop codons are not traditional initiation and termination codons, MOL4f could be a partial reading frame that extends further in the 5' and/or 3' directions.

Table 4O. MOL4f Nucleotide Sequence (SEQ ID NO:115).


The 401 amino acid MOL4f polypeptide (SEQ ID NO: l 16) encoded by SEQ ID NO: 1 15 is presented using the one-letter amino acid code in Table 4P.

Table 4P. MOL4f protein sequence (SEQ ID NO:116)



The disclosed novel semaphorin-like protein, MOL4g (also referred to herein as 209829670), is encoded by a nucleic acid, 1203 nucleotides long (SEQ ID NOT 17). An open reading frame was identified beginning with an GGA initiation codon at nucleotides 1-3 and ending after a GAC codon at nucleotides 1201-1203. In Table 4Q, the start codon is in bold letters. Because the start and stop codons are not traditional initiation and termination codons, MOL4g could be a partial reading frame that extends further in the 5' and/or 3' directions. Table 4Q. MOL4g Nucleotide Sequence (SEQ ID NO:117).


The 401 amino acid MOL4g polypeptide (SEQ ID NO: 118) encoded by SEQ ID NO:l 17 is presented using the one-letter amino acid code in Table 4R.

Table 4 . MOL4g protein sequence (SEQ ID NO: 118)


Table 4S shows a ClustalW alignment ofthe MOL4 variants.

Table 4S. Clustal W for MOL4 variants


MOL4d 1

MOL4e 1

MOL4f 1 MOL4g ■ 1

70 80 90 100 110 120



MOL4d 1

MOL4e 1 OL4f 1 MOL4g 1

130 140 150 160 170 180


MOL4c ■ ■ • 1

MOL4d 1

MOL4e 1 MOL4f 1

MOL4g 1

190 200 210 220 230 240


MOL4b- --■ 1


MOL4d 1 MOL4e 1 OL4f 1

MOL4g 1



MOL4d 1 OL4e 1 OL4f 1

MOL4g ■ 1

310 320 330 340 350 360




MOL4d 1 MOL4e 1

MOL4f 1

MOL4g > 1

370 380 390 400 410 420




MOL4d 1 MOL4e 1

MOL4f ■ 1

MOL4g 1

130 440 450 460 470 480



MOL4f 1

MOL4g 1

490 500 510 520 530 540




MOL4d 1 MOL4e 1 OL4f 1 OL4g ■ 1

550 560 570 580 590 600


610 620 630 640 650 660










910 920 930 940 950 960


970 980 990 1000 1010 1020



1030 1040 1050 1060 1070 1080




1090 1100 1110 1120 1130 1140





1150 1160 1170 1180 1190 1200

Figure imgf000071_0001

1210 1220 1230 1240 1250 1260

Figure imgf000071_0002



MOL4f • 401

MOL4g 401




MOL4f 401

MOL4g 401 MOL4a has homology to the proteins decribed in Table 4T.

Figure imgf000072_0001

This information is presented graphically in the multiple sequence alignment given in Table 4U (with MOL4 being shown on line 1) as a ClustalW analysis comparing MOL4 with related sequences. Table 4U Information for the ClustalW proteins:

1) MOL4 (SEQ ID NO: 12)

2) gi I 12731706 I ref |XP_004042.2 I sema domain, seven thrombospondin repeats (type 1 and type 1-like) , transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Homo sapiens] (SEQ ID NO: 41)

3) gi ] 7305473 I ref |NP_038689.11 sema domain, seven thrombospondin repeats (type 1 and type 1-like) , transmembrane domain (TM) and short cytoplasmic domain, (sem [Mus musculus] (SEQ ID NO:42)

4) gi I 6677915 |ref |NP_033180.11 sema domain, seven thrombospondin repeats (type 1 and type 1-like) , transmembrane domain (TM) and short cytoplasmic domain, (sem,- M-Sema D [Mus musculus] (SEQ ID NO: 43)

5) gi I 45068811 ref |NP_003957.1 ] sema domain, seven thrombospondin repeats (type 1 and type 1-like) , transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A,- semaphorin F; sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) (SEQ ID NO:44)

6) gi I 7959149 |dbj |BAA95969.l| (AB040878) KIAA1445 protein [Homo sapiens] (SEQ ID NO: 45)

10 20 30 50

MOL4 MPAGEGASAHRAGHHTRQARGGSRPSSRGMQGAPS SSARLEAGGCSARR gi|l2731706| gi|7305473] gi|6677915| gi|4S0688l| gi]7959149|


Figure imgf000073_0001

110 120 130 140 150


Figure imgf000073_0002

160 170 180 190 200 ..|..


Figure imgf000073_0003



Figure imgf000073_0004

Figure imgf000074_0001

710 720 730 750

I----I I----I

Figure imgf000075_0001
Figure imgf000076_0001




Figure imgf000076_0002

Tables 4V-4AA list the domain descriptions from DOMAIN analysis results against MOL4a. The region from amino acid residue 327 through 725 (SEQ ID NO: 12) most probably (E = 2e"1 18) contains a Sema domain found in Semaphorins, aligned here in Table 4V. Semaphorins are involved in growth cone guidance, axonal pathfmding, and other developmental processes. The region from amino acid residue 1057 through 1109 (SEQ ID NO: 12) most probably (E = 3e"9) contains a Thrombospondin type-1 repeat found in thrombospondin- 1 that binds to and activates TGF-beta, aligned here in Table 4W. TGF-beta is involved in the modulation of proliferation in many cell types. The region from amino acid residue 868 through 921 (SEQ ID NO:12) most probably (E = 4e~8) also contains a Thrombospondin type-1 repeat found in thrombospondin- 1 that binds to and activates TGF-beta, aligned here in Table AX. The region from amino acid residue 926 through 972 (SEQ ID NO: 12) most probably (E = 6e"7) also contains a Thrombospondin type-1 repeat found in thrombospondin- 1 that binds to and activates TGF-beta, aligned here in Table 4Y. The region from amino acid residue 1 169 through 1210 (SEQ ID NO: 12) most probably (E = 0.001) also contains a Thrombospondin type-1 repeat found in thrombospondin- 1 that binds to and activates TGF-beta, aligned here in Table AZ. The region from amino acid residue 756 through 803 (SEQ ID NO:12) most probably (E = le" 5) also contains a Thrombospondin type-1 repeat found in thrombospondin-1 that binds to and activates TGF-beta, aligned here in Table 4AA. The presence of these domains indicates that the MOL4a sequence has properties similar to those of other proteins known to contain these domains.

Figure imgf000077_0001

70 80 90 0L4a_l II -VAG-RKVFMB |SgMWTSRQV

Smart I smart00630 jJLHLDYNA-DRLLvB aQHVlRLINL

Figure imgf000077_0002

Figure imgf000077_0003
- SϋfflvLB

Figure imgf000077_0004

410 420 430 440 450


Smart | smart00630 LTSI. ER-BR- -TDGGNHTHJF: ^SD| LSEBSHSS E

460 470

Figure imgf000078_0001
(SEQ ID NO : 91)

Table 4W. Domain Analysis of MOL4a gnl 1 Smart | smart00209 , TSPl, Thrombospondin type 1 repeats,- Type 1 repeats in thrombospondin- 1 bind and activate TGF-beta. CD-Length = 51 residues, 100.0% aligned Score = 58.2 bits (139), Expect = 3e-09

MOL4a_3 Smar | smart

Figure imgf000078_0002

Figure imgf000078_0003
(SEQ ID NO : 92 )

Table 4X. Domain Analysis of MOL4a gnl j Smart | smart00209, TSPl, Thrombospondin type 1 repeats,- Type 1 repeats in thrombospondin- 1 bind and activate TGF-beta. CD-Length = 51 residues, 100.0% aligned Score = 54.3 bits (129), Expect = 4e-08

30 40 50

M0L4a 4

Smart smart00209


Smart I smart00209 (SEQ ID NO : 93 )

Figure imgf000078_0004


M0L4a_5 aEALB

Smart I smart 00209 STRAB (SEQ ID NO : 94 )

Table 4Z. Domain Analysis of MOL4a gnl 1 Smart ] smart00209, TSPl, Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin- 1 bind and activate TGF-beta. CD-Length = 51 residues, 88.2% aligned Score = 39.7 bits (91), Expect = 0.001

10 20 30 40 50

MOL4a 6 |2J SiJiGsE_ijκ|3i]SN| @SSR1- g E- -N@NS@ScG |gFK;τg Smart | smart00209 EGEEsE|ϊSPEEaE-S-vSτiϊlτiϊl-C_SNPPPN- -G@GPS SPDτ τRASS]

Figure imgf000079_0001
(SEQ ID NO: 95)

Table 4AA. Domain Analysis of MOL4a gnl ] Pfam]pfam01437, Plexin_repeat, Plexin repeat

CD-Length = 48 residues, 100.0% aligned

Score = 46.2 bits (108), Expect = le-05

10 20 30 40 50



MOL4a_8 NITAS Pfam | pfam01437 SSETB (SEQ ID NO : 96 )

The above defined information for MOL4 suggests that this semaphorin-like protein may function as a member of a "Semaphorin family". Therefore, the novel nucleic acids and proteins identified here may be useful in potential therapeutic applications implicated in (but not limited to) various pathologies and disorders as indicated below. The potential therapeutic applications for MOL4 include, but are not limited to: protein therapeutic, small molecule drug target, antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), diagnostic and/or prognostic marker, gene therapy (gene delivery/gene ablation), research tools, tissue regeneration in vivo and in vitro of all tissues and cell types composing (but not limited to) those defined here.

The thrombospondin type 1 repeat (TSR) superfamily: diverse proteins with related roles in neuronal development.

Adams JC, Tucker RP. Dev Dyn 2000 Jun;218(2):280-99 The semaphorins are a gene family characterized by the presence of a phylogenetically conserved 500-amino acid domain (Kolodkin et al., [1993]). Some are secreted, some are associated with the cell surface via a GPI linkage, and others are transmembrane proteins. Many are expressed in the developing nervous system, and at least some of these have repulsive properties (e.g., Raper and Kapfliammer, [1990]; Luo et al, [1993]; Pueschel et al., [1995]). Adams et al. ([1996]) cloned two novel semaphorins from murine cDNA libraries that they designated SemF and SemG. SemF and SemG are 72% similar to each other and share a common domain organization: a relatively short cytoplasmic tail with proline-rich SH3 domains (analyzed further by Wang et al., [1999]), a single hydrophobic transmembrane domain, seven TSRs that contain WSXW motifs but lack the CSVTCG motif, and finally the large semaphorin domain. Northern blotting revealed semG expression in the early (El l) mouse embryo, when in situ hybridization showed semG expression in the neuroepithelium (Adams et al., [1996]; Skaliora et al., [1998]). Thus, SemG could play a role in neuroblast proliferation. In the adult, SemG mRNA was detected in brain but not in any other tissue examined (Adams et al., [1996]). Adams RH, Betz H, Puschel AW. 1996. A novel class of murine semaphorins with homology to thrombospondin is differentially expressed during early embryogenesis. Mech Dev 57: 33-45.

Skaliora I, Singer W, Betz H, Puschel AW. 1998. Differential patterns of semaphorin expression in the developing rat brain. Eur Neurosci 10: 1215-1229. The MOL4 nucleic acids and proteins are useful in potential therapeutic applications implicated in Parkinson's disease, psychotic and neurological disorders, Alzheimers disease, cancer including but not limited to lung or breast cancer, endocrine disorders, inflammatory disorders, gastro-intestinal disorders and disorders ofthe respiratory system, and/or other pathologies and disorders. For example, a cDNA encoding the semaphorin-like protein may be useful in gene therapy, and the semaphorin-like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions ofthe present invention will have efficacy for treatment of patients suffering from Parkinson's disease, psychotic and neurological disorders, Alzheimers disease, cancer including but not limited to lung or breast cancer, endocrine disorders, inflammatory disorders, gastro-intestinal disorders and disorders of he respiratory system. MOL4, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount ofthe nucleic acid or the protein are to be assessed.

These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel MOL4 substances for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-MOLX Antibodies" section below. The disclosed MOL4 protein has multiple hydrophilic regions, each of which can be used as an immunogen. In one embodiment, a contemplated MOL4 epitope is from about amino acids 5 to 75. In another embodiment, a MOL4 epitope is from about amino acids 100 to 200. n additional embodiments, MOL4 epitopes are from about amino acids 300 to 375, 420 to 600, 600 to 675, 775 to 850, 900 to 1 150, , and from about amino acids 1250 to 1350. These novel proteins can also be used to develop assay systems for functional analysis. MOL5


The disclosed novel semaphorin 4C -like nucleic acid of 3868 nucleotides, MOL5a, (also referred to as SC20422974-A) is shown in Table 5A. An ORF begins with an ATG initiation codon at nucleotides 453-455 and ends with a TGA codon at nucleotides 2952-2954. A putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 5A, and the start and stop codons are in bold letters.

Table 5A. MOL5a Nucleotide Sequence (SEQ ID NO:13)


The MOL5a protein encoded by SEQ ID NO: 13 has 833 amino acid residues and is presented using the one-letter code in Table 5B. The Psort profile for MOL5a predicts that this sequence is likely to be localized at the mitochondrial inner membrane with a certainty of 0.8000 or plasma membrane with a certainty of 0.7000. MOL5a has a cleavage site between amino acods 20 and 21 (GIG-AE), and a molecular weight of 92617.0 Daltons.

Table 5B. Encoded MOL5a protein sequence (SEQ ID NO:14)


The disclosed nucleic acid sequence for MOL5a has 2917 of 3443 bases ( 84%) identical to a semaphorin 4C mRNA (GENBANK-ID: S79463|acc:S79463 ) (E= 0.0).

The full MOL5a amino acid sequence has 729 of 834 amino acid residues (87%) identical to, and 772 of 834 residues (92%) positives with, the 834 amino acid semaphorin 4C Precursor protein from Mus musculus (Mouse) (ptnr:SPTREMBL-ACC: Q64151) (E= 0.0). In addition, this protein contains the following protein domains (as defined by

Interpro) at the indicated nucleotide positions: Sema domain (a.a. 53-481; IPR001627), integrinJB (a.a. 505-519; IPR000413 ), Plexinjrepeat (a.a. 499-551; IPR002165), ig (a.a. 570-629; IPR000353)

MOL5a expression in different tissues was examined through TaqMan as described below in Example 1.

Chromosomal Localization MOL5a has been localized to human chromosome 2. MOL5b

Another disclosed novel semaphorin 4C -like nucleic acid of 2558 nucleotides, MOL5b, (also referred to as SC14998905_EXT) is shown in Table 5C. An ORF begins with an ATG initiation codon at nucleotides 21 - 23 and ends with a TGA codon at nucleotides 2520-2522. A putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 5C, and the start and stop codons are in bold letters.

Table 5C. MOL5b Nucleotide Sequence (SEQ ID NO: 15)


The MOL5b protein encoded by SEQ ID NO: 16 has 833 amino acid residues and is presented using the one-letter code in Table 5D. The Psort profile for MOL5b predicts that this sequence is likely to be localized at the plasma membrane with a certainty of 0.7000. Table 5D. Encoded MOL5b protein sequence (SEQ ID NO:16)


The disclosed nucleic acid sequence for MOL5b has 1695 of 2019 bases (83%) identical to a mouse Semaphorin4C mRNA (GENBANK-ID: S79463) (E= 0.0).

The full MOL5b amino acid sequence has 722 of 834 amino acid residues ( 86%) identical to, and 765 of 834 residues (91%) positive with the amino acid Semaphorin4C HOMOLOG protein from Mouse (S79463_ SEMA_4C_MOUSE) (E= 0.0). The global sequence homology (as defined by FASTA alignment with the full length sequence of this protein) is 91 % amino acid homology and 86 % amino acid identity. Chromosomal Localization MOL5b has been localized to human chromosome 2.


In the present invention, the target sequence identified previously, MOL5b, was subjected to the exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case ofthe reverse primer, until the stop codon was reached. Such primers were designed based on in silico predictions for the full length cDNA, part (one or more exons) of the DNA or protein sequence ofthe target sequence, or by translated homology ofthe predicted exons to closely related human sequences sequences from other species. These primers were then employed in PCR amplification based on the following pool of human cDNAs: adrenal gland, bone marrow, brain - amygdala, brain - cerebellum, brain - hippocampus, brain - substantia nigra, brain - thalamus, brain -whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. Usually the resulting amplicons were gel purified, cloned and sequenced to high redundancy. The resulting sequences from all clones were assembled with themselves, with other fragments in CuraGen Corporation's database and with public ESTs. Fragments and ESTs were included as components for an assembly when the extent of their identity with another component ofthe assembly was at least 95% over 50 bp. In addition, sequence traces were evaluated manually and edited for corrections if appropriate. These procedures provide the sequence reported below, which is designated MOL5c (Accession Number CG50907-02). This differs from the previously identified sequence, MOL5b, in having 17 different amino acids.

The disclosed novel semaphorin 4C -like nucleic acid of 3112 nucleotides, MOL5c, (also referred to as CG50907-02) is shown in Table 5E. An ORF begins with an ATG initiation codon at nucleotides 104 - 106 and ends with a TGA codon at nucleotides 2603-2605. A putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 5E, and the start and stop codons are in bold letters.

Table 5E. MOL5c Nucleotide Sequence (SEQ ID NO:17)


The MOL5c protein encoded by SEQ ID NO: 17 has 833 amino acid residues and is presented using the one-letter code in Table 5F. The Psort profile for MOL5c predicts that this sequence has a signal peptide and the signal peptide is predicted by SignalP to be cleaved between amino acid 20 and 21 : GIG-AE. This sequence is likely to be localized at the mitochondrial inner membrane with a certainty of 0.8000 and the plasma membrane with a certainty of 0.7000.

Table 5F. Encoded MOL5c protein sequence (SEQ ID NO: 18)


The disclosed nucleic acid sequence for MOL5c has 2879 of 2906 bases (99%) identical to a gb:GENBANK-ID:AB051526|acc:AB051526.1 mRNA from Homo sapiens (Homo sapiens mRNA for KIAA1739 protein, partial eds) (E= 0.0).

The full MOL5 amino acid sequence has 722 of 834 amino acid residues (86%) identical to, and 765 of 834 amino acid residues (91%) similar to, the 834 amino acid residue ptnr:SWISSPROT-ACC:Q64151 protein from Mus musculus (Mouse)

(SEMAPHORIN 4C PRECURSOR (SEMAPHORIN I) (SEMA I) (SEMAPHORIN C- LIKE 1 ) (M-SEMA F)) (E= 0.0). The global sequence homology (as defined by FASTA alignment with the full length sequence of this protein) is 91%> amino acid homology and 86% amino acid identity. The presence of identifiable domains in the protein disclosed herein was determined by searches versus domain databases such as Pfam, PROSITE, ProDom, Blocks or Prints and then identified by the Interpro domain accession number. Significant domains are summarized in Table 5G.

Table 5G: Domain similarities for MOL5c

Scores for sequence family classi ication (score includes all domains) :

Model Description Score E-value N

Sema Sema domain 664.4 5.8e-196 1

Plexin_repeat Plexin repeat 25.8 0.001 1 ig Immunoglobulin domain 8.5 0.44 1 integrin_B Integrins , beta chain 7.0 0.04 1

Parsed for domains :

Model Domain seq-f seq-t hmm-f hmm-t score E -value

Sema l/l 53 481 .. 1 490 [] 664.4 5.8e-196 integrin_B 1/1 505 519 .. 1 14 [. 7.0 0.04

Plexin_repeat l/l 499 551 .. 1 67 [] 25.8 0.001 ig 1/1 570 629 .. 1 45 [] 8.5 0.44

The Sema domain occurs in semaphorins, which are a large family of secreted and transmembrane proteins, some of which function as repellent signals during axon guidance. Sema domains also occur in a hepatocyte growth factor receptor, in SEX protein (Goodman et al., 1998, Cell 95: 903-916) and in viral proteins.

The presence of these domains indicates that MOL5c likely has properties similar to those of other proteins known to contain this/these domain(s) and similar to the properties of these domains.

Chromosomal Localization

MOL5c maps to chromosome 2. This assignment was made using mapping information associated with genomic clones, public genes and ESTs sharing sequence identity with the disclosed sequence and CuraGen Corporation's Electronic Northern bioinformatic tool.

Tissue Expression

MOL5c is expressed in at least the following tissues: adrenal gland, bone marrow, brain - amygdala, brain - cerebellum, brain - hippocampus, brain - substantia nigra, brain - thalamus, brain -whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea and uterus. Expression information was derived from the tissue sources ofthe sequences that were included in the derivation ofthe sequence of MOL5c. MOL5d

The disclosed novel semaphorin 4C -like nucleic acid of 1914 nucleotides, MOL5d, (also referred to as CG50907-03) is shown in Table 5H. An ORF begins with an ATG initiation codon at nucleotides 104 - 106 and ends with a TGA codon at nucleotides 2603-2605. A putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 5H, and the start and stop codons are in bold letters.

Table 5H. MOL5d Nucleotide Sequence (SEQ ID NO: 119)


The nucleic acid sequence for MOL5d is 99% identical to the 2156 sequence disclosed in WO200078802-A2 with a priority date of June 23, 1999.

The MOL5d protein encoded by SEQ ID NO: 120 has 634 amino acid residues and is presented using the one-letter code in Table 51. The Psort profile for MOL5d predicts that this sequence has a signal peptide and the signal peptide is predicted by SignalP to be cleaved between amino acid 20 and 21 : GIG-AE. This sequence is likely to be a type 1 membrane protein (ECD proposed for immunization) localized at the mitochondrial inner membrane with a certainty of 0.8000 and the plasma membrane with a certainty of 0.7000. Table 51. Encoded MOL5d protein sequence (SEQ ID NO: 120)


The disclosed amino acid sequence for MOL5d is 99% identical to Q9C0C4, June 2001, KIAA 1739 PROTEIN - Homo sapiens (Human), 963 aa (fragment). The amino acid sequence for MOL5d is also 99% identical to the 624 aa sequence with Accession number: AAB48378 disclosed in WO200078802-A2 with a priority date of June 23, 1999. The amino acid sequence for MOL5d is also 98.9% identical to the 833aa sequence with Accession number: AAE03640 disclosed in WO200142285-A2 with a priority date of December 10, 1999.

MOL5d has been found to contain the following domains from the Pfam library: Sema domain, Plexin repeat, Immunoglobulin domain, Integrins, and beta chain domains. Potential Role(s) of MOL5d in Tumorgenesis: Semaphorin are involved in neuronal axonal migration. Recently they have been associated with migration, invasion and apoptosis of tumor cells and endothelial cells. MOL5d (Semaphorin 4C-like protein) is overexpressed in the metastatic variant SW620 compared with SW480. It is also generally more expressed in cell lines derived from metastasis like the melanomas SK-Mel5 and HS688b and the liver met of gastric NCIN87. In the panel of tumor tissues, it is strongly induced in lung tumors and show overall overexpression in all other tumors. It potential role in tumorogenesis is likely to be to stimulate migration of tumor cells and therefore increase their ability to metastatize. Impact of therapeutic targeting of MOL5d : Targeting with a human monoclonal antibody of MOL5d that results in an inhibition ofthe activity of this protein, preferably as it relates to its stimulation of migration and/or apoptotic/survival activity in tumor cells, specifically lung tumor cells, will have therapeutic effect on all solid tumor that depend on its activity, preferably on lung tumors. MOL5e

The disclosed novel semaphorin 4C -like nucleic acid of 1914 nucleotides, MOL5e, (also referred to as 170645595) is shown in Table 5J. An ORF begins with an AGA initiation codon at nucleotides 1-3 and ends with a GAG codon at nucleotides 1912- 1914. The start and stop codons are in bold letters. Because the start and stop codons are not traditional initiation or termination codons, MOL5e could be a partial reading frame extending further in the 5' and/or 3' directions.

Table 5J. MOL5e Nucleotide Sequence (SEQ ID NO:121)


The reverse complement of MOL5e is shown in Table 5K.

Table 5K. MOL5e Reverse Complement Nucleotide Sequence (SEQ ID



The MOL5e protein encoded by SEQ ID NO: 123 has 638 amino acid residues and is presented using the one-letter code in Table 5L.

Table 5L. Encoded MOL5e protein sequence (SEQ ID NO: 123)



The disclosed novel semaphorin 4C -like nucleic acid of 1914 nucleotides, MOL5f, (also referred to as 170645599) is shown in Table 5M. An ORF begins with an AGA initiation codon at nucleotides 1-3 and ends with a GAG codon at nucleotides 1912-1914. The start and stop codons are in bold letters. Because the start and stop codons are not traditional initiation or termination codons, MOL5f could be a partial reading frame extending further in the 5' and/or 3' directions.

Table 5M. MOL5f Nucleotide Sequence (SEQ ID NO:124)


The MOL5f protein encoded by SEQ ID NO: 125 has 638 amino acid residues and is presented using the one-letter code in Table 5N.

Table 5N. Encoded MOL5f protein sequence (SEQ ID NO: 125)


Table 5O shows a ClustalW alignment ofthe MOL5 variants.

Table 5O. ClustalW alignment of MOL5 variants

10 20 30 40 50 60


Figure imgf000092_0001


190 200 210 220 230 240


250 260 270 280 290 300





Figure imgf000093_0001

490 500 510 520 530 540

— I — I — . i . , . . | — I — | — i , — i — t — i — i — T i

MOL5a QJggΘ^^^^^^^^^^^^^^^^^^^^S^^^^^E^EΞffiϊΞiϊiSΞl.E.S 54° MOL5b ^^^S^^SS^β^^^^BS^^^^I^SB^^^S^^^^^^^^SBmm 540 OL5C ^ffltS^^^m^^^^^^^^^ffl^^^^^^^S^^^^^^^^ffl^rø 540 O 5 ^™SSHSκ(8ffij^^^^^^S*^^^^^^^^^^^^^^^^^^^^fflfiπffi 520

MOLΞe ^^^^^^^S^Rj^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^gffi 522

MO 5f laSmSj-fiHJISBziffiSffaBiB 522

Figure imgf000093_0002

610 620 630 640 650 660

— 1 — I — 1 — 1 — I ■ - - - 1 — ] — I — 1 — ] — j — I

MOL5a ^^^^ggrøπffl^^^g^^S^^^^^^^^^^^^^^^^^^^gAAP E 660

MOL5b ^ffl^^nffl^^^^^^^^ffl^^^^^^^^^^^H^^^^^^^gARAPLE 660

MOL5C ^ffls^^g^^^^βffla^gg^^^^^^^^^^^^^^^^^^^BfflARAPLE 660

MOL5d ^fflBrø^^^^^βfflHffiKj^^^^fflgg^^^^^^^^^^ffl-- 634

MOL5e ^^^^^^S^^^^S^^^^^^^^Hϊ^^^^^^^^^^^^^^fflE 638 OL5f fljSBiB3-lSal^BCTBfi3iS3SiBSH^ 638

670 680 690 700 710 720



MOL5d 634

MOL5e 638

MOL5f 638

730 740 750 760 770 780



MOL5e 638

MOL5f 638

790 800 810 820 830




MOL5d 634

MOL5e 638

MOL5f 638

MOL5a also has homology to other proteins as shown in BLAST alignment results in Table 5P

Figure imgf000094_0001

This information is presented graphically in the multiple sequence alignment given in Table 5Q(with MOL5a being shown on line 1, and MOL5b on line 2) as a ClustalW analysis comparing MOL5 with related protein sequences. Table 5QInformation for the ClustalW proteins:

1) MOL5a (SEQ ID N0:14)

2) M0L5b (SEQ ID NO: 16)

3) gi] 12698023 |dbj |BAB21830.l| (AB051526) KIAA1739 protein [Homo sapiens] (SEQ ID NO:46)


5) gi I 8923346 I ref |NP_060259.11 sema domain, immunoglobulin domain (Ig) , transmembrane domain TM; cytokeratin 14; adipocyte-derived leucine aminopeptidase; hypothetical protein MGC10851; hypothetical protein FLJ14662; sphingomyelin phosphodiesterase- 1, acid lysosomal; Pro-platelet ba> (SEQ ID NO:48)



Figure imgf000095_0001
Figure imgf000096_0001
Figure imgf000097_0001

Figure imgf000098_0001

MOL5b and MOL5c share close homology to each other and therefore to other proteins as is shown in the BLAST alignment in Table 5R

Table 5R BLAST alignment between MOL5b and MOL5c

10 20 30 40 50





110 120 130 140 150


160 170 180 190 200


210 220 230 240 250


260 270 280 290 300


310 320 330 340 350

..I ....I ....I....I ....I ....I ....I ....I ....I


360 370 380 390 400


410 - 420 430 440 450


460 470 480 490 500


510 520 530 540 550


560 570 580 590 600


610 620 630 640 650


Figure imgf000100_0001

710 720 730 740 750


760 770 780 790 800


810 820 830 840 850


860 870 880 890 900


910 920 930 940 950


960 970 980 990 1000


1010 1020 1030 1040 1050

I ....| .... I I I ....I


Figure imgf000100_0002

1110 1120 1130 1140 1150


1160 1170 1180 1190 1200


1210 1220 1230 1240 1250


1260 1270 1280 1290 1300




Figure imgf000101_0001

1410 1420 1430 1440 1450



Figure imgf000101_0002

1510 1520 1530 1540 1550



Figure imgf000101_0003

1610 1620 1630 1640 1650

....1....1..... I .... I .... I .... I .... I .... I .... I .... I



Figure imgf000101_0004

1710 1720 1730 1740 1750


MOL5b ^_^_l___^_^'^_ξ^-^^- l?^u^^'^lS^'^^l^ ^^ MOLΞc _ s___&__m__w mmm m m B xmmwgmswm.

1760 1770 1780 1790 1800



1810 1820 1830 1840 1850



1860 1870 1880 1890 1900



1910 1920 1930 1940 1950



Figure imgf000101_0005
Figure imgf000102_0001

2010 2020 2030 2040 2050


Figure imgf000102_0002

2110 2120 2130 2140 2150


Figure imgf000102_0003

2210 2220 2230 2240 2250


Figure imgf000102_0004

2360 2370 2380 2390 2400


2410 2420 2430 2440 2450


2460 2470 2480 2490 2500


Figure imgf000102_0005

2560 2570 2580 2590 2600



Figure imgf000102_0006

2660 2670 2680 2690 2700 MOLSb
















MOL5b -




As used herein, any reference to MOL5 encompasses MOL5a, MOL5b, and MOL5c, unless otherwise indicated.

Table 5Sand 5Tlist the domain descriptions from DOMAIN analysis results against MOL5. The region from amino acid residue 66 through 487 (SEQ ID NO: 14) most probably (E = 3e~125) contains a Sema domain found in Semaphorins, described above under MOL4, and aligned here in Table 5S The region from amino acid residue 562 through 627 (SEQ ID NO: 14) most probably (E = le"4) also contains a Sema domain found in Semaphorins, aligned here in Table 5T This indicates that the MOL5 sequence has properties similar to those of other proteins known to contain this domain.

Figure imgf000104_0001

110 120 140 150

MOL5_l - -|TΪEHGEF D|KgκB Pfam | pfam01403

Figure imgf000104_0002
310 320 330 340 350


360 380 390 400


420 430 440 450


Figure imgf000104_0003

Figure imgf000104_0004
(SEQ ID NO : 97 )

Table 5T Domain Analysis of MOL5 gnl I Smart | smart00409, IG, Immunoglobulin

CD-Length = 85 residues, only 79.1% aligned

Score = 42.0 bits (97), Expect = le-04

20 30 50 MOL5 5 gKNlEEVAgTDLvgpgHL§S--IS-L H R|TFG @ D3P[J

Smart | smart00409 §PS3 _SKE@ES !TJ3SSEA@G- --S|S|PPPPPPTTVVTIJS5YYKQ _GK_L|


Smart I smart 00409

Figure imgf000105_0001



Smart |smart00409 SSGSASS-GflTLTVL (SEQ ID NO:98)

The protein similarity information, expression pattern, cellular localization, and map location for MOL5 suggest that this Semaphorin 4C-like protein may have important structural and/or physiological functions characteristic ofthe Semaphorin family. These functions include growth cone guidance, axonal pathfindin, and embryonic development. Therefore, the MOL5 nucleic acids and proteins are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount ofthe nucleic acid or the protein are to be assessed. These also include potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), (v) an agent promoting tissue regeneration in vitro and in vivo, and (vi) a biological defense weapon.

The MOL5 nucleic acids and proteins have applications in the diagnosis and/or treatment of various diseases and disorders. For example, the compositions ofthe present invention will have efficacy for the treatment of patients suffering from: Rheumatoid arthritis (RA), CNS disorders, Alzheimer, Down syndrome, Schizophrenia, Parkinsons diseases as well as other diseases, disorders and conditions.

MOL5 is a Semaphorin 4C like protein. Semaphorin 4C (S4C, previously called M-SemaF) was recently identified as a brain rich transmembrane member of semaphorin family ofthe vertebrate. In the cytoplasmic domain of S4C there is a proline-rich region suggesting that the cytoplasmic domain may play an important role in Sema4C function. The cytoplasmic domain (cd) of M-SemaF(S4C)-associating protein has been identified with a MW of 75 kDa, named SFAP75, from mouse brain. SFAP75 turned out to be the same as the recently reported neurite-outgrowth-related protein named Norbin. Deletion mutants analyses of S4C and SFAP75 have revealed that the membrane-proximal region of S4Ccd binds to the intermediate region of SFAP75. Western blot and immunohistochemical analyses with anti-Sema4C and anti-SFAP75 antibodies indicated that S4C and SFAP75 were specially enriched in the brain with a similar distribution pattern to each other. These results suggest that S4C interacts with SFAP75 and plays a role in neural function in brain.

Semaphorins are also known to act as chemorepulsive molecules that guide axons during neural development. Sema4C, a group 4 semaphorin, is a transmembrane semaphorin of unknown function. The cytoplasmic domain of Sema4C contains a proline- rich region that may interact with some signaling proteins. It has been demonstrated that Sema4C is enriched in the adult mouse brain and associated with PSD-95 isoforms containing PDZ (PSD-95/DLG/ZO-1) domains, such as PSD-95/SAP90, PSD- 93/chapsinl 10, and SAP97/DLG-1, which are concentrated in the post-synaptic density of the brain. In the neocortex, S4C is enriched in the synaptic vesicle fraction and Triton X- 100 insoluble post-synaptic density fraction. Immunostaining for Sema4C overlaps that for PSD-95 in superficial layers I-IV ofthe neocortex. In neocortical culture, S4C is colocalized with PSD-95 in neurons, with a dot-like pattern along the neurites. Sema4C thus may function in the cortical neurons as a bi-directional transmembrane ligand through interacting with PSD-95.

These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel MOL5 substances for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-MOLX Antibodies" section below. The disclosed MOL5 protein has multiple hydrophilic regions, each of which can be used as an immunogen. In one embodiment, a contemplated MOL5 epitope is from about amino acids 30 to 70. In another embodiment, a MOL5 epitope is from about amino acids 100 to 150. In additional embodiments, MOL5 epitopes are from about amino acids 175 to 200, 220 to 450, 550 to 575, 590 to 610, and from about amino acids 675 to 850. These novel proteins can also be used to develop assay systems for functional analysis. MOL6

The disclosed novel kappa casein precursor -like MOL6 nucleic acid of 603 nucleotides (also referred to as GMAC060288_A) is shown in Table 6A. An open reading begins with an ATG initiation codon at nucleotides 31-33 and ends with a TAA codon at nucleotides 574-576. A putative untranslated region upstream from the initiation codon and downstream from the termination codon are underlined in Table 6A, and the start and stop codons are in bold letters.

Table 6A. MOL6 Nucleotide Sequence (SEQ ID NO:19)


The MOL6 protein encoded by SEQ ID NO:20 has 181 amino acid residues, and is presented using the one-letter code in Table 6B (SEQ ID NO:20). The Psort profile for MOL6 predicts that this sequence has a signal peptide and is likely to be localized outside the cell with a certainty of 0.8200. The most likely cleavage site for a peptide is between amino acids 24 and 25: VQN-QK based on the SignalP result. The molecular weight o the MOL6 protein is 20424.3 Daltons.

Table 6B. Encoded MOL6 protein sequence (SEQ ID NO:20).


The disclosed nucleic acid sequence has 566 of 586 bases (96 %) identical to a Homo sapiens kappa casein precursor mRNA (GENBANK-ID: ACC: 129004) (E value = 9.8e-116).

The full amino acid sequence of MOL6 was found to have 165 of 182 amino acid residues (90%) identical to, and 168 of 182 residues (92%) positive with, the 182 amino acid residue kappa casein precursor protein from Homo sapiens (ptnr: SWISSPROT- ACC:P07498) (E value = 3.0e-83), 165 of 182 amino acid residues (90%) identical to, and 168 of 182 residues (92%) positive with patp:AAR39351 Recombinant human kappa casein - Homo sapiens having 182 aa (E value = 3.0e-8j), and 165 of 182 amino acid residues (90%) identical to, and 168 of 182 residues (92%) positive with patp:AAR92150 Human milk kappa-casein having 182 amino acids (E value = 3.0e-8j).

The global sequence homology (as defined by FASTA alignment with the full length sequence of this protein) is 92.265 % amino acid homology and 91.160% amino acid identity. In addition, this protein contains the following protein domains (as defined by Interpro) at the indicated nucleotide positions: casein_kappa (IPR000117) at amino acid positions 1 to 181.

The full amino acid sequence of MOL6 was found to have homology with several proteins, including those disclosed in the BLASTP data in Table 6C.

Figure imgf000108_0002

This information is presented graphically in the multiple sequence alignment given in Table 6D (with MOL6 being shown on line 1) as a ClustalW analysis comparing MOL6 with related protein sequences.

Table 6D Information for the ClustalW proteins:

1) MOL6 (SEQ ID NO:20)


3) gi I 4885161 j ref |NP_005203.11 casein, kappa [Homo sapiens] (SEQ ID NO:5l)

4) gij 186555 |gb|AAA59456.l| kappa-casein [Homo sapiens] (SEQ ID NO:52)

5) gij 13633560|re |XP_003538.3 | casein, kappa [Homo sapiens] (SEQ ID NO: 53)

6) gi| 2493502 |sp|P79139 |CASK_CAMDR KAPPA CASEIN PRECURSOR (SEQ ID NO:54)

10 20 30 40 50

Figure imgf000108_0001

60 70 80 90 100

Figure imgf000109_0001

Table 6E lists the domain description from DOMAIN analysis results against MOL6. The region from amino acid residue 1 through 1 16 (SEQ ID NO:20) most probably (E = 2e" ) contains a casein kappa domain found in Kappa casein, aligned here in Table 6E. This indicates that the MOL6 sequence has properties similar to those of other proteins known to contain this domain.

Figure imgf000109_0002

160 170 190


The above defined information for MOL6 suggests that this kappa casein precursor-like protein may function as a member of a "Kappa Casein Precursor family". Members of this family is found as a nutritional component of human milk. Therefore, the novel nucleic acids and proteins identified here may be useful in potential therapeutic applications implicated in (but not limited to) various pathologies and disorders as indicated below. The potential therapeutic applications for MOL6 include, but are not limited to: protein therapeutic, small molecule drug target, antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), diagnostic and/or prognostic marker, kappa casein precursor therapy (kappa casein precursor delivery/kappa casein precursor ablation), research tools, tissue reKappa Casein Precursor ration in vivo and in vitro of all tissues and cell types composing (but not limited to) those defined here.

The MOL6 nucleic acids and proteins are useful in potential therapeutic applications implicated in nutritional deficiencies. It is used as a nutrient supplement in milk based products to provide a substantial improvement ofthe nutritional and biological value of the formulae, making it closer in similarity to human milk. Kappa casein can also be used as a pharmaceutical and/or other pathologies and disorders. For example, a cDNA encoding the kappa casein precursor-like protein may be useful in kappa casein precursor therapy, and the kappa casein precursor-like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from nutritional deficiencies. MOL6, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount ofthe nucleic acid or the protein are to be assessed. These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel MOL6 substances for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-MOLX Antibodies" section below. The disclosed MOL6 protein has multiple hydrophilic regions, each of which can be used as an immunogen. In one embodiment, a contemplated MOL6 epitope is from about amino acids 30 to 125. In another embodiment, a MOL6 epitope is from about amino acids 140 to 160. These novel proteins can also be used to develop assay systems for functional analysis.

MOL7 A novel nucleic acid encoding a human Rh type B glycoprotein -like-protein

MOL7 was identified by TblastN using CuraGen Corporation's sequence file for MOL7 probes or homologs, and run against the Genomic Daily Files made available by GenBank. The disclosed novel MOL7 nucleic acid of 1765 nucleotides (also referred to as AF193808A) is shown in Table 7A. An open reading frame begins with an ATG initiation codon at nucleotides 39-41 and ends with a TAA codon at nucleotides 1383-1385. A putative untranslated region upstream from the initiation codon and downstream from the termination codon are underlined in Table 7A, and the start and stop codons are in bold letters.

Table 7A. MOL7 Nucleotide Sequence (SEQ ID NO:21)


The MOL7 protein encoded by SEQ ID NO:21 has 448 amino acid residues, and is presented using the one-letter code in Table 7B (SEQ ID NO:22). The SignalP, Psort and/or Hydropathy profile for MOL7 predict that MOL7 has a signal peptide and is likely to be localized at the plasma membrane with a certainty of 0. 6400. The SignalP shows a signal sequence is coded for with the most likely cleavage site being between amino acids 27 and 28: ATA-VL. This is typical of this type of membrane protein. The molecular weight ofthe MOL7 protein is 48304.3 Daltons.

Table 7B. Encoded MOL7 protein sequence (SEQ ID NO:22).


The full amino acid sequence of MOL7 was found to have 363 of 448 amino acid residues (81%) identical to, and 399 of 448 residues (89%) positive with, the 455 amino acid residue mouse RH TYPE B GLYCOPROTEIN (ptnr: SPTREMBL-ACC:Q9QXP1)

The full amino acid sequence of MOL7 was found to have homology with several proteins, including those disclosed in the BLASTP data in Table 7C.

Figure imgf000112_0001

This information is presented graphically in the multiple sequence alignment given in Table 7D (with MOL7 being shown on line 1) as a ClustalW analysis comparing MOL7 with related protein sequences.

Table 7D Information for the ClustalW proteins:

1) OL7 (SEQ ID N0:22)

2) gi I 99668911 ref |NP_065140. h type B glycoprotein [Homo sapiens] (SEQ ID NO: 55)

3) gi |l4346006|gb|AA 15395.1 (AY013268) Rh type B glycoprotein [Pan troglodytes] (SEQ ID NO: 56)

4) gi| 14486159|gb|AAK14651.1 (AY013261) Rh type B glycoprotein [Sus scrofa] (SEQ ID NO: 57)

5) gi| 10946710 I ref |NP_067350.11 Rhesus blood group-associated B glycoprotein; Rh type B glycoprotein [Mus musculus] (SEQ ID NO:58)

6) gi| 1448616l|gb|AAK14652.l| (AY013262) Rh type B glycoprotein [Oryctolagus cuniculus] (SEQ ID NO: 59)

10 20 30 40 50

Figure imgf000113_0001


Figure imgf000114_0001

Table 7E lists the domain description from DOMAIN analysis results against MOL7. The region from amino acid residue 25 through 336 (SEQ ID NO:22) most probably (E = le"'") contains an ammonium transporter domain found in Ammonium transporters, aligned here in Table 7E. This indicates that the MOL7 sequence has properties similar to those of other proteins known to contain this domain.

Figure imgf000114_0002

70 80 90 100



Figure imgf000114_0003

210 220 230 240 250


260 270 280 290 300


Figure imgf000114_0004

370 380 390 400


410 440 450


Figure imgf000115_0001
(SEQ ID NO : 100 )

TaqMan Data

Example 2 shows a TaqMan expression profile in 41 normal human tissues and 55 human cancer cell lines. The MOL7 gene is expressed in normal tissues, specifically lung, colon, small intestine, and prostate, and is lost in cancer cell lines.

Example 2 also shows replicate TaqMan expression results in tumor tissues that are often matched with normal adjacent tissue (NAT), as defined by the operating surgeon. The results reveal that the MOL7 human Rh type B glycoprotein is overexpressed in kidney tumors compared with their NAT and normal tissues. Chromosomal localization:

This gene belongs to genomic DNA GenBank AL139130 which maps to chromosome 1.

Tissue expression: MOL7 has been found to be expressed in Renal clear cell carcinoma by EST analysis. Genbank EST AI310325 has 100% identity with novel Rh type B glycoprotein and was obtained from 2 pooled tumors (clear cell type). Kidney, AI925934 has 100% identity with novel Rh type B glycoprotein and was obtained from Kidney. Fetal spleen R83833 and AI022447 have 96% identity to novel Rh type B glycoprotein and were obtained from Fetal spleen. The tissue expression profile of was also determined by TaqMan.

Uses ofthe Compositions of the Invention

The expression pattern, map location and protein similarity information for the MOL7 suggest that this gene may function as "an Rh family" member. Therefore, the MOL7 nucleic acids and proteins are useful in potential therapeutic applications implicated in various pathologies /disorders described and/or other pathologies/disorders

Potential therapeutic uses for MOL7 include: Protein therapeutic, Small molecule drug target, Antibody target (Therapeutic, Diagnostic, Drug targeting/Cytotoxic antibody), Diagnostic and/or prognostic marker, Gene therapy (gene delivery/gene ablation),

Research tools, Tissue regeneration in vitro and in vivo (regeneration for all these tissues and cell types composing these tissues and cell types derived from these tissues) The MOL7 nucleic acids and proteins are useful in potential therapeutic applications implicated in various names of pathologies/disorders described below and/or other pathologies disorders. For example, a cDNA encoding the RH TYPE B GLYCOPROTEIN -like protein may be useful in gene therapy, and the RH TYPE B GLYCOPROTEIN-like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions ofthe present invention will have efficacy for treatment of patients suffering from the pathologies described above. The novel nucleic acid encoding MOL7, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount ofthe nucleic acid or the protein are to be assessed.

These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel MOL7 substances for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-MOLX Antibodies" section below. The disclosed MOL7 protein has multiple hydrophilic regions, each of which can be used as an immunogen. In one embodiment, a contemplated MOL7 epitope is from about amino acids 40 to 80. In another embodiment, a MOL7 epitope is from about amino acids 160 to 190. In additional embodiments, MOL7 epitopes are from about amino acids 175 to 225, 235 to 250, 325 to 345, 360 to 380, and from about amino acids 400 to 450. These novel proteins can also be used to develop assay systems for functional analysis.


A novel human Noelin-2-like nucleic acid was identified by TblastN using CuraGen Corporation's sequence file. The disclosed novel MOL8 nucleic acid of 1399 nucleotides (also referred to as SC84366578_A) is shown in Table 8A. An open reading frame begins with an ATG initiation codon at nucleotides 14-16 and ends with a TAG codon at nucleotides 1391-1393. A putative untranslated region downstream from the termination codon are underlined in Table 8 A, and the start and stop codons are in bold letters.

14 Table 8A. MOL8 Nucleotide Sequence (SEQ ID NO:23)


The MOL8 protein encoded by SEQ ID NO:23 has 459 amino acid residues, and is presented using the one-letter code in Table 8B (SEQ ID NO:24). The SignalP, Psort and/or Hydropathy profile for MOL8 predict that MOL8 has no signal peptide and is likely to be localized at the microbody (peroxisome) with a certainty of 0.5616. The molecular weight ofthe MOL8 protein is 53275.2 Daltons.

Table 8B. Encoded MOL8 protein sequence (SEQ ID NO:24).


The nucleotide sequence of MOL8 has 889 of 1286 bases (69%) identical to a Gallus gallus NOELIN-2 mRNA (GENBANK- ID: AF239804). The full amino acid sequence ofthe protein ofthe invention was found to have 288 of 448 amino acid residues (64%) identical to, and 367 of 448 residues (80%>) positive with, the 457 amino acid residue NOELIN-2 protein from Gallus gallus (Chicken) (ptnr:SPTREMBL-ACC: AAF43715), and 439 of 459 amino acid residues (95%>) identical to, and 442 of 459 residues (96%) positive with, the 458 amino acid residue patp:AAB74696 Human membrane associated protein MEMAP-2.

The global sequence homology (as defined by FASTA alignment with the full length sequence of this protein) is 74%> amino acid homology and 65% amino acid identity. In addition, this protein contains the following protein domain (as defined by Pfam) at the indicated nucleotide positions: Olfactomedin-like domain (PF02191) at amino acid positions 201 to 451.

The full amino acid sequence of MOL8 was found to have homology with several proteins including those disclosed in the BLASTP data in Table 8C.

Figure imgf000118_0001

Homology between MOL8 and other proteins are presented graphically in the multiple sequence alignment given in Table 8D (with MOL8 being shown on line 1) as a ClustalW analysis comparing MOL8 with related protein sequences.

Table 8D. Information for the ClustalW proteins:

1) MOL8 (SEQ ID NO : 24 )



4) gi I 9506929 |ref [NP_062371.11 olfactomedin related ER localized protein [Mus musculus] (SEQ ID NO: 62)

5) gi|7248902|gb|AAF43715.l|AF239804_l (AF239804) NOELIN-2 [Gallus gallus] (SEQ ID NO: 63)

6) gi I 2143875 |pir I 1173636 neuronal olfactomedin-related ER localized protein - rat (SEQ ID NO: 64)

Figure imgf000119_0001

460 470 480


Table 8E lists the domain description from DOMAIN analysis results against MOL8. The region from amino acid residue 201 through 457 (SEQ ID NO:24) most probably (E = 4e~83) contains a Olfactomedin-like domain, aligned in Table 8E. This indicates that the MOL8 sequence has properties similar to those of other proteins known to contain this domain.

Table 8E. Domain Analysis of MOL8 gnl I Smart] smart00284, OLF, Olfactomedin-like domains

CD-Length = 257 residues, 100.0% aligned

Score = 308 bits (789), Expect = 4e-85

10 50

MOL8 g 3κκggMMκRBττGj3>SivlciB5lGτ RFwawMTiaSHlAS E - Ei - NNRVJSiaBbs Yil - - smart | smartoo284 ia gπGiglAflGHRsSκiSBiBr,o^ κ-WΑYKsιew';ιaικlBMwM τl5- κsrιYMBlpτ,

Figure imgf000120_0001

160 170 180 190 200


Smart | smart00284 JSNI IMBKIBI] ΓIIHSN

230 240



260 270


Smart I smart00284 ffiϊϊϊSKfS |LLMØHHYYDDIIAAΪΠl5KKPP (SEQ ID NO : IOI )

Uses of the Compositions of the Invention

The above defined information for MOL8 suggests that this Noelin-2-like protein may function as a member of a "Noelin-2 family". This family is involved in neural crest development, and other developmental processes. Therefore, the novel nucleic acids and proteins identified here may be useful in potential therapeutic applications implicated in (but not limited to) various pathologies and disorders as indicated below. The potential therapeutic applications for MOL8 include, but are not limited to: protein therapeutic, small molecule drug target, antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), diagnostic and/or prognostic marker, gene therapy (gene delivery/gene ablation), research tools, tissue regeneration in vivo and in vitro of all tissues and cell types composing (but not limited to) those defined here.

The MOL8 nucleic acids and proteins are useful in potential therapeutic applications implicated in neural crest development in early embryonic stage. For example, a cDNA encoding the Noelin-2-like protein may be useful in gene therapy, and the Noelin-2-like protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions ofthe present invention will have efficacy for treatment of patients suffering from primary open-angle glaucoma (POAG), and bone disorders, hematopoietic disorders, neuro-developmental disorders, cancer, autoimmune disorders, psychiatric disorders. The novel nucleic acid encoding MOL8, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount ofthe nucleic acid or the protein are to be assessed.

These materials are further useful in the generation of antibodies that bind immuno-specifically to the novel MOL8 substances for use in therapeutic or diagnostic methods. These antibodies may be generated according to methods known in the art, using prediction from hydrophobicity charts, as described in the "Anti-MOLX Antibodies" section below. The disclosed MOL8 protein has multiple hydrophilic regions, each of which can be used as an immunogen. In one embodiment, a contemplated MOL8 epitope is from about amino acids 20 to 50. In another embodiment, a MOL8 epitope is from about amino acids 50 to 125. In additional embodiments, MOL8 epitopes are from about amino acids 140 to 210, 225 to 320, 350 to 375, and from about amino acids 380 to 440. These novel proteins can also be used to develop assay systems for functional analysis. MOL9 or Clone 2191999

Clone 2191999 resembles interleukin-17 (IL-17). The Clone 2191999 nucleotide sequence (SEQ ID NO: 135), shown in Table AAA, is 1107 bp in length. This nucleotide sequence has an open reading frame ("ORF") encoding a polypeptide of 178 amino acid residues (represented in Table AAA; SEQ ID NO:136). The start codon is at nucleotides

65-67 and the stop codon is at nucleotides 599-601. The protein of SEQ ID NO.T36 is predicted by the PSORT program to localize extracellularly with a certainty of 0.4037. The program SignalP predicts an N-terminal signal peptide, with the most likely cleavage site between residues 22 and 23, represented by the dash between the amino acids GSQ- EP (i.e., GlySerGln-GluPro).

Table AAA. Sequence of clone 2191999 (IL17_like)

Translated Protein - Nucleotide 65 to 598





















IL-17 is a T cell-derived cytokine that may play an important role in the initiation or maintenance ofthe proinflammatory response. Whereas expression of IL-17 is restricted to activated T cells, the IL-17 receptor is found to be widely expressed, a finding consistent with the pleiotropic activities of IL-17. Two human cytokines, IL-17B and IL- 17C are related to IL-17 (approximately 27% amino acid identity; Proc Natl Acad Sci US A 2000, 97(2):773-8). IL-17B mRNA is expressed in adult pancreas, small intestine, and stomach. IL-17C mRNA is not detected by RNA blot hybridization of several adult tissues. No expression of IL-17B or IL-17C mRNA is found in activated T cells. In a survey of cytokine induction, IL-17B and IL-17C stimulate the release of tumor necrosis factor alpha and IL-1 beta from the monocytic cell line THP-1, whereas IL-17 has a small effect in this system. No induction of IL-1 alpha, IL-6, IFN-gamma, or granulocyte colony-stimulating factor is found in THP-1 cells. Fluorescence-activated cell sorter analysis shows that IL-17B and IL-17C bind to THP-1 cells. Conversely, IL-17B and IL- 17C are not active in an IL-17 assay or the stimulation of IL-6 release from human fibroblasts and do not bind to the human IL-17 receptor extracellular domain. These data show that there is a family of IL-17-related cytokines differing in patterns of expression and proinflammatory responses that may be transduced through a cognate set of cell surface receptors. Because Clone 2191999 is highly related to IL-17, by analogy Clone 2191999 may be utilized in assessing patterns of cytokine expression and in proinflammatory responses

In a BLASTX search the nucleotide sequence of SEQ ID NO:l, Clone 2191999 protein is found to be similar to human PRO1031 protein (90%; W09946281-A2, published 16-SEP-1999), an expressed sequence tag. It is also 90% similar to human interIeukin-17D having 180 residues (W09935267-A1 , published 15-JUL-1999).

Human IL-17D-like polypeptides are significantly related to human IL-17 polypeptides. The homology between IL-17 and IL-17D suggests that an IL-17D-like polypeptide, e.g., Clone 2191999, is capable of signaling through cytokine receptors. IL- 17D-like protein can also be used as a therapeutic agent for the treatment of diseases mediated by IL-17D. IL-17D-like polypeptides bind to B cells. It is likely that these polypeptides can be used for targeting compounds to B cells and B cell tumors, and for specific selection of B cell populations.

BLASTX of SEQ ID NO: 135 further shows that Clone 2191999 protein is 90% similar to human embryo derived interleukin related factor I protein (EDIRF I) having 180 residues (WO9932632-A1, published 01-JUL-1999). The EDIRF-like DNA and protein sequences (e.g., Clone 2191999) and their homologues, antibodies (Ab) specific for EDIRF-like protein, and other modulators may be used: (i) in screening and detection assays, e.g. for chromosome mapping, tissue typing or forensic studies; (ii) in diagnosis, prognosis or monitoring clinical trials; and (iii) for treating or preventing EDIRF-like- related diseases (especially immune, hematopoietic, differentiative, developmental or inflammatory disease, including arthritis and psoriasis. The EDIRF-like coding sequence, or its fragments, are also useful as probes and primers (for detecting related sequences and disease-associated mutations, also for mutagenesis), for expressing recombinant EDIRF and as source of antisense, ribozyme and peptide nucleic acids for inhibiting translation of EDIRF-derived mRNA. EDIRF-like protein is used to raise Ab (useful for detecting EDIRF, including forms with aberrant post-translational modification, for affinity purification and therapeutically) and to screen for specific modulators (e.g. peptides or peptidomimetics).

Clone 2191999 is also 90% similar to human inteι eukin-20 (IL-20; WO9903982- Al, published 28-JAN-1999). The Clone 2191999 sequences represent a human interleukin-20-like gene and gene product that may be used, for example, to treat B-cell neoplasms, including chronic lymphocyte leukemia (CLL) and B-lymphocyte leukemia (BLL), and in anticancer and antiviral treatments. Clone 2191999 may be used to treat immunodeficiencies, e.g. in T- and B-lymphocytes. leukopenia, reduced numbers of leukocytes, immune disorders, e.g. rheumatoid arthritis. Clone 2191999 may also be used to augment the humoral or cellular immune response in vivo to other therapeutic agents coadministered with Clone 2191999, e.g. to enhance the efficacy of viral antigen vaccines, such as HIV. Clone 2191999 may also be useful in immunotherapeutic and anti- inflammation compositions, for the treatment of patients suffering from chemotherapy from bone marrow transplants, to treat corneal damage, keratitis, ulcers, thrombocytopenia, to restore neutrophil and platelet counts in treatment of cancer, to enhance erythropoietic production for treating anemias associated with inflammation, renal failure, AIDS and cancer. Clone 2191999 may be employed to treat hematopoiesis, and to treat sepsis. Agonists and antagonists of Clone 2191999 can also be used.

The protein encoded by SEQ ID NO: 136 is also 90% similar to human Zcyto7, a polypeptide of 180 residues (WO9849310-A1, published 05-NOV-1998), a mammalian cytokine-like factor 7 polypeptide. Therefore, Clone 2191999 may be useful e.g. to promote bone and cartilage growth, e.g. to treat osteoporosis, or in treatment of inflammation, neurodegenerative diseases, and so forth.

Clone 2191999 includes the full length protein disclosed as being encoded by the ORF described herein, as well as any mature protein arising therefrom as a result ofthe removal of a signal peptide. Clone 2191999 also includes all fragments, analogs, homologs and derivatives of Clone 2191999. Thus the proteins ofthe invention encompass both the precursors and active forms of Clone 2191999 protein.

MOL10 or Clone 11753149.0.6 Clone 11753149.0.6 includes a polynucleotide of 1603 bp in length (Table AAB;

SEQ ID NO: 137. The differentially expressed gene fragment used in the identification of this clone was obtained from fetal brain tissue. Expressed fragments are also observed in fetal brain and thalamus. Clone 1 1753149.0.6 includes an ORF encoding a polypeptide of 344 amino acid residues (Table AAB; SEQ ID NO: 138. The ORF contains a predicted N- terminal signal peptide sequence and a C-terminal membrane attachment sequence between residues 327-344. The initiation codon occurs at nucleotides 92-94 and the termination codon at nucleotides 1 124-1126. The PSORT predicts that the polypeptide localizes in the plasma membrane with a certainty of 0.8110. The SignalP program predicts that the encoded polypeptide has a signal peptide, and that the most likely cleavage site occurs between residues 33 and 34, represented by the dash between the amino acids VRS-GD (i.e., ValArgSer-GlyAsp). SIGNALP also predicts additional signal peptidase cleavage sites in the segment between residues 18 and 34. Table AAB. Sequence of Clone 11753149.0.6 Translated Protein - Nucleotide 92 to 1123






























In searches of nucleic acid sequence databases, clone 1 1753149.0.6 resembles rat neurotrimin, a subfamily of differentially expressed neural cell adhesion molecules, to the extent of 84% identity of 1477 bp in a total sequence of 2040 bp (GenBank- ID:RNU16845|acc:U16845; Struyk et al J. Neurosci. 15 (3), 2141-2156 (1995)). Similarities to the additional nucleic acids, described as having similar or analogous properties, were also found, including (1) chicken mRNA for CEPU-1 , an immunoglobulin superfamily molecule expressed by developing cerebellar Purkinje cells (GenBank-ID:GGCEPUl|acc:Z72497, Spaltmann and Brummendorf. Neurosci. 16 (5), 1770-1779 (1996));(2) chicken CEPU gene identified as a neural secreted glycoprotein belonging to the immunoglobulin-like opioid binding cell adhesion molecule (OBCAM) subfamily,(GenBank-ID:GGCEPUS|acc:AJ225897, Kim et al., 1999 Mol. Cells 9 (3), 270-276); and (3) Bovine mRNA for opioid binding protein / cell adhesion molecule OBCAM (GenBank-ID:BTOBCAM|acc:X 12672).

BLASTP search revealed that the polypeptide encoded by clone 1 1753149.0.6 has 31 1 of 336 residues (92%) identical to, and 320 of 336 residues (95%) positive with rat neurotrimin precursor (GP65) having 344 residues (GenBank acc:Q62718). It also has 240 of 337 residues (71%) identical to, and 277 of 337 residues (82%) positive with human opioid binding protein/cell adhesion molecule precursor (OBCAM) having 345 residues (GenBank acc:Ql 4982). Neurotrimin-like and/or OBCAM-like proteins ofthe invention encoded by clone

11753149.0.6 include the full length protein disclosed as being encoded by the ORF described herein, as well as any mature protein arising therefrom as a result ofthe removal of a signal peptide. Clone 1 1753149.0.6 also includes all fragments, analogs, homologs and derivatives of Clone 1 1753149.0.6. Thus the proteins ofthe invention encompass both the precursors and the active forms ofthe neurotrimin-like and/or OBCAM-like proteins. MOL11 or Clone 11753149.0.37

Clone 11753149.0.37 is a variant of clone 1 1753149.0.6, wherein the nucleotide sequence has a longer 5' untranslated region (UTR), but the same open reading frame. Clone 1 1753149.0.37 nucleotide sequence (SEQ ID NO: 139 and the predicted polypeptide sequence encoded therein (SEQ ID NO: 140) are given in Table AAC. The ORF of clone 1 1753149.0.37 extends from nucleotide 501 to nucleotide 1532, in the numbering scheme of SEQ ID NO:XX. The properties ofthe neurotrimin-like or OBCAM-like polypeptide encoded by clone 1 1753149.0.37 are the same as those set forth in the preceding section for clone 1 1753149.0.6. In addition, the long 5' UTR may include control elements and/or response elements that affect the specificity of expression ofthe gene product of clone 1 1753149.0.37 among various tissues, physiological states and pathological conditions.

Table AAC. Sequence of Clone 11753149.0.37 Translated Protein - Frame: 3 - Nucleotide 501 to 1532















































Neurotrimin-like and/or OBCAM-like proteins ofthe invention encoded by clone 1 1753149.0.37 include the full length protein disclosed as being encoded by the ORF described herein, as well as any mature protein arising therefrom as a result ofthe removal of a signal peptide. Clone 1 1753149.0.37 also includes all fragments, analogs, homologs and derivatives of Clone 1 1753149.0.37. Thus the proteins ofthe invention encompass both the precursors and the active forms ofthe neurotrimin-like and/or OBCAM-like proteins.

MOL12 or Clone 3883556

Clone 3883556 includes a polynucleotide of 1228 bp in length (SEQ ID NO: 141, shown in Table AAD. Expression of this sequence is detected in human fetal brain. The polynucleotide of SEQ ID NO: 141 encodes a polypeptide of 166 residues (SEQ ID NO: 142, shown in Table AAD, in an ORF beginning with the initiation codon at nucleotides 529-531 and ending at the stop codon at nucleotides 1027-1029. The PSORT program predicts that the polypeptide is localized extracellularly, with a certainty of 0.37. The SignalP program predicts that the polypeptide has a signal peptide with the most likely cleavage site between residues 16 and 17, represented by the dash between the amino acids SHA-SE (i.e., SerHisAla-SerGlu). Table AAD. Sequence of Clone 3883556












ProGlnAspSerT rProAsnGlnLeuTyrlleTrpGlyArgThr










BLASTP search revealed a 27% identity, and 41% similarity with ZK899.1 - Caenorhabditis elegans, having 161 aa (ACC:Q23659; Z37140); and a 33% identity, and 47%o similarity with major merozoite surface antigen - Plasmodium berghei yoelii, 641 aa (fragment) (ACC:G 160082). The protein ofthe invention encoded by clone 3883556 includes the full length protein disclosed herein, as well as any mature protein arising therefrom as a result of the removal of a signal peptide. Clone 3883556 also includes all fragments, analogs, homologs and derivatives of Clone 3883556. Thus the proteins ofthe invention encompass both the precursors and the active forms ofthe 3883556 protein. MOL13 or Clone 4301136-1

Clone 4301 136-1 includes a polynucleotide of 1917 bp (SEQ ID NO: 143, as shown in Table AAE. This clone was initially identified in fetal kidney and heart tissue. The polynucleotide of SEQ ID NO: 143 encodes a polypeptide having 160 residues (SEQ ID NO: 144), shown in Table AAE, in an ORF beginning at nucleotides 48-50 and ending with a stop codon at nucleotides 528-530. The PSORT program predicts that the 4301 136- 1 polypeptide localizes extracellularly with a certainty of 0.3700. The SignalP program predicts only a low probability that the polypeptide contains a known signal peptide. If so, the most likely cleavage site for the signal peptide occurs between residues 23 and 24, represented by the dash between the amino acids PWG-GK (i.e., ProTrpGly-GlyLys). Table AAE. Sequence of Clone 4301136-1

Translated Protein - Nucleotide 410 to 889






















Clone 4301136-1 proteins ofthe invention include the full length protein encoded by the ORF disclosed herein, as well as any mature protein arising therefrom, for example, as a result ofthe removal of a signal peptide. Clone 4301 136-1 also includes all fragments, analogs, homologs and derivatives of Clone 4301 136-1. Thus the proteins ofthe invention encompass both the precursors and the active forms ofthe PCKl-like Clone 4301 136-2 protein. MOL14 or 4301136-2

Clone 4301 136-2 includes a polynucleotide of 1279 bp (SEQ ID NO: 145), shown in Table AAF. This clone was initially isolated from fetal kidney and heart tissues. It is also found in other tissues, including normal adult lung, osteosarcoma, lymph node tissue, prostate gland, thymus gland, and fetal brain.

The polynucleotide of clone 4301 136-2 includes an ORF encoding a polypeptide of 161 residues (SEQ ID NO: 146), shown in Table AAF, with an initiation codon at nucleotides 61-63 and a termination codon at nucleotides 544-546. The PSORT program predicts that this polypeptide localizes extracellularly with a certainty of 0.3700. The SignalP program predicts only a low probability that the polypeptide contains a known signal peptide. If so the most likely cleavage site occurs between residues 23 and 24, represented by the dash between the amino acids PWG-GK (i.e., ProTrpGly-GlyLys). Table AAF . Sequence of Clone 4301136 -2

Translated Protein - Nucleotide 410 to 892






















1261 NNNNTNNNNNANNCTTNNA Clone 4301136-2 includes the full length protein encoded by the ORF disclosed herein, as well as any mature protein arising therefrom, for example, as a result ofthe removal of a signal peptide. Clone 4301136-2 also includes all fragments, analogs, homologs and derivatives of Clone 4301136-2. Thus the proteins ofthe invention encompass both the precursors and the active forms of Clone 4301136-2 protein. MOLl 5 or 4324229

Clone 4324229 includes a polynucleotide of 1689 bp (SEQ ID NO: 147), shown in Table AAG. This clone is shorter in both the 5' and 3' directions than the nucleotide sequence of clone 4324229-2 disclosed in the next section. It also is closely related to the nucleotide sequence of clone AC012614-1.0.123 disclosed below. This sequence was originally identified in lymph node. The Clone 4324229 polypeptide has 316 amino acid residues (SEQ ID NO: 148), represented in Table AAG, and is encoded by an ORF beginning at nucleotides 199-201 of SEQ ID NO: 147, with a termination codon at nucleotides 1 147-1 149. The PSORT program predicts that the polypeptide localizes to the mitochondrial matrix space with a certainty of 0.4433. The SignalP program predicts that this sequence most likely has no known signal sequence. SignalP does predict, however, that if a signal sequence is present, the most likely cleavage site occurs between residues 18 and 19, represented by the dash between the amino acids TRL-QP (i.e., TryArgLeu- GlnPro). Table AAG. Sequence of Clone 4324229.

Translated Protein - Nucleotide 199 to 1146

























Database similarity searches indicate that the protein encoded by clone 4324229 has similarity to a fragment of human limbic system associated membrane protein (LAMP; PCT Publication WO9630052-A1, published 03-OCT-1996). LAMP is a self- binding, antibody-like cell surface adhesion protein involved in formation of connections between adjacent neurons. LAMP protein, and by analogy the clone 4324229 protein, may be important in nerve growth and differentiation, epilepsy, Alzheimer's disease and schizophrenia.

The protein encoded by clone 4324229 is also similar to portions of human Down syndrome-cell adhesion molecule (DS-CAM2), a protein of 1571 residues (PCT Publication W09817795-A1, published 30-APR-1998). DS-CAM2 is a soluble extracellular protein belonging to a novel subclass ofthe Ig superfamily, with highest homology to neural cell adhesion molecules. DS-CAM polypeptides are associated with developmental and neurological processes. DS-CAM polypeptides, and by analogy the clone 4324229 polypeptides, can be used in, e.g. neural prosthetic devices used in entubulation methods of repairing (regenerating) damaged or severed peripheral nerves, and in bioassays to identify agonists and antagonists to said proteins and processes. The clone 4324229 polypeptides can also be used in detection, diagnosis and therapy of developmental and neurological abnormalities such as Down syndrome, mental retardation, holoprosencephaly, agenesis ofthe corpus callosum, or schizencephaly. In a BLASTN similarity search, a 895 bp portion ofthe clone 4324229 nucleotide sequence was found to be 100%) identical to the sequence of human mRNA for KIAA1061 protein (GenBank-ID:AB028984|acc:AB028984, submitted 17-JUN-1999). KIAA1061 originates in brain and its sequence falls within the ORF identified above for clone 4324229. A BLASTP similarity was found to FRAZZLED of Drosophila melanogaster


Clone 4324229 proteins include the full length protein encoded by the ORF disclosed herein, as well as any mature protein arising therefrom. Such a mature protein could be formed, for example, as a result ofthe removal of a signal peptide. Clone

4324229 also includes all fragments, analogs, homologs and derivatives of Clone

4324229. Thus the proteins ofthe invention encompass both the precursors and the active forms of Clone 4324229 protein.

MOLl 6 or 4324229-2 Clone 4324229-2 includes a polynucleotide of 4000 bp (SEQ ID NO: 149), shown in Table

AAH. This clone incorporates extensions in both the 5' and 3' directions ofthe nucleotide sequence of clone 4324229 disclosed above. It also is closely related to the nucleotide sequence of clone AC012614-1.0.123 disclosed in the following section. Clone 4324229-2 was originally identified in lymph node. Clone 4324229-2 nucleotide sequence encodes a polypeptide of 842 amino acid residues (SEQ ID NO: 150), shown in Table AAH. This polypeptide is encoded by an open reading frame beginning at nucleotides 408-410, with a termination codon at nucleotides


Table AAH. Sequence of Clone 4324229-2




MetLysProGlyGlyPheTrp euHisLeuThrLeuLεuGlyAlaSerLeuProAlaAlaLeuGlyTrpMetA



ArgGluGlyLeuSerSerHisAsnGlu eu euAlaSerCysGly ysLysPheCysSerArgGlySerArgCysValLe




AspCysPheLeuLysGlyAspThrCysThrMetAlaGlyTyrAlaArg euLysAsnValLeu euAlaLeuGlnThrAr



Asp euLeuGlyCysSerProGlyAspLeuLeuArgPheAspAspTyrAsnSerAspSerSerLeuThrLeuArgGluPh




LeuAsp euGluAspIleAsnAspPheGlyGluAspAspSerLeuTyrlleThrLysValThrThrlleHisMetGlyAs








BLASTX analysis indicates that a portion ofthe C-terminus of Clone 4324229-2 protein is identical to KIAA1061. See DNA Res. 6:197-205(1999); GenBank- ID:AB028984|acc:AB028984. It is similar to cell adhesion molecules and follistatin-like proteins.

Clone 4324229-2 proteins include the full length protein encoded by the ORF disclosed herein, as well as any mature protein arising therefrom. Such a mature protein could be formed, for example, as a result ofthe removal of a signal peptide. Clone 4324229-2 also includes all fragments, analogs, homologs and derivatives of Clone 4324229-2. Thus the proteins ofthe invention encompass both the precursors and the active forms of a LAMP-like and DS-CAM-like Clone 4324229-2 protein. MOL17 or AC012614J.0.123 AC012614 .0.123 includes a full-length clone of 5502 nucleotides (SEQ ID NO:

151) and the entire coding sequence of a predicted 815 amino acid protein (SEQ ID NO: 152), shown in Table AAI. The predicted ORF spans from nucleotides 420 to 2865. This sequence is expressed in glioma, osteoblast, other cancer cells, lung carcinoma, and small intestine. Table AAI . Sequence of Clone AC012614_1 . 0 . 123

Frame : 3 - Nucleotide 420 to 2864 Printed 80 characters to a line . i








MetGlnCysAspValGlyAspGlyArgLeuPheArgLeuSer euLysArgAlaLeuSerS







LeuGlnThrArgLeuGlnPro euGlnGluGlyAspSerArgGlnAspProAlaSerGlnLysArg eu euValGluSe










































































AC012614_1.0.123 maps to the Unigene entry 123420, which is expressed in brain, breast, kidney, pancreas, and pooled tissue. This entry further maps to the Chromosome 5 marker stSG63086 (also known as RH104076) (GM99-GB4 Map information); Position: 510.63 (cR3000); Lod score:0.71; Reference Interval: D5S471- D5S393 (129.6-140.8 cM). By integrating the marker information with the MIM gene map, it is believed clone ACO 12614_1.0.123 maps to 5q21 -5q31.

AC012614_1.0.123 was searched against other databases using SignalPep and PSort search protocols. The protein is most likely located in the mitochondrial matrix space (certainty=0.4718) and seems to have no known N-terminal signal sequence. The predicted molecular weight is 90346.9 daltons.

The predicted AC012614_1.0.123 amino acid sequence was searched in the publicly available GenBank database using BLASTP. The 815 residue AC012614_1.0.123 protein shows 100% identity (693 of 693 amino acids) with the 693 aa human KIAA 1061 protein fragment (ACC:BAA83013). AC012614_1.0.123 protein is similar to cell adhesion molecules; to murine, rat, Xenopus and human follistatin-related protein precursor (TGF-beta-inducible protein TSC-36, a protein of about 300 residues in the various species); and to short segments of Drosophila roundabout and fi-azzled. These genes are involved in neuronal development and reproductive physiology. By analogy, AC012614_1.0.123 proteins and polypeptides may also be involved in neuronal development and reproductive physiology.

Frazzled encodes & Drosophila member ofthe DCC immunoglobulin subfamily and is required for CNS and motor axon guidance. Cell 87: 197-204(1996). Characterization of a rat C6 glioma-secreted follistatin-related protein (FRP) and cloning and sequence ofthe human homologue is described in Eur. J. Biochem. 225:937- 946(1994). This protein may modulate the action of some growth factors on cell proliferation and differentiation. FRP binds heparin. The follistatin-related protein is a secreted protein and has one follistatin-like domain. The cloning and early dorsal axial expression of Flik, a chick follistatin-related gene and evidence for involvement in dorsalization/neural induction is described in Dev. Biol. 178:327-342(1996). Roundabout controls axon crossing ofthe CNS midline and defines a novel subfamily of evolutionarily conserved guidance receptors, as shown in Cell 92:205-21.5(1998). cDNA cloning and structural analysis ofthe human limbic-system- associated membrane protein (LAMP) is described in Gene 170:189-195(1996). LAMP, a protein ofthe OBCAM family that contains three immunoglobulin-like C2-type domains, mediates selective neuronal growth and axon targeting. LAMP contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. This protein is essential for normal growth ofthe hippocampal mossy fiber projection. LAMP is attached to the membrane by a GPI-Anchor. It is expressed on limbic neurons and fiber tracts as well as in single layers of the superior colliculus, spinal chord and cerebellum. Characterization ofthe human full- length PTK7 cDNA encoding a receptor protein tyrosine kinase-like molecule closely related to chick KLG is disclosed in J. Biochem. 1 19:235-239(1996). Based upon homology, AC012614_1.0.012 proteins and each homologous protein or peptide may share at least some activity.

The region to which AC012614_1.0.123 maps is listed in the National Center for Biotechnology Information website for the Online Mendelian Inheritance in Man (OMIM™) gene map (URL: "") to be associated with susceptibility to the following diseases (where available, OMIM™ identifying numbers are underlined): allergy and asthma; hemangioma; capillary infantile Schistosoma mansoni infection; susceptibility/resistance to Spinocerebellar ataxia; bronchial asthma; Plasmodium falciparum parasitemia; intensity of Corneal dystrophy, Groenouw type I (OMIM™ 121900); corneal dystrophy, lattice type I (OMIM™ 122200); Reis-Bucklers corneal dystrophy; corneal dystrophy, Avellino type eosinophilia, familial myelodysplastic syndrome; myelogenous leukemia, acute Cutis laxa, recessive, type I; deafness, autosomal dominant non-syndromic sensorineural; 1 contractural arachnodactyly; congenital neonatal alloimmune thrombocytopenia; glycoprotein la deficiency male infertility; Charcot-Marie- Tooth neuropathy, demyelinating Gardner syndrome; adenomatous polyposis coli; colorectal cancer; desmoid disease, hereditary (OMIM™ 135290); Turcot syndrome (OMIM™ 276300); and adenomatous polyposis coli, attenuated. By analogy, clone AC012614_1.0.123 is implicated in at least all ofthe above mentioned diseases and may have therapeutic uses for these diseases.

Clone AC012614_1.0.123 has similarity to cell adhesion molecules, follistatin, roundabout and frazzled. These genes are involved in neuronal development and reproductive physiology. Therefore Clone AC012614_1.0.123 is also implicated in disorders such as or therapeutic uses for nerve trauma, neurodegenerative disorders, epilepsy, mental health conditions, tissue regeneration in vivo and in vitro, and female reproductive system disorders and pregnancy. Clone AC012614_1.0.123 proteins include the full length protein encoded by the

ORF disclosed herein, as well as any mature protein arising therefrom. Such a mature protein could be formed, for example, as a result ofthe removal of a signal peptide. Clone AC012614_1.0.123 also includes all fragments, analogs, homologs and derivatives of Clone AC012614_1.0.123. Thus the invention encompass both the precursors and the active forms of a protein encoded by clone AC012614_1.0.123.

MOL18 or 4339264-2

Clone 4339264-2 includes a polynucleotide having 1208 bp (SEQ ID NO: 153), shown in Table AAJ. This clone was isolated from lymph node, and is also found in MCF-

7, OVCAR-3, heart, prostate, uterus, mammary gland, salivary gland, thalamus, bone marrow, lymph node, spleen, fetal liver, fetal thymus - CRL7046, brain, fetal brain, liver, fetal liver, skeletal muscle, pancreas, kidney, heart, lung and placenta. Clone 4339264-2 includes an ORF encoding a polypeptide of 322 amino acid residues (SEQ ID NO: 154), shown in Table AAJ. The initiation codon is found at nucleotides 124-126 and the stop codon is at nucleotides 1090-1092. The PSORT program predicts that the protein localizes to the mitochondrial inner membrane with a certainty of 0.7515, or to the plasma membrane with a certainty of 0.6000. The SignalP program predicts that there may be a signal peptide, with the most likely cleavage site found between residues 59 and 60, represented by the dash between the amino acids VGA-WT (i.e., ValGlyAla-TrpThr). Table AAJ. Sequence of Clone 4339264-2.

Translated Protein - Nucleotide 124 to 1089























BLASTX and BLASTP searches show that the protein has an 84 residue fragment that is 100% identical to a the same fragment in a protein encoded by a human EST sequence (PCT Publication WO 9906552-A2, published 1 l-FEB-1999). An additional BLASTN search showed that clone 4339264-2 is similar to murine mRNA for myeloid associated differentiation protein (GenBank-ID:MMMYELUPR| acc:AJ001616, submitted 15-SEP-1997). This gene is described as being expressed in a stage specific fashion during myeloid differentiation but absent in lymphoid cells.

BLASTP searches identified additional similarities to a 296 aa mouse myeloid upregulated protein (GenBank ACC:035682), and a 153 aa human T-lymphocyte maturation-associated protein (GenBank ACC:P21 145).

Clone 4339264-2 proteins include the full length protein encoded by the ORF disclosed herein, as well as any mature protein arising therefrom. Such a mature protein could be formed, for example, as a result of the removal of a signal peptide. Clone 4339264-2 also includes all fragments, analogs, homologs and derivatives of Clone 4339264-2. Thus the proteins ofthe invention encompass both the precursors and the active forms of 4339264-2, including, for example, a myeloid associated differentiation- like Clone 4339264-2 protein. MOL19 or 4357764-3 Clone 4357764-3 includes a polynucleotide of 1203 bp (SEQ ID NO: 155), shown in Table AAK. This clone was isolated from lymph node. The clone includes an ORF encoding a polypeptide of 142 amino acid residues (SEQ ID NO: 156), shown in Table AAK. The ORF begins with an initiation codon at nucleotides 587-589 of SEQ ID NO: 155 and ends with a stop codon at nucleotides 1013-1015. The PSORT program predicts that the protein is localized extracellularly with a certainty of 0.8200. SignalP predicts that there is a signal peptide present, with the most likely cleavage site found between residues 21 and 22, represented by the dash between the amino acids TRS-SE (i.e., ThrArgSer- SerGlu).

Table AAK .

A. Sequence of Clone 4357764-3. Translated Protein - Nucleotide 587 to 1012





















BLASTX analysis showed that, over 135 residues, the polypeptide encoded by clone 4357764-3 is 97% identical and 98% positive with the 301 residue protein encoded by human "200 gene" that is reported to be differentially expressed in T helper cells (U.S. Patent 5,721,351; PCT Publication WO 9627603-AI, published 12-SEP-1996). The 200 gene protein is reported to be a novel cell surface receptor ofthe Ig superfamily class. Expression of 200 gene is many-fold higher in TH1 than in TH2 subpopulations (WO9627603-A1). Modulation ofthe 200 gene product may ameliorate a range of T-cell- related disorders. BLASTP searches also show a moderate degree of similarity to kidney injury molecule- 1 ofthe rat (GenBank acc:054947) and to human hepatitis A virus cellular receptor 1 (GenBank acc:043656).

Clone 4357764-3 proteins include the full length protein encoded by the ORF disclosed herein, as well as any mature protein arising therefrom. Such a mature protein could be formed, for example, as a result ofthe removal of a signal peptide. Clone 4357764-3 also includes all fragments, analogs, homologs and derivatives of Clone 4357764-3. Thus the proteins ofthe invention encompass both the precursors and the active forms of a protein encoded by clone 4339264-3.

Other variants are shown below in Tables ABR and ABS. (4339264-3 is also known as CG52676-02.)

Table ABR

Polypeptide and Polynucleotide Sequence of Clone 191998702

Polynucleotide (SEQ ID NO: 157) Polypeptide (SEQ ID NO: 158)

DNA Sequence Analysis of 191998702

Translated Protein - Frame 1 - Nycleofide 1 to 375

Printed 80 characters to a line






V N Y Y w


241 V T A D S G I Y C C Q I


Table ABS

Alignment of Polypeptide Sequence of Clone 191998702 (SEQ ID

NO: 158) with Polypeptide Sequence of CG52676-02 (SEQ ID


Figure imgf000150_0001



191998702 ] 02 KF N LK LV I K PGEWT FAC HLYE L

CG52676-02 121 MJϋMVJiadttt l ϊTHilE'I: MOL20 or 4391184

Clone 4391184 is a polynucleotide of 825 bp (SEQ ID NO: 159), shown in Table AAL. This clone was isolated from lymph node tissue. Clone 4391184 contains an ORF encoding a protein of 92 amino acid residues (SEQ ID NO: 160), shown in Table AAL. The start codon is at nucleotides 494-496 and the stop codon is at nucleotides 770-772. The PSORT program predicts that the protein of clone 4391 184 localizes to the microbody (peroxisome) with a certainty of 0.5690. The SignalP software program predicts a low likelihood ofthe protein including a known signal peptide. Table AAL . Sequence of Clone 4391184 .

Translated Protein - Nucleotide 494 to 769
















BLASTP searching revealed a similarity of Clone 4391184 to a fragment of human superoxide dismutase (Cu, Zn) (GenBank ACC:Q16839). Clone 4391 184 proteins include the full length protein encoded by the ORF disclosed herein, as well as any mature protein arising therefrom. Such a mature protein could be formed, for example, as a result ofthe removal of a signal peptide. Clone 4391184 also includes all fragments, analogs, homologs and derivatives of Clone 4391 184. Thus the proteins ofthe invention encompass both the precursors and the active forms of a protein encoded by clone 4391184. MOL21 or 4437909.0.4

Clone 4437909.0.4 was originally identified by Applicant as clone 4437909 in US Provisional application Serial No. 60/128,514. Clone 4437909.0.4 includes a polynucleotide of 1099 bp (SEQ ID NO: 161), shown in Table AAM. This clone has been found in osteogenic sarcoma cell lines - HTB96, adrenal gland, thalamus, fetal brain and fetal lung. Clone 4437909.0.4 includes an ORF encoding a polypeptide of 269 amino acid residues (SEQ ID NO: 162), shown in Table AAM. The initiation codon for this polypeptide occurs at nucleotides 83-85 of SEQ ID NO: 161 and the termination codon is at nucleotides 890-892. The PSORT program predicts that the 4437909.0.4 protein is localized in the microbody (peroxisome) with a certainty of 0.7480. The SignalP program predicts that there is no known signal peptide.

Table AAM. Sequence of Clone 4437909.0.4 Translated Protein -Nucleotide 83 to 889





















BLASTP and BLASTX searching showed that the 4437909.0.4 polypeptide has a

55% identity and a 70% similarity to the 255 residue human microfibril-associated glycoprotein 4 (ACC:P55083 and US Patent No. 5972654-A, issued 26-OCT-1999). The human microfibril-associated glycoprotein 4 splice variant (MAG4V) polypeptides and/or antibodies thereto are disclosed in this patent as being usable to down regulate MAG4V expression and activity. By analogy, Clone 4437909.0.4 polypeptides as well as MAG4V proteins may be used to treat reproductive disorders (e.g. disruptions o the estrous cycle and spermatogenesis, polycystic ovary syndrome and cancers ofthe prostate and ovaries), muscular disorders (e.g. Duchenne's muscular dystrophy, lipid myopathy and myocarditis), immunological disorders (e.g. Addison's disease, asthma, anemia and acquired immune deficiency syndrome (AIDS)) and neoplastic disorders (e.g. myeloma, sarcoma, leukemia and lung cancer).

BLASTX searching further showed that the 4437909.0.4 protein is 48% identical and 61%) positive with the 313 residue human 35 kDa opsonin protein P35 (JP08038182- A, published 13-FEB-1996). P35 protein has opsonin activity useful in prevention and treatment of infectious diseases. Opsonin activates the phagocytosis of pathogenic microbes by phagocytic cells, useful in the prevention and treatment of infectious diseases. By analogy, Clone 4437909.0.4 may also be utilized in the prevention and treatment of infectious diseases. Additionally the 4437909.0.4 protein, over 221 residues, is also 52% identical and 63% similar to the 324 residue porcine TGF-beta- 1 binding protein (W09222319-A), and Clone 4437909.0.4 protein may additionally have TGF-beta-1 binding activity.

Clone 4437909.0.4 proteins include the full length protein encoded by the 4437909.0.4 ORF disclosed herein, as well as any mature protein arising therefrom. Such a mature protein could be formed, for example, as a result of he removal of a signal peptide. Clone 4437909.0.4 also includes all fragments, analogs, homologs and derivatives of Clone 4437909.0.4. Thus the proteins ofthe invention encompass both the precursors and the active forms of a protein encoded by clone 4437909.0.4. Clone 4437909.0.4 activities may include those activities possessed by MAG4V protein or opsonin P35 protein. MOL22 or 4437909.0.55

Clone 4437909.0.55 is a variant of clone 4437909.0.4, and has a shorter 5' UTR and two base changes in the coding sequence.

Clone 4437909.0.55 has 1054 bp (SEQ ID NO: 163), shown in Table AAN. This clone has been found in osteogenic sarcoma cell lines - HTB96, adrenal gland, thalamus, fetal brain and fetal lung. This clone includes an ORF beginning at nucleotides 38-40 and terminating at nucleotides 845-847, encoding a polypeptide of 269 amino acid residues (SEQ ID NO: 164), shown in Table AAN. The mutations in the open reading frame lead to two mutated amino acid residues. The properties and physiological activities of clone 4437909.0.55 are essentially the same as those summarized above for clone 4437909.0.4 Table AAN. Sequence of Clone 4437909 . 0 . 55

Translated Protein - Frame: 2 - Nucleotide 38 to 844 1


MetAlaHi 46


























Clone 4437909.0.55 proteins include the full length protein encoded by the 4437909.0.55 ORF disclosed herein, as well as any mature protein arising therefrom. Such a mature protein could be formed, for example, as a result ofthe removal of a signal peptide. Clone 4437909.0.55 also includes all fragments, analogs, homologs and derivatives of Clone 4437909.0.55. Thus the proteins ofthe invention encompass both the precursors and the active forms of a protein encoded by clone 4437909.0.55. Clone 4437909.0.55 activities may include those activities possessed by MAG4V protein or opsonin P35 protein. The construct is called TA-4437909-S443. The coding sequence in clone TA-

4437909-S443 differs by one bp from that given for clone 4437909.0.4 (Table AAR; SEQ ID NO:165). The sequence of clone TA-4437909-S443 (SEQ ID NO: 165) is shown in Table AAR, and the variant base is underlined. The base change, however, is silent and does not change the polypeptide sequence (SEQ ID NO: 164) predicted for clone 4437909.0.4. Table AAR . Sequence of Clone TA-4437909-S443


MOL23 or CG52703-03

Clone CG52703-03 has 1037 bp, and the polynucleotide (SEQ ID NO: 166) and polypeptide (SEQ ID NO: 167) are given at Tables ACA and ACB. The polynucleotide sequence encodes a microfibril-associated glycoprotein-like protein. An open reading frame was identified beginning at nucleotides 46-48 and ending at nucleotides 853-855. The encoded polypeptide has 269 amino acid residues, and is presented in FIG. 26 using the one letter codes. CG52703-03 has greater than 65% nucleic acid identity to human microfibril associated glucoprotein 4, and has greater than 55% identity to the same protein. The polypeptide displays at least one fibrinogen beta and gamma chains C- terminal globular domain, and thus has properties similar to those of other proteins known to contain these domains. The nucleic acid maps to chromosome 9. Expression ofthe gene has been detected in at least the following tissues: adrenal/supraadrenal gland, salivary gland, liver, bone marrow, lymphoid tissue, hippocampus, lung, thalamus, amygdala, placenta and hair follicles. The polypeptide is localized to peroxisomal bodies and is also secreted. The protein has structural and physiological functions similar to those ofthe microfibril associated glycoprotein family. Clone CG52703-03 activities include those activities possessed by microfibril associated glycoprotein families, and accordingly, is useful in serving as a diagnostic or prognostic marker for the diseases indicated herein. Potential therapeutic applications include protein therapeutics, small molecule targets, antibody targets, nucleic acids useful in gene therapy, and the like. Table ACA CG52703-03
















Table ACB






Clone CG52703-03 proteins include the full length protein encoded by the CG52703-03 ORF disclosed herein, as well as any mature protein arising therefrom. Such a mature protein could be formed, for example, as a result ofthe removal of a signal peptide. Clone CG52703-03 also includes all fragments, analogs, homologs and derivatives of Clone CG52703-03. Thus the proteins ofthe invention encompass both the precursors and the active forms of a protein encoded by clone CG52703-03.

Figure imgf000159_0001
Figure imgf000160_0001

MOLX Nucleic Acids and Polypeptides

One aspect of he invention pertains to isolated nucleic acid molecules that encode MOLX polypeptides or biologically active portions thereof. Also included in the invention are nucleic acid fragments sufficient for use as hybridization probes to identify MOLX-encoding nucleic acids (e.g., MOLX mRNAs) and fragments for use as PCR primers for the amplification and/or mutation of MOLX nucleic acid molecules. As used herein, the term "nucleic acid molecule" is intended to include DNA molecules (e.g., cDNA or genomic DNA), RNA molecules (e.g., mRNA), analogs ofthe DNA or RNA generated using nucleotide analogs, and derivatives, fragments and homologs thereof. The nucleic acid molecule may be single-stranded or double-stranded, but preferably is comprised double-stranded DNA.

An MOLX nucleic acid can encode a mature MOLX polypeptide. As used herein, a "mature" form of a polypeptide or protein disclosed in the present invention is the product of a naturally occurring polypeptide or precursor form or proprotein. The naturally occurring polypeptide, precursor or proprotein includes, by way of nonlimiting example, the full-length gene product, encoded by the corresponding gene. Alternatively, it may be defined as the polypeptide, precursor or proprotein encoded by an ORF described herein. The product "mature" form arises, again by way of nonlimiting example, as a result of one or more naturally occurring processing steps as they may take place within the cell, or host cell, in which the gene product arises. Examples of such processing steps leading to a "mature" form of a polypeptide or protein include the cleavage ofthe N-terminal methionine residue encoded by the initiation codon of an ORF, or the proteolytic cleavage of a signal peptide or leader sequence. Thus a mature form arising from a precursor polypeptide or protein that has residues 1 to N, where residue 1 is the N-terminal methionine, would have residues 2 through N remaining after removal of the N-terminal methionine. Alternatively, a mature form arising from a precursor polypeptide or protein having residues 1 to N, in which an N-terminal signal sequence from residue 1 to residue M is cleaved, would have the residues from residue M+l to residue N remaining. Further as used herein, a "mature" form of a polypeptide or protein may arise from a step of post-translational modification other than a proteolytic cleavage event. Such additional processes include, by way of non-limiting example, glycosylation, myristoylation or phosphorylation. In general, a mature polypeptide or protein may result from the operation of only one of these processes, or a combination of any of them.

The term "probes", as utilized herein, refers to nucleic acid sequences of variable length, preferably between at least about 10 nucleotides (nt), 100 nt, or as many as approximately, e.g., 6,000 nt, depending upon the specific use. Probes are used in the detection of identical, similar, or complementary nucleic acid sequences. Longer length probes are generally obtained from a natural or recombinant source, are highly specific, and much slower to hybridize than shorter-length oligomer probes. Probes may be single- or double-stranded and designed to have specificity in PCR, membrane-based hybridization technologies, or ELISA-like technologies.

The term "isolated" nucleic acid molecule, as utilized herein, is one, which is separated from other nucleic acid molecules which are present in the natural source ofthe nucleic acid. Preferably, an "isolated" nucleic acid is free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5'- and 3'-termini ofthe nucleic acid) in the genomic DNA ofthe organism from which the nucleic acid is derived. For example, in various embodiments, the isolated MOLX nucleic acid molecules can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb or 0.1 kb of nucleotide sequences which naturally flank the nucleic acid molecule in genomic DNA ofthe cell/tissue from which the nucleic acid is derived (e.g., brain, heart, liver, spleen, etc.). Moreover, an "isolated" nucleic acid molecule, such as a cDNA molecule, can be substantially free of other cellular material or culture medium when produced by recombinant techniques, or of chemical precursors or other chemicals when chemically synthesized.

A nucleic acid molecule ofthe invention, e.g., a nucleic acid molecule having the nucleotide sequence of SEQ ID NOS: 1, 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151 , 153, 155, 157, 159, 161, 163, 165, and 166, or a complement of this aforementioned nucleotide sequence, can be isolated using standard molecular biology techniques and the sequence information provided herein. Using all or a portion ofthe nucleic acid sequence of SEQ ID NOS: l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21 , 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 119, 121 , 124, 135, 137, 139, 141 , 143, 145, 147, 149, 151, 153, 155, 157, 159, 161 , 163, 165, and 166 as a hybridization probe, MOLX molecules can be isolated using standard hybridization and cloning techniques (e.g., as described in Sambrook, et al, (eds.), MOLECULAR CLONING: A LABORATORY MANUAL 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989; and Ausubel, et al, (eds.), CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, NY, 1993.)

A nucleic acid ofthe invention can be amplified using cDNA, mRNA or alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to standard PCR amplification techniques. The nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis. Furthermore, oligonucleotides corresponding to MOLX nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an automated DNA synthesizer. As used herein, the term "oligonucleotide" refers to a series of linked nucleotide residues, which oligonucleotide has a sufficient number of nucleotide bases to be used in a PCR reaction. A short oligonucleotide sequence may be based on, or designed from, a genomic or cDNA sequence and is used to amplify, confirm, or reveal the presence of an identical, similar or complementary DNA or RNA in a particular cell or tissue. Oligonucleotides comprise portions of a nucleic acid sequence having about 10 nt, 50 nt, or 100 nt in length, preferably about 15 nt to 30 nt in length. In one embodiment ofthe invention, an oligonucleotide comprising a nucleic acid molecule less than 100 nt in length would further comprise at least 6 contiguous nucleotides of SEQ ID NOS:l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 115, 1 17, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166, or a complement thereof. Oligonucleotides may be chemically synthesized and may also be used as probes.

In another embodiment, an isolated nucleic acid molecule ofthe invention comprises a nucleic acid molecule that is a complement ofthe nucleotide sequence shown in SEQ ID NOS: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101 , 103, 105, 107, 109, 112, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166, or a portion of this nucleotide sequence (e.g., a fragment that can be used as a probe or primer or a fragment encoding a biologically-active portion of an MOLX polypeptide). A nucleic acid molecule that is complementary to the nucleotide sequence shown in SEQ ID NOS: 1, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 115, 117, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153,

155, 157, 159, 161, 163, 165, and 166 is one that is sufficiently complementary to the nucleotide sequence shown in SEQ ID NOS: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101,

103, 105, 107, 109, 112, 115, 117, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149,

151, 153, 155, 157, 159, 161, 163, 165, and 166 that it can hydrogen bond with little or no mismatches to the nucleotide sequence shown SEQ ID NOS:l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166, thereby forming a stable duplex. As used herein, the term "complementary" refers to Watson-Crick or Hoogsteen base pairing between nucleotides units of a nucleic acid molecule, and the term "binding" means the physical or chemical interaction between two polypeptides or compounds or associated polypeptides or compounds or combinations thereof. Binding includes ionic, non-ionic, van der Waals, hydrophobic interactions, and the like. A physical interaction can be either direct or indirect. Indirect interactions may be through or due to the effects of another polypeptide or compound. Direct binding refers to interactions that do not take place through, or due to, the effect of another polypeptide or compound, but instead are without other substantial chemical intermediates.

Fragments provided herein are defined as sequences of at least 6 (contiguous) nucleic acids or at least 4 (contiguous) amino acids, a length sufficient to allow for specific hybridization in the case of nucleic acids or for specific recognition of an epitope in the case of amino acids, respectively, and are at most some portion less than a full length sequence. Fragments may be derived from any contiguous portion of a nucleic acid or amino acid sequence of choice. Derivatives are nucleic acid sequences or amino acid sequences formed from the native compounds either directly or by modification or partial substitution. Analogs are nucleic acid sequences or amino acid sequences that have a structure similar to, but not identical to, the native compound but differs from it in respect to certain components or side chains. Analogs may be synthetic or from a different evolutionary origin and may have a similar or opposite metabolic activity compared to wild type. Homologs are nucleic acid sequences or amino acid sequences of a particular gene that are derived from different species.

Derivatives and analogs may be full length or other than full length, if the derivative or analog contains a modified nucleic acid or amino acid, as described below. Derivatives or analogs ofthe nucleic acids or proteins ofthe invention include, but are not limited to, molecules comprising regions that are substantially homologous to the nucleic acids or proteins ofthe invention, in various embodiments, by at least about 70%, 80%, or

95%o identity (with a preferred identity of 80-95%) over a nucleic acid or amino acid sequence of identical size or when compared to an aligned sequence in which the alignment is done by a computer homology program known in the art, or whose encoding nucleic acid is capable of hybridizing to the complement of a sequence encoding the aforementioned proteins under stringent, moderately stringent, or low stringent conditions. See e.g. Ausubel, et al, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, NY, 1993, and below. A "homologous nucleic acid sequence" or "homologous amino acid sequence," or variations thereof, refer to sequences characterized by a homology at the nucleotide level or amino acid level as discussed above. Homologous nucleotide sequences encode those sequences coding for isoforms of MOLX polypeptides. Isoforms can be expressed in different tissues ofthe same organism as a result of, for example, alternative splicing of RNA. Alternatively, isoforms can be encoded by different genes. In the invention, homologous nucleotide sequences include nucleotide sequences encoding for an MOLX polypeptide of species other than humans, including, but not limited to: vertebrates, and thus can include, e.g., frog, mouse, rat, rabbit, dog, cat cow, horse, and other organisms. Homologous nucleotide sequences also include, but are not limited to, naturally occurring allelic variations and mutations ofthe nucleotide sequences set forth herein. A homologous nucleotide sequence does not, however, include the exact nucleotide sequence encoding human MOLX protein. Homologous nucleic acid sequences include those nucleic acid sequences that encode conservative amino acid substitutions (see below) in SEQ ID NOS: 1, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 115, 1 17, 119, 121 , 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166, as well as a polypeptide possessing MOLX biological activity. Various biological activities ofthe MOLX proteins are described below.

An MOLX polypeptide is encoded by the open reading frame ("ORF") of an MOLX nucleic acid. An ORF corresponds to a nucleotide sequence that could potentially be translated into a polypeptide. A stretch of nucleic acids comprising an ORF is uninterrupted by a stop codon. An ORF that represents the coding sequence for a full protein begins with an ATG "start" codon and terminates with one ofthe three "stop" codons, namely, TAA, TAG, or TGA. For the purposes of this invention, an ORF may be any part of a coding sequence, with or without a start codon, a stop codon, or both. For an ORF to be considered as a good candidate for coding for a bonafide cellular protein, a minimum size requirement is often set, e.g., a stretch of DNA that would encode a protein of 50 amino acids or more.

The nucleotide sequences determined from the cloning ofthe human MOLX genes allows for the generation of probes and primers designed for use in identifying and/or cloning MOLX homologues in other cell types, e.g. from other tissues, as well as MOLX homologues from other vertebrates. The probe/primer typically comprises substantially purified oligonucleotide. The oligonucleotide typically comprises a region of nucleotide sequence that hybridizes under stringent conditions to at least about 12, 25, 50, 100, 150, 200, 250, 300, 350 or 400 consecutive sense strand nucleotide sequence of SEQ ID

NOS: l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 1 15, 117, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151 , 153, 155, 157, 159, 161, 163, 165, and 166; or an anti-sense strand nucleotide sequence of SEQ ID NOST, 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 115, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166; or of a naturally occurring mutant of SEQ ID NOS: l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 115, 117, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166.

Probes based on the human MOLX nucleotide sequences can be used to detect transcripts or genomic sequences encoding the same or homologous proteins. In various embodiments, the probe further comprises a label group attached thereto, e.g. the label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used as a part of a diagnostic test kit for identifying cells or tissues which mis-express an MOLX protein, such as by measuring a level of an MOLX-encoding nucleic acid in a sample of cells from a subject e.g., detecting MOLX mRNA levels or determining whether a genomic MOLX gene has been mutated or deleted.

"A polypeptide having a biologically-active portion of an MOLX polypeptide" refers to polypeptides exhibiting activity similar, but not necessarily identical to, an activity of a polypeptide ofthe invention, including mature forms, as measured in a particular biological assay, with or without dose dependency. A nucleic acid fragment encoding a "biologically-active portion of MOLX" can be prepared by isolating a portion SEQ ID NOS: l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 1 15, 1 17, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166 that encodes a polypeptide having an MOLX biological activity (the biological activities ofthe MOLX proteins are described below), expressing the encoded portion of MOLX protein (e.g., by recombinant expression in vitro) and assessing the activity ofthe encoded portion of MOLX. MOLX Nucleic Acid and Polypeptide Variants

The invention further encompasses nucleic acid molecules that differ from the nucleotide sequences shown SEQ ID NOS: l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166 due to degeneracy ofthe genetic code and thus encode the same MOLX proteins as that encoded by the nucleotide sequences shown in SEQ ID NOS: 1, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 1 15, 117, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166. In another embodiment, an isolated nucleic acid molecule of the invention has a nucleotide sequence encoding a protein having an amino acid sequence shown in SEQ ID NOS:2, A, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1, 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167.

In addition to the human MOLX nucleotide sequences shown in SEQ ID NOS: 1, 3, 5, 7, 9, 11 , 13, 15, 17, 19, 21 , 23, 101, 103, 105, 107, 109, 1 12, 115, 1 17, 119, 121 , 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166 it will be appreciated by those skilled in the art that DNA sequence polymorphisms that lead to changes in the amino acid sequences ofthe MOLX polypeptides may exist within a population (e.g., the human population). Such genetic polymorphism in the MOLX genes may exist among individuals within a population due to natural allelic variation. As used herein, the terms "gene" and "recombinant gene" refer to nucleic acid molecules comprising an open reading frame (ORF) encoding an MOLX protein, preferably a vertebrate MOLX protein. Such natural allelic variations can typically result in 1-5% variance in the nucleotide sequence ofthe MOLX genes. Any and all such nucleotide variations and resulting amino acid polymorphisms in the MOLX polypeptides, which are the result of natural allelic variation and that do not alter the functional activity of the MOLX polypeptides, are intended to be within the scope ofthe invention.

Moreover, nucleic acid molecules encoding MOLX proteins from other species, and thus that have a nucleotide sequence that differs from the human sequence SEQ ID NOS: l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 115, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166 are intended to be within the scope ofthe invention. Nucleic acid molecules corresponding to natural allelic variants and homologues ofthe MOLX cDNAs ofthe invention can be isolated based on their homology to the human MOLX nucleic acids disclosed herein using the human cDNAs, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions. Accordingly, in another embodiment, an isolated nucleic acid molecule ofthe invention is at least 6 nucleotides in length and hybridizes under stringent conditions to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NOS:l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166. In another embodiment, the nucleic acid is at least 10, 25, 50, 100, 250, 500, 750, 1000, 1500, or 2000 or more nucleotides in length. In yet another embodiment, an isolated nucleic acid molecule ofthe invention hybridizes to the coding region. As used herein, the term "hybridizes under stringent conditions" is intended to describe conditions for hybridization and washing under which nucleotide sequences at least 60% homologous to each other typically remain hybridized to each other. Homologs (i.e., nucleic acids encoding MOLX proteins derived from species other than human) or other related sequences (e.g., paralogs) can be obtained by low, moderate or high stringency hybridization with all or a portion ofthe particular human sequence as a probe using methods well known in the art for nucleic acid hybridization and cloning.

As used herein, the phrase "stringent hybridization conditions" refers to conditions under which a probe, primer or oligonucleotide will hybridize to its target sequence, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures than shorter sequences. Generally, stringent conditions are selected to be about 5 °C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength, pH and nucleic acid concentration) at which 50% ofthe probes complementary to the target sequence hybridize to the target sequence at equilibrium. Since the target sequences are generally present at excess, at Tm, 50% ofthe probes are occupied at equilibrium. Typically, stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes, primers or oligonucleotides (e.g., 10 nt to 50 nt) and at least about 60°C for longer probes, primers and oligonucleotides. Stringent conditions may also be achieved with the addition of destabilizing agents, such as formamide. Stringent conditions are known to those skilled in the art and can be found in Ausubel, et al, (eds.), CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, N.Y. ( 1989), 6.3.1-6.3.6. Preferably, the conditions are such that sequences at least about 65%, 70%, 75%, 85%, 90%, 95%, 98%, or 99% homologous to each other typically remain hybridized to each other. A non-limiting example of stringent hybridization conditions are hybridization in a high salt buffer comprising 6X SSC, 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 mg/ml denatured salmon sperm DNA at 65°C, followed by one or more washes in 0.2X SSC,.0.01% BSA at 50°C. An isolated nucleic acid molecule ofthe invention that hybridizes under stringent conditions to the sequences of SEQ ID NOS: 1 , 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166 corresponds to a naturally-occurring nucleic acid molecule. As used herein, a "naturally-occurring" nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g., encodes a natural protein).

In a second embodiment, a nucleic acid sequence that is hybridizable to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NOS: l, 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21 , 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166 or fragments, analogs or derivatives thereof, under conditions of moderate stringency is provided. A non-limiting example of moderate stringency hybridization conditions are hybridization in 6X SSC, 5X Denhardt's solution, 0.5% SDS and 100 mg/ml denatured salmon sperm DNA at 55°C, followed by one or more washes in IX SSC, 0.1 % SDS at 37°C. Other conditions of moderate stringency that may be used are well-known within the art. See, e.g., Ausubel, et al. (eds.), 1993, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, NY, and Kriegler, 1990; GENE TRANSFER AND EXPRESSION, A LABORATORY MANUAL, Stockton Press, NY.

In a third embodiment, a nucleic acid that is hybridizable to the nucleic acid molecule comprising the nucleotide sequences of SEQ ID NOS: l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 115, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143,

145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166 or fragments, analogs or derivatives thereof, under conditions of low stringency, is provided. A non-limiting example of low stringency hybridization conditions are hybridization in 35% formamide,

5X SSC, 50 mM Tris-HCl (pH 7.5), 5 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.2% BSA, 100 mg/ml denatured salmon sperm DNA, 10% (wt/vol) dextran sulfate at 40°C, followed by one or more washes in 2X SSC, 25 mM Tris-HCl (pH 7.4), 5 mM EDTA, and 0.1% SDS at 50°C. Other conditions of low stringency that may be used are well known in the art (e.g., as employed for cross-species hybridizations). See, e.g., Ausubel, et al. (eds.), 1993, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, NY, and Kriegler, 1990, GENE TRANSFER AND EXPRESSION, A LABORATORY MANUAL, Stockton Press, NY; Shilo and Weinberg, 1981. Proc Natl Acad Sci USA 78: 6789-6792.

Conservative Mutations In addition to naturally-occurring allelic variants of MOLX sequences that may exist in the population, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequences of SEQ ID NOS: 1, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166 thereby leading to changes in the amino acid sequences ofthe encoded MOLX proteins, without altering the functional ability of said MOLX proteins. For example, nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues can be made in the sequence of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1 , 114, 1 16, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167. A "non-essential" amino acid residue is a residue that can be altered from the wild-type sequences ofthe MOLX proteins without altering their biological activity, whereas an "essential" amino acid residue is required for such biological activity. For example, amino acid residues that are conserved among the MOLX proteins ofthe invention are predicted to be particularly non-amenable to alteration. Amino acids for which conservative substitutions can be made are well-known within the art.

Another aspect ofthe invention pertains to nucleic acid molecules encoding MOLX proteins that contain changes in amino acid residues that are not essential for activity. Such MOLX proteins differ in amino acid sequence from SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 11 1, 1 14, 116, 118, 120, 123, 125, 136,

138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167 yet retain biological activity. In one embodiment, the isolated nucleic acid molecule comprises a nucleotide sequence encoding a protein, wherein the protein comprises an amino acid sequence at least about 45%> homologous to the amino acid sequences of SEQ ID NOS:2, 4,6,8, 10, 12, 14, 16, 18,20,22,24, 102, 104, 106, 108, 111, 114, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167. Preferably, the protein encoded by the nucleic acid molecule is at least about 60% homologous to SEQ IDNOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 111, 114, 116, 118, 120, 123, 125, 136,138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167; more preferably at least about 70% homologous to SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18,20,22,24, 102, 104, 106, 108, 111, 114, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167; still more preferably at least about 80% homologous to SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18,20,22,24, 102, 104, 106, 108, 111, 114, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167; even more preferably at least about 90% homologous to SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20,22,24, 102, 104, 106, 108, 111, 114, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167; and most preferably at least about 95% homologous to SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 111, 114, 116, 118, 120, 123,125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167.

An isolated nucleic acid molecule encoding an MOLX protein homologous to the protein of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18,20,22,24, 102, 104, 106, 108, 111, 114, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167 can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of SEQ ID NOS:l, 3, 5, 7, 9, 11, 13, 15, 17, 19,21,23, 101, 103, 105, 107, 109, 112, 115, 117, 119, 121, 124, 135, 137, 139, 141,143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166 such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein.

Mutations can be introduced into SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22,24, 102, 104, 106, 108, 111, 114, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167 by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions are made at one or more predicted, non-essential amino acid residues. A

"conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined within the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a predicted non-essential amino acid residue in the MOLX protein is replaced with another amino acid residue from the same side chain family. Alternatively, in another embodiment, mutations can be introduced randomly along all or part of an MOLX coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for MOLX biological activity to identify mutants that retain activity. Following mutagenesis of SEQ ID NOS: l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 115, 1 17, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166, the encoded protein can be expressed by any recombinant technology known in the art and the activity ofthe protein can be determ ined .

The relatedness of amino acid families may also be determined based on side chain interactions. Substituted amino acids may be fully conserved "strong" residues or fully conserved "weak" residues. The "strong" group of conserved amino acid residues may be any one ofthe following groups: STA, NEQK, NHQK, NDEQ, QHRK, MILV, MILF, HY, FYW, wherein the single letter amino acid codes are grouped by those amino acids that may be substituted for each other. Likewise, the "weak" group of conserved residues may be any one ofthe following: CSA, ATV, SAG, STNK, STPA, SGND, SNDEQK, NDEQHK, NEQHRK, VLIM, HFY, wherein the letters within each group represent the single letter amino acid code. In one embodiment, a mutant MOLX protein can be assayed for ( ) the ability to form protein: protein interactions with other MOLX proteins, other cell-surface proteins, or biologically-active portions thereof, (ii) complex formation between a mutant MOLX protein and an MOLX ligand; or (iii) the ability of a mutant MOLX protein to bind to an intracellular target protein or biologically-active portion thereof; (e.g. avidin proteins). In yet another embodiment, a mutant MOLX protein can be assayed for the ability to regulate a specific biological function (e.g., regulation of insulin release). Antisense Nucleic Acids

Another aspect ofthe invention pertains to isolated antisense nucleic acid molecules that are hybridizable to or complementary to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NOS: l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101 , 103, 105, 107, 109, 112, 1 15, 1 17, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166, or fragments, analogs or derivatives thereof. An "antisense" nucleic acid comprises a nucleotide sequence that is complementary to a "sense" nucleic acid encoding a protein (e.g., complementary to the coding strand of a double-stranded cDNA molecule or complementary to an mRNA sequence). In specific aspects, antisense nucleic acid molecules are provided that comprise a sequence complementary to at least about 10, 25, 50, 100, 250 or 500 nucleotides or an entire MOLX coding strand, or to only a portion thereof. Nucleic acid molecules encoding fragments, homologs, derivatives and analogs of an MOLX protein of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 11 1, 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, or antisense nucleic acids complementary to an MOLX nucleic acid sequence of SEQ ID NOS:l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141 , 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166, are additionally provided. In one embodiment, an antisense nucleic acid molecule is antisense to a "coding region" ofthe coding strand of a nucleotide sequence encoding an MOLX protein. The term "coding region" refers to the region ofthe nucleotide sequence comprising codons which are translated into amino acid residues. In another embodiment, the antisense nucleic acid molecule is antisense to a "noncoding region" ofthe coding strand of a nucleotide sequence encoding the MOLX protein. The term "noncoding region" refers to 5' and 3' sequences which flank the coding region that are not translated into amino acids (i.e., also referred to as 5' and 3' untranslated regions).

Given the coding strand sequences encoding the MOLX protein disclosed herein, antisense nucleic acids ofthe invention can be designed according to the rules of Watson and Crick or Hoogsteen base pairing. The antisense nucleic acid molecule can be complementary to the entire coding region of MOLX mRNA, but more preferably is an oligonucleotide that is antisense to only a portion ofthe coding or noncoding region of MOLX mRNA. For example, the antisense oligonucleotide can be complementary to the region surrounding the translation start site of MOLX mRNA. An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides in length. An antisense nucleic acid ofthe invention can be constructed using chemical synthesis or enzymatic ligation reactions using procedures known in the art. For example, an antisense nucleic acid (e.g., an antisense oligonucleotide) can be chemically synthesized using naturally-occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability ofthe duplex formed between the antisense and sense nucleic acids (e.g., phosphorothioate derivatives and acridine substituted nucleotides can be used). Examples of modified nucleotides that can be used to generate the antisense nucleic acid include: 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1 -methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine,

2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3-N-2-carboxypropyl) uracil, (acp3)w, and 2,6-diaminopurine. Alternatively, the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in the following subsection).

The antisense nucleic acid molecules ofthe invention are typically administered to a subject or generated in situ such that they hybridize with or bind to cellular mRNA and/or genomic DNA encoding an MOLX protein to thereby inhibit expression of the protein (e.g., by inhibiting transcription and/or translation). The hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid molecule that binds to DNA duplexes, through specific interactions in the major groove ofthe double helix. An example of a route of administration of antisense nucleic acid molecules ofthe invention includes direct injection at a tissue site. Alternatively, antisense nucleic acid molecules can be modified to target selected cells and then administered systemically. For example, for systemic administration, antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface (e.g., by linking the antisense nucleic acid molecules to peptides or antibodies that bind to cell surface receptors or antigens). The antisense nucleic acid molecules can also be delivered to cells using the vectors described herein. To achieve sufficient nucleic acid molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter are preferred.

In yet another embodiment, the antisense nucleic acid molecule ofthe invention is an α-anomeric nucleic acid molecule. An α-anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual β-units, the strands run parallel to each other. See, e.g., Gaultier, et al., 1987. Nucl. Acids Res. 15: 6625-6641. The antisense nucleic acid molecule can also comprise a

2'-o-methylribonucleotide (see, e.g., Inoue, et al. 1987. Nucl. Acids Res. 15: 6131-6148) or a chimeric RNA-DNA analogue (see, e.g., Inoue, et al, 1987. FEES Lett. 215: 327-330.

Ribozymes and PNA Moieties Nucleic acid modifications include, by way of non-limiting example, modified bases, and nucleic acids whose sugar phosphate backbones are modified or derivatized. These modifications are carried out at least in part to enhance the chemical stability ofthe modified nucleic acid, such that they may be used, for example, as antisense binding nucleic acids in therapeutic applications in a subject. In one embodiment, an antisense nucleic acid ofthe invention is a ribozyme.

Ribozymes are catalytic RNA molecules with ribonuclease activity that are capable of cleaving a single-stranded nucleic acid, such as an mRNA, to which they have a complementary region. Thus, ribozymes (e.g., hammerhead ribozymes as described in Haselhoff and Gerlach 1988. Nature 334: 585-591) can be used to catalytically cleave MOLX mRNA transcripts to thereby inhibit translation of MOLX mRNA. A ribozyme having specificity for an MOLX-encoding nucleic acid can be designed based upon the nucleotide sequence of an MOLX cDNA disclosed herein (i.e., SEQ ID NOS:l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 115, 117, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166). For example, a derivative of a Tetrahymena L-19 IVS RNA can be constructed in which the nucleotide sequence ofthe active site is complementary to the nucleotide sequence to be cleaved in an MOLX-encoding mRNA. See, e.g., U.S. Patent 4,987,071 to Cech, et al. and U.S. Patent 5,1 16,742 to Cech, et al. MOLX mRNA can also be used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules. See, e.g., Bartel et α/., (1993) Science 261 : 141 1-1418.

Alternatively, MOLX gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region ofthe MOLX nucleic acid (e.g., the MOLX promoter and/or enhancers) to form triple helical structures that prevent transcription of the MOLX gene in target cells. See, e.g., Helene, 1991. Anticancer Drug Des. 6: 569-84; Helene, et al. 1992. Ann. N.Y. Acad. Sci. 660: 27-36; Maher, 1992. Bioassays 14: 807-15.

In various embodiments, the MOLX nucleic acids can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g., the stability, hybridization, or solubility ofthe molecule. For example, the deoxyribose phosphate backbone ofthe nucleic acids can be modified to generate peptide nucleic acids. See, e.g., Hyrup, et al, 1996. Bioorg Med Chem 4: 5-23. As used herein, the terms "peptide nucleic acids" or "PNAs" refer to nucleic acid mimics (e.g., DNA mimics) in which the deoxyribose phosphate backbone is replaced by a pseudopeptide backbone and only the four natural nucleobases are retained. The neutral backbone of PNAs has been shown to allow for specific hybridization to DNA and RNA under conditions of low ionic strength. The synthesis of PNA oligomers can be performed using standard solid phase peptide synthesis protocols as described in Hyrup, et al, 1996. supra; Perry-O'Keefe, et al, 1996. Proc. Natl. Acad. Sci. USA 93: 14670-14675.

PNAs of MOLX can be used in therapeutic and diagnostic applications. For example, PNAs can be used as antisense or antigene agents for sequence-specific modulation of gene expression by, e.g., inducing transcription or translation arrest or inhibiting replication. PNAs of MOLX can also be used, for example, in the analysis of single base pair mutations in a gene (e.g., PNA directed PCR clamping; as artificial restriction enzymes when used in combination with other enzymes, e.g., Si nucleases (see, Hyrup, et al, 1996.suprd); or as probes or primers for DNA sequence and hybridization (see, Hyrup, et al, 1996, supra; Perry-O'Keefe, et al, 1996. supra). In another embodiment, PNAs of MOLX can be modified, e.g., to enhance their stability or cellular uptake, by attaching lipophilic or other helper groups to PNA, by the formation of PNA-DNA chimeras, or by the use of liposomes or other techniques of drug delivery known in the art. For example, PNA-DNA chimeras of MOLX can be generated that may combine the advantageous properties of PNA and DNA. Such chimeras allow DNA recognition enzymes (e.g., RNase FI and DNA polymerases) to interact with the DNA portion while the PNA portion would provide high binding affinity and specificity. PNA-DNA chimeras can be linked using linkers of appropriate lengths selected in terms of base stacking, number of bonds between the nucleobases, and orientation (see, Hyrup, et al., 1996. supra). The synthesis of PNA-DNA chimeras can be performed as described in Hyrup, et al, 1996. supra and Finn, et al, 1996. Nucl Acids Res 24: 3357-3363. For example, a DNA chain can be synthesized on a solid support using standard phosphoramidite coupling chemistry, and modified nucleoside analogs, e.g., 5'-(4-methoxytrityl)amino-5'-deoxy-thymidine phosphoramidite, can be used between the PNA and the 5' end of DNA. See, e.g., Mag, et al, 1989. Nucl Acid Res 17: 5973-5988. PNA monomers are then coupled in a stepwise manner to produce a chimeric molecule with a 5' PNA segment and a 3' DNA segment. See, e.g., Finn, et al, 1996. supra. Alternatively, chimeric molecules can be synthesized with a 5' DNA segment and a 3' PNA segment. See, e.g., Petersen, et al, 1975. Bioorg. Pled. Chem. Lett. 5: 1 1 19-1 1 124. In other embodiments, the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g., Letsinger, et al, 1989. Proc. Natl. Acad. Sci. U.S.A. 86: 6553-6556; Lemaitre, et al, 1987. Proc. Natl. Acad. Sci. 84: 648-652; PCT Publication No. WO88/09810) or the blood-brain barrier (see, e.g., PCT Publication No. WO 89/10134). In addition, oligonucleotides can be modified with hybridization triggered cleavage agents (see, e.g., Krol, et al, 1988. BioTechniques 6:958-976) or intercalating agents (see, e.g., Zon, 1988. Pharm. Res. 5: 539-549). To this end, the oligonucleotide may be conjugated to another molecule, e.g., a peptide, a hybridization triggered cross-linking agent, a transport agent, a hybridization-triggered cleavage agent, and the like.

MOLX Polypeptides

A polypeptide according to the invention includes a polypeptide including the amino acid sequence of MOLX polypeptides whose sequences are provided in SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 11 , 114, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167. The invention also includes a mutant or variant protein any of whose residues may be changed from the corresponding residues shown in SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 11 1, 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167 while still encoding a protein that maintains its MOLX activities and physiological functions, or a functional fragment thereof.

In general, an MOLX variant that preserves MOLX-like function includes any variant in which residues at a particular position in the sequence have been substituted by other amino acids, and further include the possibility of inserting an additional residue or residues between two residues ofthe parent protein as well as the possibility of deleting one or more residues from the parent sequence. Any amino acid substitution, insertion, or deletion is encompassed by the invention. In favorable circumstances, the substitution is a conservative substitution as defined above.

One aspect ofthe invention pertains to isolated MOLX proteins, and biologically- active portions thereof, or derivatives, fragments, analogs or homologs thereof. Also provided are polypeptide fragments suitable for use as immunogens to raise anti-MOLX antibodies. In one embodiment, native MOLX proteins can be isolated from cells or tissue sources by an appropriate purification scheme using standard protein purification techniques. In another embodiment, MOLX proteins are produced by recombinant DNA techniques. Alternative to recombinant expression, an MOLX protein or polypeptide can be synthesized chemically using standard peptide synthesis techniques.

An "isolated" or "purified" polypeptide or protein or biologically-active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the MOLX protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized. The language "substantially free of cellular material" includes preparations of MOLX proteins in which the protein is separated from cellular components ofthe cells from which it is isolated or recombinantly-produced. In one embodiment, the language "substantially free of cellular material" includes preparations of MOLX proteins having less than about 30% (by dry weight) of non-MOLX proteins (also referred to herein as a "contaminating protein"), more preferably less than about 20% of non-MOLX proteins, still more preferably less than about 10% of non-MOLX proteins, and most preferably less than about 5% of non-MOLX proteins. When the MOLX protein or biologically-active portion thereof is recombinantly-produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%, more preferably less than about 10%, and most preferably less than about 5% ofthe volume of the MOLX protein preparation. The language "substantially free of chemical precursors or other chemicals" includes preparations of MOLX proteins in which the protein is separated from chemical precursors or other chemicals that are involved in the synthesis ofthe protein. In one embodiment, the language "substantially free of chemical precursors or other chemicals" includes preparations of MOLX proteins having less than about 30% (by dry weight) of chemical precursors or non-MOLX chemicals, more preferably less than about 20% chemical precursors or non-MOLX chemicals, still more preferably less than about 10% chemical precursors or non-MOLX chemicals, and most preferably less than about 5% chemical precursors or non-MOLX chemicals.

Biologically-active portions of MOLX proteins include peptides comprising amino acid sequences sufficiently homologous to or derived from the amino acid sequences of the MOLX proteins (e.g., the amino acid sequence shown in SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 11 1, 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167) that include fewer amino acids than the full-length MOLX proteins, and exhibit at least one activity of an MOLX protein. Typically, biologically-active portions comprise a domain or motif with at least one activity ofthe MOLX protein. A biologically-active portion of an MOLX protein can be a polypeptide which is, for example, 10, 25, 50, 100 or more amino acid residues in length.

Moreover, other biologically-active portions, in which other regions ofthe protein are deleted, can be prepared by recombinant techniques and evaluated for one or more of the functional activities of a native MOLX protein.

In an embodiment, the MOLX protein has an amino acid sequence shown in SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1 , 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167. In other embodiments, the MOLX protein is substantially homologous to SEQ

ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 11 1 , 1 14, 1 16, 1 18,

120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, and retains the functional activity ofthe protein of SEQ ID NOS:2, 4, 6, 8, 10,

12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 11 1, 114, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, yet differs in amino acid sequence due to natural allelic variation or mutagenesis, as described in detail, below. Accordingly, in another embodiment, the MOLX protein is a protein that comprises an amino acid sequence at least about 45% homologous to the amino acid sequence SEQ ID NOS :2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1, 1 14, 1 16, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, and retains the functional activity ofthe MOLX proteins of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 11 , 1 14, 116, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167.

Determining Homology Between Two or More Sequences

To determine the percent homology of two amino acid sequences or of two nucleic acids, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are homologous at that position (i.e., as used herein amino acid or nucleic acid "homology" is equivalent to amino acid or nucleic acid "identity").

The nucleic acid sequence homology may be determined as the degree of identity between two sequences. The homology may be determined using computer programs known in the art, such as GAP software provided in the GCG program package. See, Needleman and Wunsch, 1970. J Mol Biol 48: 443-453. Using GCG GAP software with the following settings for nucleic acid sequence comparison: GAP creation penalty of 5.0 and GAP extension penalty of 0.3, the coding region ofthe analogous nucleic acid sequences referred to above exhibits a degree of identity preferably of at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99%, with the CDS (encoding) part of the DNA sequence shown in SEQ ID NOS: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109,

1 12, 115, 1 17, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157,

159, 161, 163, 165, and 166.

The term "sequence identity" refers to the degree to which two polynucleotide or polypeptide sequences are identical on a residue-by-residue basis over a particular region of comparison. The term "percentage of sequence identity" is calculated by comparing two optimally aligned sequences over that region of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I, in the case of nucleic acids) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the region of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. The term "substantial identity" as used herein denotes a characteristic of a polynucleotide sequence, wherein the polynucleotide comprises a sequence that has at least 80 percent sequence identity, preferably at least 85 percent identity and often 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison region.

Chimeric and Fusion Proteins

The invention also provides MOLX chimeric or fusion proteins. As used herein, an MOLX "chimeric protein" or "fusion protein" comprises an MOLX polypeptide operatively-linked to a non-MOLX polypeptide. An "MOLX polypeptide" refers to a polypeptide having an amino acid sequence corresponding to an MOLX protein (SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1 , 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167), whereas a "non-MOLX polypeptide" refers to a polypeptide having an amino acid sequence corresponding to a protein that is not substantially homologous to the MOLX protein, e.g., a protein that is different from the MOLX protein and that is derived from the same or a different organism. Within an MOLX fusion protein the MOLX polypeptide can correspond to all or a portion of an MOLX protein. In one embodiment, an MOLX fusion protein comprises at least one biologically-active portion of an MOLX protein. In another embodiment, an MOLX fusion protein comprises at least two biologically-active portions of an MOLX protein. In yet another embodiment, an MOLX fusion protein comprises at least three biologically-active portions of an MOLX protein. Within the fusion protein, the term "operatively-linked" is intended to indicate that the MOLX polypeptide and the non-MOLX polypeptide are fused in-frame with one another. The non-MOLX polypeptide can be fused to the N-terminus or C-terminus ofthe MOLX polypeptide.

In one embodiment, the fusion protein is a GST-MOLX fusion protein in which the

MOLX sequences are fused to the C-terminus ofthe GST (glutathione S-transferase) sequences. Such fusion proteins can facilitate the purification of recombinant MOLX polypeptides.

In another embodiment, the fusion protein is an MOLX protein containing a heterologous signal sequence at its N-terminus. In certain host cells (e.g., mammalian host cells), expression and/or secretion of MOLX can be increased through use of a heterologous signal sequence.

In yet another embodiment, the fusion protein is an MOLX-immunoglobulin fusion protein in which the MOLX sequences are fused to sequences derived from a member of the immunoglobulin protein family. The MOLX-immunoglobulin fusion proteins ofthe invention can be incorporated into pharmaceutical compositions and administered to a subject to inhibit an interaction between an MOLX ligand and an MOLX protein on the surface of a cell, to thereby suppress MOLX-mediated signal transduction in vivo. The MOLX-immunoglobulin fusion proteins can be used to affect the bioavailability of an MOLX cognate ligand. Inhibition ofthe MOLX ligand/MOLX interaction may be useful therapeutically for both the treatment of proliferative and differentiative disorders, as well as modulating (e.g. promoting or inhibiting) cell survival. Moreover, the MOLX-immunoglobulin fusion proteins ofthe invention can be used as immunogens to produce anti-MOLX antibodies in a subject, to purify MOLX ligands, and in screening assays to identify molecules that inhibit the interaction of MOLX with an MOLX ligand. An MOLX chimeric or fusion protein ofthe invention can be produced by standard recombinant DNA techniques. For example, DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, e.g., by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation. In another embodiment, the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers. Alternatively, PCR amplification of gene fragments can be carried out using anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed and reamplified to generate a chimeric gene sequence (see, e.g., Ausubel, et al (eds.)

CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, 1992). Moreover, many expression vectors are commercially available that already encode a fusion moiety

(e.g., a GST polypeptide). An MOLX-encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the MOLX protein. MOLX Agonists and Antagonists

The invention also pertains to variants ofthe MOLX proteins that function as either MOLX agonists (i.e., mimetics) or as MOLX antagonists. Variants ofthe MOLX protein can be generated by mutagenesis (e.g., discrete point mutation or truncation ofthe MOLX protein). An agonist ofthe MOLX protein can retain substantially the same, or a subset of, the biological activities ofthe naturally occurring form ofthe MOLX protein. An antagonist ofthe MOLX protein can inhibit one or more ofthe activities of the naturally occurring form ofthe MOLX protein by, for example, competitively binding to a downstream or upstream member of a cellular signaling cascade which includes the MOLX protein. Thus, specific biological effects can be elicited by treatment with a variant of limited function. In one embodiment, treatment of a subject with a variant having a subset ofthe biological activities ofthe naturally occurring form ofthe protein has fewer side effects in a subject relative to treatment with the naturally occurring form of the MOLX proteins.

Variants ofthe MOLX proteins that function as either MOLX agonists (i.e., mimetics) or as MOLX antagonists can be identified by screening combinatorial libraries of mutants (e.g., truncation mutants) ofthe MOLX proteins for MOLX protein agonist or antagonist activity. In one embodiment, a variegated library of MOLX variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library. A variegated library of MOLX variants can be produced by, for example, enzymatically ligating a mixture of synthetic oligonucleotides into gene sequences such that a degenerate set of potential MOLX sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of MOLX sequences therein. There are a variety of methods which can be used to produce libraries of potential MOLX variants from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be performed in an automatic DNA synthesizer, and the synthetic gene then ligated into an appropriate expression vector. Use of a degenerate set of genes allows for the provision, in one mixture, of all ofthe sequences encoding the desired set of potential MOLX sequences. Methods for synthesizing degenerate oligonucleotides are well-known within the art. See, e.g., Narang, 1983. Tetrahedron 39: 3; Itakura, et al, 1984. Anna. Rev.

Biochem. 53: 323; Itakura, et al, 1984. Science 198: 1056; Ike, et al, 1983. Nucl. Acids

Res. 11 : 477. Polypeptide Libraries

In addition, libraries of fragments ofthe MOLX protein coding sequences can be used to generate a variegated population of MOLX fragments for screening and subsequent selection of variants of an MOLX protein. In one embodiment, a library of coding sequence fragments can be generated by treating a double stranded PCR fragment of an MOLX coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule, denaturing the double stranded DNA, renaturing the DNA to form double-stranded DNA that can include sense/antisense pairs from different nicked products, removing single stranded portions from reformed duplexes by treatment with Si nuclease, and ligating the resulting fragment library into an expression vector. By this method, expression libraries can be derived which encodes N-terminal and internal fragments of various sizes of the MOLX proteins.

Various techniques are known in the art for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA libraries for gene products having a selected property. Such techniques are adaptable for rapid screening ofthe gene libraries generated by the combinatorial mutagenesis of MOLX proteins. The most widely used techniques, which are amenable to high throughput analysis, for screening large gene libraries typically include cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates isolation ofthe vector encoding the gene whose product was detected. Recursive ensemble mutagenesis (REM), a new technique that enhances the frequency of functional mutants in the libraries, can be used in combination with the screening assays to identify MOLX variants. See, e.g., Arkin and Yourvan, 1992. Proc. Natl. Acad. Sci. USA 89: 781 1-7815; Delgrave, et al, 1993. Protein Engineering 6:327-331.

Anti-MOLX Antibodies

The invention encompasses antibodies and antibody fragments, such as Fab or (Fat,)2,that bind immunospecifically to any ofthe MOLX polypeptides of said invention. An isolated MOLX protein, or a portion or fragment thereof, can be used as an immunogen to generate antibodies that bind to MOLX polypeptides using standard techniques for polyclonal and monoclonal antibody preparation. The full-length MOLX proteins can be used or, alternatively, the invention provides antigenic peptide fragments of MOLX proteins for use as immunogens. The antigenic MOLX peptides comprises at least 4 amino acid residues ofthe amino acid sequence shown in SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 11, 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167 and encompasses an epitope of MOLX such that an antibody raised against the peptide forms a specific immune complex with MOLX. Preferably, the antigenic peptide comprises at least 6, 8, 10, 15, 20, or 30 amino acid residues. Longer antigenic peptides are sometimes preferable over shorter antigenic peptides, depending on use and according to methods well known to someone skilled in the art.

In certain embodiments ofthe invention, at least one epitope encompassed by the antigenic peptide is a region of MOLX that is located on the surface ofthe protein (e.g., a hydrophilic region). As a means for targeting antibody production, hydropathy plots showing regions of hydrophilicity and hydrophobicity may be generated by any method well known in the art, including, for example, the Kyte Doolittle or the Hopp Woods methods, either with or without Fourier transformation (see, e.g., Hopp and Woods, 1981. Proc. Nat. Acad. Sci. USA 78: 3824-3828; Kyte and Doolittle, 1982. J. Mo Biol. 157: 105-142, each incorporated herein by reference in their entirety).

As disclosed herein, MOLX protein sequences of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1, 1 14, 116, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, or derivatives, fragments, analogs or homologs thereof, may be utilized as immunogens in the generation of antibodies that immunospecifically-bind these protein components. The term "antibody" as used herein refers to immunoglobulin molecules and immunologically- active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that specifically-binds (immunoreacts with) an antigen, such as MOLX. Such antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, Fa and F(ab')2 fragments, and an Fab expression library. In a specific embodiment, antibodies to human MOLX proteins are disclosed. Various procedures known within the art may be used for the production of polyclonal or monoclonal antibodies to an MOLX protein sequence of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106,

108, 11 1, 1 14, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154,

156, 158, 160, 162, 164, and 167, or a derivative, fragment, analog or homolog thereof.

Some of these proteins are discussed below. For the production of polyclonal antibodies, various suitable host animals (e.g., rabbit, goat, mouse or other mammal) may be immunized by injection with the native protein, or a synthetic variant thereof, or a derivative ofthe foregoing. An appropriate immunogenic preparation can contain, for example, recombinantly-expressed MOLX protein or a chemically-synthesized MOLX polypeptide. The preparation can further include an adjuvant. Various adjuvants used to increase the immunological response include, but are not limited to, Freund's (complete and incomplete), mineral gels (e.g., aluminum hydroxide), surface active substances (e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), human adjuvants such as Bacille Calmette-Guerin and Corynebacterium parvum, or similar immunostimulatory agents. If desired, the antibody molecules directed against MOLX can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as protein A chromatography to obtain the IgG fraction.

The term "monoclonal antibody" or "monoclonal antibody composition", as used herein, refers to a population of antibody molecules that contain only one species of an antigen binding site capable of immunoreacting with a particular epitope of MOLX. A monoclonal antibody composition thus typically displays a single binding affinity for a particular MOLX protein with which it immunoreacts. For preparation of monoclonal antibodies directed towards a particular MOLX protein, or derivatives, fragments, analogs or homologs thereof, any technique that provides for the production of antibody molecules by continuous cell line culture may be utilized. Such techniques include, but are not limited to, the hybridoma technique (see, e.g., Kohler & Milstein, 1975. Nature 256: 495-497); the trioma technique; the human B-cell hybridoma technique (see, e.g., Kozbor, et al, 1983. Immunol. Today 4: 72) and the EBV hybridoma technique to produce human monoclonal antibodies (see, e.g., Cole, et al, 1985. In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96). Human monoclonal antibodies may be utilized in the practice ofthe invention and may be produced by using human hybridomas (see, e.g., Cote, et al, 1983. Proc Natl Acad Sci USA 80: 2026-2030) or by transforming human B-cells with Epstein Barr Virus in vitro (see, e.g., Cole, et al, 1985. In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96). Each of the above citations is incorporated herein by reference in their entirety.

According to the invention, techniques can be adapted for the production of single-chain antibodies specific to an MOLX protein (see, e.g., U.S. Patent No.

4,946,778). In addition, methods can be adapted for the construction of Fab expression libraries (see, e.g., Huse, et al, 1989. Science 246: 1275-1281) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for an MOLX protein or derivatives, fragments, analogs or homologs thereof. Non-human antibodies can be "humanized" by techniques well known in the art. See, e.g., U.S. Patent No. 5,225,539. Antibody fragments that contain the idiotypes to an MOLX protein may be produced by techniques known in the art including, but not limited to: (i) an F^yp fragment produced by pepsin digestion of an antibody molecule; (ii) an Fab fragment generated by reducing the disulfide bridges of an Fta ')2 fragment; (Hi) an Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent; and (iv) Fv fragments.

Additionally, recombinant anti-MOLX antibodies, such as chimeric and humanized monoclonal antibodies, comprising both human and non-human portions, which can be made using standard recombinant DNA techniques, are within the scope of the invention. Such chimeric and humanized monoclonal antibodies can be produced by recombinant DNA techniques known in the art, for example using methods described in International Application No. PCT/US86/02269; European Patent Application No. 184, 187; European Patent Application No. 171,496; European Patent Application No. 173,494; PCT International Publication No. WO 86/01533; U.S. Patent No. 4,816,567; U.S. Pat. No. 5,225,539; European Patent Application No. 125,023; Better, et al, 1988. Science 240: 1041-1043; Liu, et al, 1987. Proc. Natl Acad. Sci. USA 84: 3439-3443; Liu, et al, 1987. J. Immunol. 139: 3521-3526; Sun, et al, 1987. Proc. Natl. Acad. Sci. USA 84: 214-218; Nishimura, et al, 1987. Cancer Res. 47: 999-1005; Wood, et al, 1985. Nature 314 :446-449; Shaw, et al, 1988. J Natl. Cancer Inst. 80: 1553-1559); Morrison(1985) Science 229: 1202-1207; Oi, et al. (1986) BioTechniques 4:214; Jones, et al, 1986. Nature 321 : 552-525; Verhoeyan, et al, 1988. Science 239: 1534; and Beidler, et al, 1988. J. Immunol. 141 : 4053-4060. Each ofthe above citations are incorporated herein by reference in their entirety.

In one embodiment, methods for the screening of antibodies that possess the desired specificity include, but are not limited to, enzyme-linked immunosorbent assay (ELISA) and other immunologically-mediated techniques known within the art. In a specific embodiment, selection of antibodies that are specific to a particular domain of an MOLX protein is facilitated by generation of hybridomas that bind to the fragment of an MOLX protein possessing such a domain. Thus, antibodies that are specific for a desired domain within an MOLX protein, or derivatives, fragments, analogs or homologs thereof, are also provided herein.

Anti-MOLX antibodies may be used in methods known within the art relating to the localization and/or quantitation of an MOLX protein (e.g., for use in measuring levels ofthe MOLX protein within appropriate physiological samples, for use in diagnostic methods, for use in imaging the protein, and the like). In a given embodiment, antibodies for MOLX proteins, or derivatives, fragments, analogs or homologs thereof, that contain the antibody derived binding domain, are utilized as pharmacologically-active compounds (hereinafter "Therapeutics"). An anti-MOLX antibody (e.g., monoclonal antibody) can be used to isolate an

MOLX polypeptide by standard techniques, such as affinity chromatography or immunoprecipitation. An anti-MOLX antibody can facilitate the purification of natural MOLX polypeptide from cells and of recombinantly-produced MOLX polypeptide expressed in host cells. Moreover, an anti-MOLX antibody can be used to detect MOLX protein (e.g., in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression ofthe MOLX protein. Anti-MOLX antibodies can be used diagnostically to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to, for example, determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling (i.e., physically linking) the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include

Figure imgf000187_0001

MOLX Recombinant Expression Vectors and Host Cells

Another aspect ofthe invention pertains to vectors, preferably expression vectors, containing a nucleic acid encoding an MOLX protein, or derivatives, fragments, analogs or homologs thereof. As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as "expression vectors". In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" can be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.

The recombinant expression vectors of the invention comprise a nucleic acid ofthe invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis ofthe host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, "operably-linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).

The term "regulatory sequence" is intended to includes promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression ofthe nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design ofthe expression vector can depend on such factors as the choice ofthe host cell to be transformed, the level of expression of protein desired, etc. The expression vectors ofthe invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., MOLX proteins, mutant forms of MOLX proteins, fusion proteins, etc.).

The recombinant expression vectors of the invention can be designed for expression of MOLX proteins in prokaryotic or eukaryotic cells. For example, MOLX proteins can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN

ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.

Expression of proteins in prokaryotes is most often carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus ofthe recombinant protein. Such fusion vectors typically serve three purposes: (i) to increase expression of recombinant protein; (ii) to increase the solubility ofthe recombinant protein; and (iii) to aid in the purification ofthe recombinant protein by acting as a ligand in affinity purification.

Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction ofthe fusion moiety and the recombinant protein to enable separation ofthe recombinant protein from the fusion moiety subsequent to purification ofthe fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia, Piscataway, NJ.) that fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein. Examples of suitable inducible non-fusion E. coli expression vectors include pTrc

(Amrann et al, (1988) Gene 69:301-315) and pET l id (Studier et al, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89). One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacteria with an impaired capacity to proteolytically cleave the recombinant protein. See, e.g., Gottesman, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 1 19-128. Another strategy is to alter the nucleic acid sequence ofthe nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in E. coli (see, e.g., Wada, et al, 1992. Nucl. Acids Res. 20: 211 1-2118). Such alteration of nucleic acid sequences ofthe invention can be carried out by standard DNA synthesis techniques. In another embodiment, the MOLX expression vector is a yeast expression vector.

Examples of vectors for expression in yeast Saccharomyces cerivisae include pYepSecl (Baldari, et al, 1987. EMBO J. 6: 229-234), pMFa (Kurjan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al, 1987. Gene 54: 1 13-123), pYES2 (Invitrogen Corporation, San Diego, Calif), and picZ (InVitrogen Corp, San Diego, Calif). Alternatively, MOLX can be expressed in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) include the pAc series (Smith, et al, 1983. Mol Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).

In yet another embodiment, a nucleic acid ofthe invention is expressed in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al, 1987. EMBO J. 6: 187-195). When used in mammalian cells, the expression vector's control functions are often provided by viral regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, and simian virus 40. For other suitable expression systems for both 'prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et al, MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.

In another embodiment, the recombinant mammalian expression vector is capable of directing expression ofthe nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al,

1987. Genes Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and immunoglobulins (Banerji, et al, 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Nat Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlund, et al, 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264, 166). Developmentally-regulated promoters are also encompassed, e.g., the murine hox promoters (Kessel and Grass, 1990. Science 249: 374-379) and the α-fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546).

The invention further provides a recombinant expression vector comprising a DNA molecule ofthe invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively-linked to a regulatory sequence in a manner that allows for expression (by transcription ofthe DNA molecule) of an RNA molecule that is antisense to MOLX mRNA. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen that direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen that direct constitutive, tissue specific or cell type specific expression of antisense RNA. The antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced. For a discussion ofthe regulation of gene expression using antisense genes see, e.g., Weintraub, et al, "Antisense RNA as a molecular tool for genetic analysis," Reviews- Trends in Genetics, Vol. 1(1) 1986.

Another aspect ofthe invention pertains to host cells into which a recombinant expression vector ofthe invention has been introduced. The terms "host cell" and "recombinant host cell" are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope ofthe term as used herein. A host cell can be any prokaryotic or eukaryotic cell. For example, MOLX protein can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art. Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. As used herein, the terms "transformation" and "transfection" are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989), and other laboratory manuals.

For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Various selectable markers include those that confer resistance to drugs, such as G418, hygromycin and methotrexate. Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding MOLX or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die). A host cell ofthe invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) MOLX protein. Accordingly, the invention further provides methods for producing MOLX protein using the host cells ofthe invention. In one embodiment, the method comprises culturing the host cell of invention (into which a recombinant expression vector encoding MOLX protein has been introduced) in a suitable medium such that MOLX protein is produced. In another embodiment, the method further comprises isolating MOLX protein from the medium or the host cell. Transgenic MOLX Animals

The host cells of the invention can also be used to produce non-human transgenic animals. For example, in one embodiment, a host cell ofthe invention is a fertilized oocyte or an embryonic stem cell into which MOLX protein-coding sequences have been introduced. Such host cells can then be used to create non-human transgenic animals in which exogenous MOLX sequences have been introduced into their genome or homologous recombinant animals in which endogenous MOLX sequences have been altered. Such animals are useful for studying the function and/or activity of MOLX protein and for identifying and/or evaluating modulators of MOLX protein activity. As used herein, a "transgenic animal" is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, in which one or more ofthe cells ofthe animal includes a transgene. Other examples of transgenic animals include non-human primates, sheep, dogs, cows, goats, chickens, amphibians, etc. A transgene is exogenous DNA that is integrated into the genome of a cell from which a transgenic animal develops and that remains in the genome ofthe mature animal, thereby directing the expression of an encoded gene product in one or more cell types or tissues ofthe transgenic animal. As used herein, a "homologous recombinant animal" is a non-human animal, preferably a mammal, more preferably a mouse, in which an endogenous MOLX gene has been altered by homologous recombination between the endogenous gene and an exogenous DNA molecule introduced into a cell ofthe animal, e.g., an embryonic cell ofthe animal, prior to development ofthe animal.

A transgenic animal ofthe invention can be created by introducing MOLX-encoding nucleic acid into the male pronuclei of a fertilized oocyte (e.g., by microinjection, retroviral infection) and allowing the oocyte to develop in a pseudopregnant female foster animal. The human MOLX cDNA sequences of SEQ ID NOS: l , 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 115, 117, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166 can be introduced as a transgene into the genome of a non-human animal. Alternatively, a non-human homologue ofthe human MOLX gene, such as a mouse MOLX gene, can be isolated based on hybridization to the human MOLX cDNA

(described further supra) and used as a transgene. Intronic sequences and polyadenylation signals can also be included in the transgene to increase the efficiency of expression of the transgene. A tissue-specific regulatory sequence(s) can be operably-linked to the MOLX transgene to direct expression of MOLX protein to particular cells. Methods for generating transgenic animals via embryo manipulation and microinjection, particularly animals such as mice, have become conventional in the art and are described, for example, in U.S. Patent Nos. 4,736,866; 4,870,009; and 4,873,191 ; and Hogan, 1986. In: MANIPULATING THE MOUSE EMBRYO, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. Similar methods are used for production of other transgenic animals. A transgenic founder animal can be identified based upon the presence ofthe MOLX transgene in its genome and/or expression of MOLX mRNA in tissues or cells ofthe animals. A transgenic founder animal can then be used to breed additional animals carrying the transgene. Moreover, transgenic animals carrying a transgene-encoding

MOLX protein can further be bred to other transgenic animals carrying other transgenes. To create a homologous recombinant animal, a vector is prepared which contains at least a portion of an MOLX gene into which a deletion, addition or substitution has been introduced to thereby alter, e.g., functionally disrupt, the MOLX gene. The MOLX gene can be a human gene (e.g., the cDNA of SEQ ID NOS: 1 , 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 , 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121 , 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166), but more preferably, is a non-human homologue of a human MOLX gene. For example, a mouse homologue of human MOLX gene of SEQ ID NOS: 1, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 1 15, 117, 1 19, 121, 124, 135, 137, 139, 141 , 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166 can be used to construct a homologous recombination vector suitable for altering an endogenous MOLX gene in the mouse genome. In one embodiment, the vector is designed such that, upon homologous recombination, the endogenous MOLX gene is functionally disrupted (i.e., no longer encodes a functional protein; also referred to as a "knock out" vector).

Alternatively, the vector can be designed such that, upon homologous recombination, the endogenous MOLX gene is mutated or otherwise altered but still encodes functional protein (e.g., the upstream regulatory region can be altered to thereby alter the expression ofthe endogenous MOLX protein). In the homologous recombination vector, the altered portion ofthe MOLX gene is flanked at its 5'- and 3 '-termini by additional nucleic acid ofthe MOLX gene to allow for homologous recombination to occur between the exogenous MOLX gene carried by the vector and an endogenous

MOLX gene in an embryonic stem cell. The additional flanking MOLX nucleic acid is of sufficient length for successful homologous recombination with the endogenous gene. Typically, several kilobases of flanking DNA (both at the 5'- and 3'-termini) are included in the vector. See, e.g., Thomas, et al, 1987. Cell 51 : 503 for a description of homologous recombination vectors. The vector is ten introduced into an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced MOLX gene has homologously- recombined with the endogenous MOLX gene are selected. See, e.g., Li, et al, 1992. Cell 69: 915.

The selected cells are then injected into a blastocyst of an animal (e.g., a mouse) to form aggregation chimeras. See, e.g., Bradley, 1987. In: TERATOCARCINOMAS AND EMBRYONIC STEM CELLS: A PRACTICAL APPROACH, Robertson, ed. IRL, Oxford, pp. 1 13-152. A chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term. Progeny harboring the homologously- recombined DNA in their germ cells can be used to breed animals in which all cells ofthe animal contain the homologously-recombined DNA by germline transmission ofthe transgene. Methods for constructing homologous recombination vectors and homologous recombinant animals are described further in Bradley, 1991. Curr. Opin. Biotechnol 2:

823-829; PCT International Publication Nos.: WO 90/1 1354; WO 91/01 140; WO 92/0968; and WO 93/04169.

In another embodiment, transgenic non-humans animals can be produced that contain selected systems that allow for regulated expression ofthe transgene. One example of such a system is the cre/loxP recombinase system of bacteriophage PL For a description ofthe cre/loxP recombinase system, See, e.g., Lakso, et al, 1992. Proc. Natl Acad. Sci. USA 89: 6232-6236. Another example of a recombinase system is the FLP recombinase system of Saccharomyces cerevisiae. See, O'Gorman, et al, 1991. Science 251 :1351 -1355. If a cre/loxP recombinase system is used to regulate expression ofthe transgene, animals containing transgenes encoding both the Cre recombinase and a selected protein are required. Such animals can be provided through the construction of "double" transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected protein and the other containing a transgene encoding a recombinase. Clones ofthe non-human transgenic animals described herein can also be produced according to the methods described in Wilmut, et al, 1997. Nature 385: 810-813. In brief, a cell (e.g., a somatic cell) from the transgenic animal can be isolated and induced to exit the growth cycle and enter G0 phase. The quiescent cell can then be fused, e.g., through the use of electrical pulses, to an enucleated oocyte from an animal ofthe same species from which the quiescent cell is isolated. The reconstructed oocyte is then cultured such that it develops to morula or blastocyte and then transferred to pseudopregnant female foster animal. The offspring borne of this female foster animal will be a clone ofthe animal from which the cell (e.g., the somatic cell) is isolated.

Pharmaceutical Compositions

The MOLX nucleic acid molecules, MOLX proteins, and anti-MOLX antibodies (also referred to herein as "active compounds") ofthe invention, and derivatives, fragments, analogs and homologs thereof, can be incorporated into pharmaceutical compositions suitable for administration. Such compositions typically comprise the nucleic acid molecule, protein, or antibody and a pharmaceutically acceptable carrier. As used herein, "pharmaceutically acceptable carrier" is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Preferred examples of such carriers or diluents include, but are not limited to, water, saline, finger's solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.

A pharmaceutical composition ofthe invention is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (i.e., topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose. The pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.

Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL (BASF, Parsippany, NJ.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance ofthe required particle size in the case of dispersion and by the use of surfactants. Prevention ofthe action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition. Prolonged absorption ofthe injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.

Sterile injectable solutions can be prepared by incorporating the active compound (e.g., an MOLX protein or anti-MOLX antibody) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation are vacuum drying and freeze-drying that yields a powder ofthe active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.

Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part ofthe composition. The tablets, pills, capsules, troches and the like can contain any ofthe following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.

For administration by inhalation, the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.

Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.

The compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery. In one embodiment, the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Patent No. 4,522,811.

It is especially advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms ofthe invention are dictated by and directly dependent on the unique characteristics ofthe active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.

The nucleic acid molecules ofthe invention can be inserted into vectors and used as gene therapy vectors. Gene therapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see, e.g., U.S. Patent No. 5,328,470) or by stereotactic injection (see, e.g., Chen, et al, 1994. Proc. Natl. Acad. Sci. USA 91 : 3054-3057). The pharmaceutical preparation ofthe gene therapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded. Alternatively, where the complete gene delivery vector can be produced intact from recombinant cells, e.g., retroviral vectors, the pharmaceutical preparation can include one or more cells that produce the gene delivery system.

The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.

Screening and Detection Methods The isolated nucleic acid molecules ofthe invention can be used to express MOLX protein (e.g., via a recombinant expression vector in a host cell in gene therapy applications), to detect MOLX mRNA (e.g., in a biological sample) or a genetic lesion in an MOLX gene, and to modulate MOLX activity, as described further, below. In addition, the MOLX proteins can be used to screen drugs or compounds that modulate the MOLX protein activity or expression as well as to treat disorders characterized by insufficient or excessive production of MOLX protein or production of MOLX protein forms that have decreased or aberrant activity compared to MOLX wild-type protein (e.g.; diabetes (regulates insulin release); obesity (binds and transport lipids); metabolic disturbances associated with obesity, the metabolic syndrome X as well as anorexia and wasting disorders associated with chronic diseases and various cancers, and infectious disease(possesses anti-microbial activity) and the various dyslipidemias. In addition, the anti-MOLX antibodies ofthe invention can be used to detect and isolate MOLX proteins and modulate MOLX activity. In yet a further aspect, the invention can be used in methods to influence appetite, absorption of nutrients and the disposition of metabolic substrates in both a positive and negative fashion.

The invention further pertains to novel agents identified by the screening assays described herein and uses thereof for treatments as described, supra.

Screening Assays

The invention provides a method (also referred to herein as a "screening assay") for identifying modulators, i.e., candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other drugs) that bind to MOLX proteins or have a stimulatory or inhibitory effect on, e.g., MOLX protein expression or MOLX protein activity. The invention also includes compounds identified in the screening assays described herein.

In one embodiment, the invention provides assays for screening candidate or test compounds which bind to or modulate the activity ofthe membrane-bound form of an MOLX protein or polypeptide or biologically-active portion thereof. The test compounds ofthe invention can be obtained using any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the "one-bead one-compound" library method; and synthetic library methods using affinity chromatography selection. The biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds. See, e.g., Lam, 1997. Anticancer Drug Design 12: 145.

A "small molecule" as used herein, is meant to refer to a composition that has a molecular weight of less than about 5 kD and most preferably less than about 4 kD. Small molecules can be, e.g., nucleic acids, peptides, polypeptides, peptidomimetics, carbohydrates, lipids or other organic or inorganic molecules. Libraries of chemical and/or biological mixtures, such as fungal, bacterial, or algal extracts, are known in the art and can be screened with any ofthe assays ofthe invention. Examples of methods for the synthesis of molecular libraries can be found in the art, for example in: DeWitt, et al, 1993. Proc. Natl. Acad. Sci. USA. 90: 6909; Erb, et al, 1994. Proc. Natl Acad. Sci. U.S.A. 91 : 11422; Zuckermann, et al, 1994. J. Med. Chem. 37: 2678; Cho, et al, 1993. Science 261 : 1303; Carrell, et al, 1994. Angew. Chem. Int. Ed. Engl. 33: 2059; Carell, et al, 1994. Angew. Chem. Int. Ed. Engl. 33: 2061 ; and Gallop, et al, 1994. J. Med. Chem. 37: 1233.

Libraries of compounds may be presented in solution (e.g., Houghten, 1992. Biotechniques 13: 412-421), or on beads (Lam, 1991. Nature 354: 82-84), on chips (Fodor, 1993. Nature 364: 555-556), bacteria (Ladner, U.S. Patent No. 5,223,409), spores (Ladner, U.S. Patent 5,233,409), plasmids (Cull, et al, 1992. Proc. Natl. Acad. Sci. USA 89: 1865-1869) or on phage (Scott and Smith, 1990. Sc/'e7?ce 249: 386-390; Devlin, 1990. Science 249: 404-406; Cwirla, et al, 1990. Proc. Natl. Acad. Sci. U.S.A. 87: 6378-6382; Felici, 1991. J. Mol. Biol. 222: 301-310; Ladner, U.S. Patent No. 5,233,409.).

In one embodiment, an assay is a cell-based assay in which a cell which expresses a membrane-bound form of MOLX protein, or a biologically-active portion thereof, on the cell surface is contacted with a test compound and the ability of the test compound to bind to an MOLX protein determined. The cell, for example, can of mammalian origin or a yeast cell. Determining the ability ofthe test compound to bind to the MOLX protein can be accomplished, for example, by coupling the test compound with a radioisotope or enzymatic label such that binding ofthe test compound to the MOLX protein or biologically-active portion thereof can be determined by detecting the labeled compound in a complex. For example, test compounds can be labeled with , 25I, j3S, l4C, or Η, either directly or indirectly, and the radioisotope detected by direct counting of radioemission or by scintillation counting. Alternatively, test compounds can be enzymatically-labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product. In one embodiment, the assay comprises contacting a cell which expresses a membrane-bound form of MOLX protein, or a biologically-active portion thereof, on the cell surface with a known compound which binds MOLX to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with an MOLX protein, wherein determining the ability ofthe test compound to interact with an MOLX protein comprises determining the ability ofthe test compound to preferentially bind to MOLX protein or a biologically-active portion thereof as compared to the known compound. In another embodiment, an assay is a cell-based assay comprising contacting a cell expressing a membrane-bound form of MOLX protein, or a biologically-active portion thereof, on the cell surface with a test compound and determining the ability ofthe test compound to modulate (e.g., stimulate or inhibit) the activity ofthe MOLX protein or biologically-active portion thereof. Determining the ability ofthe test compound to modulate the activity of MOLX or a biologically-active portion thereof can be accomplished, for example, by determining the ability ofthe MOLX protein to bind to or interact with an MOLX target molecule. As used herein, a "target molecule" is a molecule with which an MOLX protein binds or interacts in nature, for example, a molecule on the surface of a cell which expresses an MOLX interacting protein, a molecule on the surface of a second cell, a molecule in the extracellular milieu, a molecule associated with the internal surface of a cell membrane or a cytoplasmic molecule. An MOLX target molecule can be a non-MOLX molecule or an MOLX protein or polypeptide ofthe invention. In one embodiment, an MOLX target molecule is a component of a signal transduction pathway that facilitates transduction of an extracellular signal (e.g. a signal generated by binding of a compound to a membrane-bound MOLX molecule) through the cell membrane and into the cell. The target, for example, can be a second intercellular protein that has catalytic activity or a protein that facilitates the association of downstream signaling molecules with MOLX. Determining the ability ofthe MOLX protein to bind to or interact with an MOLX target molecule can be accomplished by one ofthe methods described above for determining direct binding. In one embodiment, determining the ability ofthe MOLX protein to bind to or interact with an MOLX target molecule can be accomplished by determining the activity ofthe target molecule. For example, the activity ofthe target molecule can be determined by detecting induction of a cellular second messenger of the target (i.e. intracellular Ca-+, diacylglycerol, IP3, etc.), detecting catalytic/enzymatic activity of the target an appropriate substrate, detecting the induction of a reporter gene (comprising an MOLX-responsive regulatory element operatively linked to a nucleic acid encoding a detectable marker, e.g., luciferase), or detecting a cellular response, for example, cell survival, cellular differentiation, or cell proliferation.

In yet another embodiment, an assay ofthe invention is a cell-free assay comprising contacting an MOLX protein or biologically-active portion thereof with a test compound and determining the ability ofthe test compound to bind to the MOLX protein or biologically-active portion thereof. Binding ofthe test compound to the MOLX protein can be determined either directly or indirectly as described above. In one such embodiment, the assay comprises contacting the MOLX protein or biologically-active portion thereof with a known compound which binds MOLX to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability ofthe test compound to interact with an MOLX protein, wherein determining the ability ofthe test compound to interact with an MOLX protein comprises determining the ability ofthe test compound to preferentially bind to MOLX or biologically-active portion thereof as compared to the known compound.

In still another embodiment, an assay is a cell-free assay comprising contacting MOLX protein or biologically-active portion thereof with a test compound and determining the ability ofthe test compound to modulate (e.g. stimulate or inhibit) the activity ofthe MOLX protein or biologically-active portion thereof. Determining the ability ofthe test compound to modulate the activity of MOLX can be accomplished, for example, by determining the ability ofthe MOLX protein to bind to an MOLX target molecule by one ofthe methods described above for determining direct binding. In an alternative embodiment, determining the ability ofthe test compound to modulate the activity of MOLX protein can be accomplished by determining the ability ofthe MOLX protein further modulate an MOLX target molecule. For example, the catalytic/enzymatic activity ofthe target molecule on an appropriate substrate can be determined as described, supra.

In yet another embodiment, the cell-free assay comprises contacting the MOLX protein or biologically-active portion thereof with a known compound which binds MOLX protein to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability ofthe test compound to interact with an MOLX protein, wherein determining the ability ofthe test compound to interact with an MOLX protein comprises determining the ability ofthe MOLX protein to preferentially bind to or modulate the activity of an MOLX target molecule.

The cell-free assays ofthe invention are amenable to use of both the soluble form or the membrane-bound form of MOLX protein. In the case of cell-free assays comprising the membrane-bound form of MOLX protein, it may be desirable to utilize a solubilizing agent such that the membrane-bound form of MOLX protein is maintained in solution.

Examples of such solubilizing agents include non-ionic detergents such as n-octylglucoside, n-dodecylglucoside, n-dodecylmaltoside, octanoyl-N-methylglucamide, decanoyl-N-methylglucamide, Triton® X-100, Triton® X-l 14, Thesit®, Isotridecypoly(ethylene glycol ether)n, N-dodecyl— N,N-dimethyl-3-ammonio-l-propane sulfonate, 3-(3-cholamidopropyl) dimethylamminiol-1 -propane sulfonate (CHAPS), or 3-(3-cholamidopropyl)dimethylamminiol-2-hydroxy-l -propane sulfonate (CHAPSO).

In more than one embodiment ofthe above assay methods ofthe invention, it may be desirable to immobilize either MOLX protein or its target molecule to facilitate separation of complexed from uncomplexed forms of one or both ofthe proteins, as well as to accommodate automation of the assay. Binding of a test compound to MOLX protein, or interaction of MOLX protein with a target molecule in the presence and absence of a candidate compound, can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtiter plates, test tubes, and micro-centrifuge tubes. In one embodiment, a fusion protein can be provided that adds a domain that allows one or both ofthe proteins to be bound to a matrix. For example, GST-MOLX fusion proteins or GST-target fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, MO) or glutathione derivatized microtiter plates, that are then combined with the test compound or the test compound and either the non-adsorbed target protein or MOLX protein, and the mixture is incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components, the matrix immobilized in the case of beads, complex determined either directly or indirectly, for example, as described, supra. Alternatively, the complexes can be dissociated from the matrix, and the level of MOLX protein binding or activity determined using standard techniques.

Other techniques for immobilizing proteins on matrices can also be used in the screening assays ofthe invention. For example, either the MOLX protein or its target molecule can be immobilized utilizing conjugation of biotin and streptavidin. Biotinylated MOLX protein or target molecules can be prepared from biotin-NHS (N-hydroxy-succinimide) using techniques well-known within the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, 111.), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical). Alternatively, antibodies reactive with MOLX protein or target molecules, but which do not interfere with binding ofthe MOLX protein to its target molecule, can be derivatized to the wells ofthe plate, and unbound target or MOLX protein trapped in the wells by antibody conjugation. Methods for detecting such complexes, in addition to those described above for the GST-immobilized complexes, include immunodetection of complexes using antibodies reactive with the MOLX protein or target molecule, as well as enzyme-linked assays that rely on detecting an enzymatic activity associated with the MOLX protein or target molecule.

In another embodiment, modulators of MOLX protein expression are identified in a method wherein a cell is contacted with a candidate compound and the expression of MOLX mRNA or protein in the cell is determined. The level of expression of MOLX mRNA or protein in the presence ofthe candidate compound is compared to the level of expression of MOLX mRNA or protein in the absence of the candidate compound. The candidate compound can then be identified as a modulator of MOLX mRNA or protein expression based upon this comparison. For example, when expression of MOLX mRNA or protein is greater (i.e., statistically significantly greater) in the presence ofthe candidate compound than in its absence, the candidate compound is identified as a stimulator of MOLX mRNA or protein expression. Alternatively, when expression of MOLX mRNA or protein is less (statistically significantly less) in the presence ofthe candidate compound than in its absence, the candidate compound is identified as an inhibitor of MOLX mRNA or protein expression. The level of MOLX mRNA or protein expression in the cells can be determined by methods described herein for detecting MOLX mRNA or protein.

In yet another aspect ofthe invention, the MOLX proteins can be used as "bait proteins" in a two-hybrid assay or three hybrid assay (.see, e.g., U.S. Patent No. 5,283,317; Zervos, et al, 1993. Cell 72: 223-232; Madura, et al, 1993. J. Biol. Chem. 268: 12046-12054; Bartel, et al, 1993. Biotechniques 14: 920-924; Iwabuchi, et al, 1993.

Oncogene 8: 1693-1696; and Brent WO 94/10300), to identify other proteins that bind to or interact with MOLX ("MOLX-binding proteins" or "MOLX-bp") and modulate MOLX activity. Such MOLX-binding proteins are also likely to be involved in the propagation of signals by the MOLX proteins as, for example, upstream or downstream elements ofthe MOLX pathway.

The two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains. Briefly, the assay utilizes two different DNA constructs. In one construct, the gene that codes for MOLX is fused to a gene encoding the DNA binding domain of a known transcription factor (e.g., GAL-4). In the other construct, a DNA sequence, from a library of DNA sequences, that encodes an unidentified protein ("prey" or "sample") is fused to a gene that codes for the activation domain ofthe known transcription factor. If the "bait" and the

"prey" proteins are able to interact, in vivo, forming an MOLX-dependent complex, the

DNA-binding and activation domains ofthe transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ) that is operably linked to a transcriptional regulatory site responsive to the transcription factor. Expression ofthe reporter gene can be detected and cell colonies containing the functional transcription factor can be isolated and used to obtain the cloned gene that encodes the protein which interacts with MOLX.

The invention further pertains to novel agents identified by the aforementioned screening assays and uses thereof for treatments as described herein.

Detection Assays

Portions or fragments ofthe cDNA sequences identified herein (and the corresponding complete gene sequences) can be used in numerous ways as polynucleotide reagents. By way of example, and not of limitation, these sequences can be used to: (i) map their respective genes on a chromosome; and, thus, locate gene regions associated with genetic disease; (ii) identify an individual from a minute biological sample (tissue typing); and (iii) aid in forensic identification of a biological sample. Some of these applications are described in the subsections, below.

Chromosome Mapping

Once the sequence (or a portion ofthe sequence) of a gene has been isolated, this sequence can be used to map the location of the gene on a chromosome. This process is called chromosome mapping. Accordingly, portions or fragments ofthe MOLX sequences, SEQ ID NOS: l, 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141 , 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166, or fragments or derivatives thereof, can be used to map the location ofthe MOLX genes, respectively, on a chromosome. The mapping ofthe MOLX sequences to chromosomes is an important first step in correlating these sequences with genes associated with disease.

Briefly, MOLX genes can be mapped to chromosomes by preparing PCR primers (preferably 15-25 bp in length) from the MOLX sequences. Computer analysis of the MOLX, sequences can be used to rapidly select primers that do not span more than one exon in the genomic DNA, thus complicating the amplification process. These primers can then be used for PCR screening of somatic cell hybrids containing individual human chromosomes. Only those hybrids containing the human gene corresponding to the MOLX sequences will yield an amplified fragment. Somatic cell hybrids are prepared by fusing somatic cells from different mammals (e.g., human and mouse cells). As hybrids of human and mouse cells grow and divide, they gradually lose human chromosomes in random order, but retain the mouse chromosomes. By using media in which mouse cells cannot grow, because they lack a particular enzyme, but in which human cells can, the one human chromosome that contains the gene encoding the needed enzyme will be retained. By using various media, panels of hybrid cell lines can be established. Each cell line in a panel contains either a single human chromosome or a small number of human chromosomes, and a full set of mouse chromosomes, allowing easy mapping of individual genes to specific human chromosomes. See, e.g., D'Eustachio, et al, 1983. Science 220: 919-924. Somatic cell hybrids containing only fragments of human chromosomes can also be produced by using human chromosomes with translocations and deletions.

PCR mapping of somatic cell hybrids is a rapid procedure for assigning a particular sequence to a particular chromosome. Three or more sequences can be assigned per day using a single thermal cycler. Using the MOLX sequences to design oligonucleotide primers, sub-localization can be achieved with panels of fragments from specific chromosomes.

Fluorescence in situ hybridization (FISH) of a DNA sequence to a metaphase chromosomal spread can further be used to provide a precise chromosomal location in one step. Chromosome spreads can be made using cells whose division has been blocked in metaphase by a chemical like colcemid that disrupts the mitotic spindle. The chromosomes can be treated briefly with trypsin, and then stained with Giemsa. A pattern of light and dark bands develops on each chromosome, so that the chromosomes can be identified individually. The FISH technique can be used with a DNA sequence as short as 500 or 600 bases. However, clones larger than 1 ,000 bases have a higher likelihood of binding to a unique chromosomal location with sufficient signal intensity for simple detection. Preferably 1,000 bases, and more preferably 2,000 bases, will suffice to get good results at a reasonable amount of time. For a review of this technique, see, Verma, et al, HUMAN CHROMOSOMES: A MANUAL OF BASIC TECHNIQUES (Pergamon Press, New York 1988).

Reagents for chromosome mapping can be used individually to mark a single chromosome or a single site on that chromosome, or panels of reagents can be used for marking multiple sites and/or multiple chromosomes. Reagents corresponding to noncoding regions ofthe genes actually are preferred for mapping purposes. Coding sequences are more likely to be conserved within gene families, thus increasing the chance of cross hybridizations during chromosomal mapping.

Once a sequence has been mapped to a precise chromosomal location, the physical position ofthe sequence on the chromosome can be correlated with genetic map data. Such data are found, e.g., in McKusick, MENDELIAN INHERITANCE IN MAN, available on-line through Johns Hopkins University Welch Medical Library). The relationship between genes and disease, mapped to the same chromosomal region, can then be identified through linkage analysis (co-inheritance of physically adjacent genes), described in, e.g., Egeland, et al, 1987. Nature, 325: 783-787. Moreover, differences in the DNA sequences between individuals affected and unaffected with a disease associated with the MOLX gene, can be determined. If a mutation is observed in some or all ofthe affected individuals but not in any unaffected individuals, then the mutation is likely to be the causative agent ofthe particular disease. Comparison of affected and unaffected individuals generally involves first looking for structural alterations in the chromosomes, such as deletions or translocations that are visible from chromosome spreads or detectable using PCR based on that DNA sequence. Ultimately, complete sequencing of genes from several individuals can be performed to confirm the presence of a mutation and to distinguish mutations from polymorphisms.

Tissue Typing

The MOLX sequences ofthe invention can also be used to identify individuals from minute biological samples. In this technique, an individual's genomic DNA is digested with one or more restriction enzymes, and probed on a Southern blot to yield unique bands for identification. The sequences ofthe invention are useful as additional DNA markers for RFLP ("restriction fragment length polymorphisms," described in U.S. Patent No. 5,272,057).

Furthermore, the sequences ofthe invention can be used to provide an alternative technique that determines the actual base-by-base DNA sequence of selected portions of an individual's genome. Thus, the MOLX sequences described herein can be used to prepare two PCR primers from the 5'- and 3'-termini ofthe sequences. These primers can then be used to amplify an individual's DNA and subsequently sequence it.

Panels of corresponding DNA sequences from individuals, prepared in this manner, can provide unique individual identifications, as each individual will have a unique set of such DNA sequences due to allelic differences. The sequences ofthe invention can be used to obtain such identification sequences from individuals and from tissue. The MOLX sequences ofthe invention uniquely represent portions of the human genome. Allelic variation occurs to some degree in the coding regions of these sequences, and to a greater degree in the noncoding regions. It is estimated that allelic variation between individual humans occurs with a frequency of about once per each 500 bases. Much ofthe allelic variation is due to single nucleotide polymorphisms (SNPs), which include restriction fragment length polymorphisms (RFLPs).

Each ofthe sequences described herein can, to some degree, be used as a standard against which DNA from an individual can be compared for identification purposes. Because greater numbers of polymorphisms occur in the noncoding regions, fewer sequences are necessary to differentiate individuals. The noncoding sequences can comfortably provide positive individual identification with a panel of perhaps 10 to 1 ,000 primers that each yield a noncoding amplified sequence of 100 bases. If predicted coding sequences, such as those in SEQ ID NOS: l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161 , 163, 165, and 166 are used, a more appropriate number of primers for positive individual identification would be 500-2,000.

Predictive Medicine The invention also pertains to the field of predictive medicine in which diagnostic assays, prognostic assays, pharmacogenomics, and monitoring clinical trials are used for prognostic (predictive) purposes to thereby treat an individual prophylactically. Accordingly, one aspect ofthe invention relates to diagnostic assays for determining MOLX protein and/or nucleic acid expression as well as MOLX activity, in the context of a biological sample (e.g., blood, serum, cells, tissue) to thereby determine whether an individual is afflicted with a disease or disorder, or is at risk of developing a disorder, associated with aberrant MOLX expression or activity. The disorders include metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders, and the various dyslipidemias, metabolic disturbances associated with obesity, the metabolic syndrome X and wasting disorders associated with chronic diseases and various cancers. The invention also provides for prognostic (or predictive) assays for determining whether an individual is at risk of developing a disorder associated with MOLX protein, nucleic acid expression or activity. For example, mutations in an MOLX gene can be assayed in a biological sample. Such assays can be used for prognostic or predictive purpose to thereby prophylactically treat an individual prior to the onset of a disorder characterized by or associated with MOLX protein, nucleic acid expression, or biological activity.

Another aspect ofthe invention provides methods for determining MOLX protein, nucleic acid expression or activity in an individual to thereby select appropriate therapeutic or prophylactic agents for that individual (referred to herein as "pharmacogenomics"). Pharmacogenomics allows for the selection of agents (e.g., drugs) for therapeutic or prophylactic treatment of an individual based on the genotype of the individual (e.g., the genotype ofthe individual examined to determine the ability ofthe individual to respond to a particular agent.)

Yet another aspect ofthe invention pertains to monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of MOLX in clinical trials.

These and other agents are described in further detail in the following sections.

Diagnostic Assays

An exemplary method for detecting the presence or absence of MOLX in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with a compound or an agent capable of detecting MOLX protein or nucleic acid (e.g., mRNA, genomic DNA) that encodes MOLX protein such that the presence of MOLX is detected in the biological sample. An agent for detecting MOLX mRNA or genomic DNA is a labeled nucleic acid probe capable of hybridizing to MOLX mRNA or genomic DNA. The nucleic acid probe can be, for example, a full-length MOLX nucleic acid, such as the nucleic acid of SEQ ID NOS: 1 , 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21 , 23, 101 , 103, 105, 107, 109, 1 12, 1 15, 1 17, 1 19, 121 , 124, 135, 137,

139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166, or a portion thereof, such as an oligonucleotide of at least 15, 30, 50, 100, 250 or 500 nucleotides in length and sufficient to specifically hybridize under stringent conditions to MOLX mRNA or genomic DNA. Other suitable probes for use in the diagnostic assays ofthe invention are described herein.

An agent for detecting MOLX protein is an antibody capable of binding to MOLX protein, preferably an antibody with a detectable label. Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment thereof (e.g. , Fab or

F(ab')2) can be used. The term "labeled", with regard to the probe or antibody, is intended to encompass direct labeling ofthe probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling ofthe probe or antibody by reactivity with another reagent that is directly labeled. Examples of indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin. The term "biological sample" is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. That is, the detection method ofthe invention can be used to detect MOLX mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo. For example, in vitro techniques for detection of MOLX mRNA include

Northern hybridizations and in situ hybridizations. In vitro techniques for detection of MOLX protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and immunofluorescence. In vitro techniques for detection of MOLX genomic DNA include Southern hybridizations. Furthermore, in vivo techniques for detection of MOLX protein include introducing into a subject a labeled anti-MOLX antibody. For example, the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.

In one embodiment, the biological sample contains protein molecules from the test subject. Alternatively, the biological sample can contain mRNA molecules from the test subject or genomic DNA molecules from the test subject. A preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject.

In another embodiment, the methods further involve obtaining a control biological sample from a control subject, contacting the control sample with a compound or agent capable of detecting MOLX protein, mRNA, or genomic DNA, such that the presence of MOLX protein, mRNA or genomic DNA is detected in the biological sample, and comparing the presence of MOLX protein, mRNA or genomic DNA in the control sample with the presence of MOLX protein, mRNA or genomic DNA in the test sample.

The invention also encompasses kits for detecting the presence of MOLX in a biological sample. For example, the kit can comprise: a labeled compound or agent capable of detecting MOLX protein or mRNA in a biological sample; means for determining the amount of MOLX in the sample; and means for comparing the amount of

MOLX in the sample with a standard. The compound or agent can be packaged in a suitable container. The kit can further comprise instructions for using the kit to detect

MOLX protein or nucleic acid. Prognostic Assays

The diagnostic methods described herein can furthermore be utilized to identify subjects having or at risk of developing a disease or disorder associated with aberrant MOLX expression or activity. For example, the assays described herein, such as the preceding diagnostic assays or the following assays, can be utilized to identify a subject having or at risk of developing a disorder associated with MOLX protein, nucleic acid expression or activity. Alternatively, the prognostic assays can be utilized to identify a subject having or at risk for developing a disease or disorder. Thus, the invention provides a method for identifying a disease or disorder associated with aberrant MOLX expression or activity in which a test sample is obtained from a subject and MOLX protein or nucleic acid (e.g., mRNA, genomic DNA) is detected, wherein the presence of MOLX protein or nucleic acid is diagnostic for a subject having or at risk of developing a disease or disorder associated with aberrant MOLX expression or activity. As used herein, a "test sample" refers to a biological sample obtained from a subject of interest. For example, a test sample can be a biological fluid (e.g., serum), cell sample, or tissue.

Furthermore, the prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate) to treat a disease or disorder associated with aberrant MOLX expression or activity. For example, such methods can be used to determine whether a subject can be effectively treated with an agent for a disorder. Thus, the invention provides methods for determining whether a subject can be effectively treated with an agent for a disorder associated with aberrant MOLX expression or activity in which a test sample is obtained and MOLX protein or nucleic acid is detected (e.g., wherein the presence of MOLX protein or nucleic acid is diagnostic for a subject that can be administered the agent to treat a disorder associated with aberrant MOLX expression or activity).

The methods ofthe invention can also be used to detect genetic lesions in an MOLX gene, thereby determining if a subject with the lesioned gene is at risk for a disorder characterized by aberrant cell proliferation and/or differentiation. In various embodiments, the methods include detecting, in a sample of cells from the subject, the presence or absence of a genetic lesion characterized by at least one of an alteration affecting the integrity of a gene encoding an MOLX-protein, or the misexpression ofthe

MOLX gene. For example, such genetic lesions can be detected by ascertaining the existence of at least one of: (i) a deletion of one or more nucleotides from an MOLX gene; (ii) an addition of one or more nucleotides to an MOLX gene; (iii) a substitution of one or more nucleotides of an MOLX gene, (iv) a chromosomal rearrangement of an MOLX gene; (v) an alteration in the level of a messenger RNA transcript of an MOLX gene, (vi) aberrant modification of an MOLX gene, such as ofthe methylation pattern ofthe genomic DNA, (vii) the presence of a non-wild-type splicing pattern of a messenger RNA transcript of an MOLX gene, (viii) a non-wild-type level of an MOLX protein, (ix) allelic loss of an MOLX gene, and (x) inappropriate post-translational modification of an MOLX protein. As described herein, there are a large number of assay techniques known in the art which can be used for detecting lesions in an MOLX gene. A preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject. However, any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.

In certain embodiments, detection of the lesion involves the use of a probe/primer in a polymerase chain reaction (PCR) (see, e.g., U.S. Patent Nos. 4,683, 195 and

4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligation chain reaction (LCR) (see, e.g., Landegran, et al, 1988. Science 241 : 1077-1080; and Nakazawa, et al, 1994. Proc. Natl. Acad. Sci. USA 91 : 360-364), the latter of which can be particularly useful for detecting point mutations in the MOLX-gene (.see, Abravaya, et al, 1995. Nucl. Acids Res. 23: 675-682). This method can include the steps of collecting a sample of cells from a patient, isolating nucleic acid (e.g., genomic, mRNA or both) from the cells ofthe sample, contacting the nucleic acid sample with one or more primers that specifically hybridize to an MOLX gene under conditions such that hybridization and amplification ofthe MOLX gene (if present) occurs, and detecting the presence or absence of an amplification product, or detecting the size ofthe amplification product and comparing the length to a control sample. It is anticipated that PCR and/or LCR may be desirable to use as a preliminary amplification step in conjunction with any ofthe techniques used for detecting mutations described herein.

Alternative amplification methods include: self sustained sequence replication (see, Guatelli, et al, 1990. Proc. Natl. Acad. Sci. USA 87: 1874-1878), transcriptional amplification system (see, Kwoh, et al, 1989. Proc. Natl. Acad. Sci. USA 86: 1173-1177); Qβ Replicase (see, Lizardi, et al, 1988. BioTechnology 6: 1197), or any other nucleic acid amplification method, followed by the detection ofthe amplified molecules using techniques well known to those of skill in the art. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers.

In an alternative embodiment, mutations in an MOLX gene from a sample cell can be identified by alterations in restriction enzyme cleavage patterns. For example, sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis and compared. Differences in fragment length sizes between sample and control DNA indicates mutations in the sample DNA. Moreover, the use of sequence specific ribozymes (see, e.g., U.S. Patent No. 5,493,531) can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.

In other embodiments, genetic mutations in MOLX can be identified by hybridizing a sample and control nucleic acids, e.g., DNA or RNA, to high-density arrays containing hundreds or thousands of oligonucleotides probes. See, e.g., Cronin, et al, 1996. Human Mutation 7: 244-255; Kozal, et al, 1996. Nat. Med. 2: 753-759. For example, genetic mutations in MOLX can be identified in two dimensional arrays containing light-generated DNA probes as described in Cronin, et al, supra. Briefly, a first hybridization array of probes can be used to scan through long stretches of DNA in a sample and control to identify base changes between the sequences by making linear arrays of sequential overlapping probes. This step allows the identification of point mutations. This is followed by a second hybridization array that allows the characterization of specific mutations by using smaller, specialized probe arrays complementary to all variants or mutations detected. Each mutation array is composed of parallel probe sets, one complementary to the wild-type gene and the other complementary to the mutant gene.

In yet another embodiment, any of a variety of sequencing reactions known in the art can be used to directly sequence the MOLX gene and detect mutations by comparing the sequence ofthe sample MOLX with the corresponding wild-type (control) sequence. Examples of sequencing reactions include those based on techniques developed by Maxim and Gilbert, 1977. Proc. Natl. Acad. Sci. USA 74: 560 or Sanger, 1977. Proc. Natl. Acad. Sci. USA 74: 5463. It is also contemplated that any of a variety of automated sequencing procedures can be utilized when performing the diagnostic assays (see, e.g., Naeve, et al, 1995. Biotechniques 19: 448), including sequencing by mass spectrometry (see, e.g., PCT International Publication No. WO 94/16101 ; Cohen, et al, 1996. Adv. Chromatography 36: 127-162; and Griffin, et al, \993. Appl. Biochem. Biotechnol 38: 147-159).

Other methods for detecting mutations in the MOLX gene include methods in which protection from cleavage agents is used to detect mismatched bases in RNA RNA or RNA/DNA heteroduplexes. See, e.g., Myers, et al, 1985. Science 230: 1242. In general, the art technique of "mismatch cleavage" starts by providing heteroduplexes of formed by hybridizing (labeled) RNA or DNA containing the wild-type MOLX sequence with potentially mutant RNA or DNA obtained from a tissue sample. The double-stranded duplexes are treated with an agent that cleaves single-stranded regions ofthe duplex such as which will exist due to basepair mismatches between the control and sample strands. For instance, RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with Si nuclease to enzymatically digesting the mismatched regions. In other embodiments, either DNA/DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion of he mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, e.g., Cotton, et al, 1988. Proc. Natl. Acad. Sci. USA 85: 4397; Saleeba, et al, 1992. Methods Enzymol. 217: 286-295. In an embodiment, the control DNA or RNA can be labeled for detection. In still another embodiment, the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called "DNA mismatch repair" enzymes) in defined systems for detecting and mapping point mutations in MOLX cDNAs obtained from samples of cells. For example, the mutY enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches. See, e.g., Hsu, et al, 1994. Carcinogenesis 15: 1657-1662. According to an exemplary embodiment, a probe based on an MOLX sequence, e.g., a wild-type MOLX sequence, is hybridized to a cDNA or other DNA product from a test cell(s). The duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, e.g., U.S. Patent No. 5,459,039.

In other embodiments, alterations in electrophoretic mobility will be used to identify mutations in MOLX genes. For example, single strand conformation polymorphism (SSCP) may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids. See, e.g., Orita, et al, 1989. Proc. Natl. Acad. Sci. USA: 86: 2766; Cotton, 1993. Mutat. Res. 285: 125-144; Hayashi, 1992. Genet. Anal. Tech. Appl. 9: 73-79. Single-stranded DNA fragments of sample and control MOLX nucleic acids will be denatured and allowed to renature. The secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change. The DNA fragments may be labeled or detected with labeled probes. The sensitivity ofthe assay may be enhanced by using RNA (rather than DNA), in which the secondary structure is more sensitive to a change in sequence. In one embodiment, the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility. See, e.g., Keen, et al, 1991. Trends Genet. 7: 5. In yet another embodiment, the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE). See, e.g., Myers, et al, 1985. Nature 313: 495. When DGGE is used as the method of analysis, DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting GC-rich DNA by PCR. In a further embodiment, a temperature gradient is used in place of a denaturing gradient to identify differences in the mobility of control and sample DNA. See, e.g., Rosenbaum and Reissner, 1987. Biophys. Chem. 265: 12753. Examples of other techniques for detecting point mutations include, but are not limited to, selective oligonucleotide hybridization, selective amplification, or selective primer extension. For example, oligonucleotide primers may be prepared in which the known mutation is placed centrally and then hybridized to target DNA under conditions that permit hybridization only if a perfect match is found. See, e.g., Saiki, et al, 1986. Nature 324: 163; Saiki, et al, 1989. Proc. Natl. Acad Sci. USA 86: 6230. Such allele specific oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations when the oligonucleotides are attached to the hybridizing membrane and hybridized with labeled target DNA.

Alternatively, allele specific amplification technology that depends on selective PCR amplification may be used in conjunction with the instant invention. Oligonucleotides used as primers for specific amplification may carry the mutation of interest in the center ofthe molecule (so that amplification depends on differential hybridization; see, e.g., Gibbs, et al, 1989. Nucl. Acids Res. 17: 2437-2448) or at the extreme 3 '-terminus of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (see, e.g., Prossner, 1993. Tibtech. 1 1 : 238). In addition it may be desirable to introduce a novel restriction site in the region ofthe mutation to create cleavage-based detection. See, e.g., Gasparini, et al, 1992. Mol. Cell Probes 6: 1. It is anticipated that in certain embodiments amplification may also be performed using Taq ligase for amplification. See, e.g., Barany, 1991. Proc. Natl. Acad. Sci. USA 88: 189. In such cases, ligation will occur only if there is a perfect match at the 3'-terminus ofthe 5' sequence, making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification. The methods described herein may be performed, for example, by utilizing pre-packaged diagnostic kits comprising at least one probe nucleic acid or antibody reagent described herein, which may be conveniently used, e.g., in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving an MOLX gene.

Furthermore, any cell type or tissue, preferably peripheral blood leukocytes, in which MOLX is expressed may be utilized in the prognostic assays described herein. However, any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.


Agents, or modulators that have a stimulatory or inhibitory effect on MOLX activity (e.g., MOLX gene expression), as identified by a screening assay described herein can be administered to individuals to treat (prophylactically or therapeutically) disorders

(The disorders include metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease,

Parkinson's Disorder, immune disorders, and hematopoietic disorders, and the various dyslipidemias, metabolic disturbances associated with obesity, the metabolic syndrome X and wasting disorders associated with chronic diseases and various cancers.) In conjunction with such treatment, the pharmacogenomics (i.e., the study ofthe relationship between an individual's genotype and that individual's response to a foreign compound or drug) ofthe individual may be considered. Differences in metabolism of therapeutics can lead to severe toxicity or therapeutic failure by altering the relation between dose and blood concentration of the pharmacologically active drug. Thus, the pharmacogenomics ofthe individual permits the selection of effective agents (e.g., drugs) for prophylactic or therapeutic treatments based on a consideration ofthe individual's genotype. Such pharmacogenomics can further be used to determine appropriate dosages and therapeutic regimens. Accordingly, the activity of MOLX protein, expression of MOLX nucleic acid, or mutation content of MOLX genes in an individual can be determined to thereby select appropriate agent(s) for therapeutic or prophylactic treatment ofthe individual.

Pharmacogenomics deals with clinically significant hereditary variations in the response to drugs due to altered drug disposition and abnormal action in affected persons. See e.g., Eichelbaum, 1996. Clin. Exp. Pharmacol. Physiol, 23: 983-985; Linder, 1997. Clin. Chem., 43: 254-266. In general, two types of pharmacogenetic conditions can be differentiated. Genetic conditions transmitted as a single factor altering the way drugs act on the body (altered drug action) or genetic conditions transmitted as single factors altering the way the body acts on drugs (altered drug metabolism). These pharmacogenetic conditions can occur either as rare defects or as polymorphisms. For example, glucose-6-phosphate dehydrogenase (G6PD) deficiency is a common inherited enzymopathy in which the main clinical complication is hemolysis after ingestion of oxidant drugs (anti-malarials, sulfonamides, analgesics, nitrofurans) and consumption of fava beans.

As an illustrative embodiment, the activity of drug metabolizing enzymes is a major determinant of both the intensity and duration of drug action. The discovery of genetic polymorphisms of drug metabolizing enzymes (e.g., N-acetyltransferase 2 (NAT 2) and cytochrome P450 enzymes CYP2D6 and CYP2C19) has provided an explanation as to why some patients do not obtain the expected drug effects or show exaggerated drug response and serious toxicity after taking the standard and safe dose of a drug. These polymorphisms are expressed in two phenotypes in the population, the extensive metabolizer (EM) and poor metabolizer (PM). The prevalence of PM is different among different populations. For example, the gene coding for CYP2D6 is highly polymorphic and several mutations have been identified in PM, which all lead to the absence of functional CYP2D6. Poor metabolizers of CYP2D6 and CYP2C19 quite frequently experience exaggerated drug response and side effects when they receive standard doses. If a metabolite is the active therapeutic moiety, PM show no therapeutic response, as demonstrated for the analgesic effect of codeine mediated by its CYP2D6-formed metabolite morphine. At the other extreme are the so called ultra-rapid metabolizers who do not respond to standard doses. Recently, the molecular basis of ultra-rapid metabolism has been identified to be due to CYP2D6 gene amplification.

Thus, the activity of MOLX protein, expression of MOLX nucleic acid, or mutation content of MOLX genes in an individual can be determined to thereby select appropriate agent(s) for therapeutic or prophylactic treatment ofthe individual. In addition, pharmacogenetic studies can be used to apply genotyping of polymorphic alleles encoding drug-metabolizing enzymes to the identification of an individual's drug responsiveness phenotype. This knowledge, when applied to dosing or drug selection, can avoid adverse reactions or therapeutic failure and thus enhance therapeutic or prophylactic efficiency when treating a subject with an MOLX modulator, such as a modulator identified by one ofthe exemplary screening assays described herein.

Monitoring of Effects During Clinical Trials Monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of MOLX (e.g., the ability to modulate aberrant cell proliferation and/or differentiation) can be applied not only in basic drug screening, but also in clinical trials. For example, the effectiveness of an agent determined by a screening assay as described herein to increase MOLX gene expression, protein levels, or upregulate MOLX activity, can be monitored in clinical trails of subjects exhibiting decreased MOLX gene expression, protein levels, or downregulated MOLX activity. Alternatively, the effectiveness of an agent determined by a screening assay to decrease MOLX gene expression, protein levels, or downregulate MOLX activity, can be monitored in clinical trails of subjects exhibiting increased MOLX gene expression, protein levels, or upregulated MOLX activity. In such clinical trials, the expression or activity of MOLX and, preferably, other genes that have been implicated in, for example, a cellular proliferation or immune disorder can be used as a "read out" or markers ofthe immune responsiveness of a particular cell.

By way of example, and not of limitation, genes, including MOLX, that are modulated in cells by treatment with an agent (e.g., compound, drug or small molecule) that modulates MOLX activity (e.g., identified in a screening assay as described herein) can be identified. Thus, to study the effect of agents on cellular proliferation disorders, for example, in a clinical trial, cells can be isolated and RNA prepared and analyzed for the levels of expression of MOLX and other genes implicated in the disorder. The levels of gene expression (i.e., a gene expression pattern) can be quantified by Northern blot analysis or RT-PCR, as described herein, or alternatively by measuring the amount of protein produced, by one ofthe methods as described herein, or by measuring the levels of activity of MOLX or other genes. In this manner, the gene expression pattern can serve as a marker, indicative ofthe physiological response ofthe cells to the agent. Accordingly, this response state may be determined before, and at various points during, treatment of the individual with the agent.

In one embodiment, the invention provides a method for monitoring the effectiveness of treatment of a subject with an agent (e.g., an agonist, antagonist, protein, peptide, peptidomimetic, nucleic acid, small molecule, or other drug candidate identified by the screening assays described herein) comprising the steps of (i) obtaining a pre-administration sample from a subject prior to administration ofthe agent; (ii) detecting the level of expression of an MOLX protein, mRNA, or genomic DNA in the preadministration sample; (iii) obtaining one or more post-administration samples from the subject; (iv) detecting the level of expression or activity ofthe MOLX protein, mRNA, or genomic DNA in the post-administration samples; (v) comparing the level of expression or activity ofthe MOLX protein, mRNA, or genomic DNA in the pre-administration sample with the MOLX protein, mRNA, or genomic DNA in the post administration sample or samples; and (vi) altering the administration ofthe agent to the subject accordingly. For example, increased administration ofthe agent may be desirable to increase the expression or activity of MOLX to higher levels than detected, i.e., to increase the effectiveness ofthe agent. Alternatively, decreased administration ofthe agent may be desirable to decrease expression or activity of MOLX to lower levels than detected, i.e., to decrease the effectiveness ofthe agent.

Methods of Treatment

The invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant MOLX expression or activity. The disorders include cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventricular (A-V) canal defect, ductus arteriosus, pulmonary stenosis, subaortic stenosis, ventricular septal defect (VSD), valve diseases, tuberous sclerosis, scleroderma, obesity, transplantation, adrenoleukodystrophy, congenital adrenal hyperplasia, prostate cancer, neoplasm; adenocarcinoma, lymphoma, uterus cancer, fertility, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, graft versus host disease, AIDS, bronchial asthma, Crohn's disease; multiple sclerosis, treatment of Albright Hereditary Ostoeodystrophy, and other diseases, disorders and conditions ofthe like.

These methods of treatment will be discussed more fully, below. Disease and Disorders

Diseases and disorders that are characterized by increased (relative to a subject not suffering from the disease or disorder) levels or biological activity may be treated with Therapeutics that antagonize (i.e., reduce or inhibit) activity. Therapeutics that antagonize activity may be administered in a therapeutic or prophylactic manner. Therapeutics that may be utilized include, but are not limited to: ( ) an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof; (ii) antibodies to an aforementioned peptide; (iii) nucleic acids encoding an aforementioned peptide; (iv) administration of antisense nucleic acid and nucleic acids that are "dysfunctional" (i.e., due to a heterologous insertion within the coding sequences of coding sequences to an aforementioned peptide) that are utilized to "knockout" endoggenous function of an aforementioned peptide by homologous recombination (see, e.g., Capecchi, 1989. Science 244: 1288-1292); or (v) modulators ( i.e., inhibitors, agonists and antagonists, including additional peptide mimetic ofthe invention or antibodies specific to a peptide ofthe invention) that alter the interaction between an aforementioned peptide and its binding partner.

Diseases and disorders that are characterized by decreased (relative to a subject not suffering from the disease or disorder) levels or biological activity may be treated with Therapeutics that increase (i.e., are agonists to) activity. Therapeutics that upregulate activity may be administered in a therapeutic or prophylactic manner. Therapeutics that may be utilized include, but are not limited to, an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof; or an agonist that increases bioavailability.

Increased or decreased levels can be readily detected by quantifying peptide and/or RNA, by obtaining a patient tissue sample (e.g., from biopsy tissue) and assaying it in vitro for RNA or peptide levels, structure and/or activity ofthe expressed peptides (or mRNAs of an aforementioned peptide). Methods that are well-known within the art include, but are not limited to, immunoassays (e.g., by Western blot analysis, immunoprecipitation followed by sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis, immunocytochemistry, etc.) and/or hybridization assays to detect expression of mRNAs (e.g., Northern assays, dot blots, in situ hybridization, and the like).

Prophylactic Methods

In one aspect, the invention provides a method for preventing, in a subject, a disease or condition associated with an aberrant MOLX expression or activity, by administering to the subject an agent that modulates MOLX expression or at least one MOLX activity. Subjects at risk for a disease that is caused or contributed to by aberrant MOLX expression or activity can be identified by, for example, any or a combination of diagnostic or prognostic assays as described herein. Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic ofthe MOLX aberrancy, such that a disease or disorder is prevented or, alternatively, delayed in its progression. Depending upon the type of MOLX aberrancy, for example, an MOLX agonist or MOLX antagonist agent can be used for treating the subject. The appropriate agent can be determined based on screening assays described herein. The prophylactic methods of the invention are further discussed in the following subsections.

Therapeutic Methods

Another aspect ofthe invention pertains to methods of modulating MOLX expression or activity for therapeutic purposes. The modulatory method ofthe invention involves contacting a cell with an agent that modulates one or more ofthe activities of MOLX protein activity associated with the cell. An agent that modulates MOLX protein activity can be an agent as described herein, such as a nucleic acid or a protein, a naturally-occurring cognate ligand of an MOLX protein, a peptide, an MOLX peptidomimetic, or other small molecule. In one embodiment, the agent stimulates one or more MOLX protein activity. Examples of such stimulatory agents include active MOLX protein and a nucleic acid molecule encoding MOLX that has been introduced into the cell. In another embodiment, the agent inhibits one or more MOLX protein activity. Examples of such inhibitory agents include antisense MOLX nucleic acid molecules and anti-MOLX antibodies. These modulatory methods can be performed in vitro (e.g., by culturing the cell with the agent) or, alternatively, in vivo (e.g., by administering the agent to a subject). As such, the invention provides methods of treating an individual afflicted with a disease or disorder characterized by aberrant expression or activity of an MOLX protein or nucleic acid molecule. In one embodiment, the method involves administering an agent (e.g., an agent identified by a screening assay described herein), or combination of agents that modulates (e.g., up-regulates or down-regulates) MOLX expression or activity. In another embodiment, the method involves administering an MOLX protein or nucleic acid molecule as therapy to compensate for reduced or aberrant MOLX expression or activity. Stimulation of MOLX activity is desirable in situations in which MOLX is abnormally downregulated and/or in which increased MOLX activity is likely to have a beneficial effect. One example of such a situation is where a subject has a disorder characterized by aberrant cell proliferation and/or differentiation (e.g., cancer or immune associated disorders). Another example of such a situation is where the subject has a gestational disease (e.g., preclampsia).

Determination of the Biological Effect of the Therapeutic

In various embodiments ofthe invention, suitable in vitro or in vivo assays are performed to determine the effect of a specific Therapeutic and whether its administration is indicated for treatment ofthe affected tissue.

In various specific embodiments, in vitro assays may be performed with representative cells ofthe type(s) involved in the patient's disorder, to determine if a given Therapeutic exerts the desired effect upon the cell type(s). Compounds for use in therapy may be tested in suitable animal model systems including, but not limited to rats, mice, chicken, cows, monkeys, rabbits, and the like, prior to testing in human subjects.

Similarly, for in vivo testing, any ofthe animal model system known in the art may be used prior to administration to human subjects.

Prophylactic and Therapeutic Uses of the Compositions of the Invention

The MOLX nucleic acids and proteins of the invention are useful in potential prophylactic and therapeutic applications implicated in a variety of disorders including, but not limited to: metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, hematopoietic disorders, and the various dyslipidemias, metabolic disturbances associated with obesity, the metabolic syndrome X and wasting disorders associated with chronic diseases and various cancers.

As an example, a cDNA encoding the MOLX protein of the invention may be useful in gene therapy, and the protein may be useful when administered to a subject in need thereof. By way of non-limiting example, the compositions ofthe invention will have efficacy for treatment of patients suffering from: metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, hematopoietic disorders, and the various dyslipidemias. Both the novel nucleic acid encoding the MOLX protein, and the MOLX protein of the invention, or fragments thereof, may also be useful in diagnostic applications, wherein the presence or amount ofthe nucleic acid or the protein are to be assessed. A further use could be as an anti-bacterial molecule (i.e., some peptides have been found to possess anti- bacterial properties). These materials are further useful in the generation of antibodies which immunospecifically-bind to the novel substances ofthe invention for use in therapeutic or diagnostic methods.


Example 1. Quantitative expression analysis of clones in various cells and tissues The quantitative expression of various clones was assessed using microtiter plates containing RNA samples from a variety of normal and pathology-derived cells, cell lines and tissues using real time quantitative PCR (RTQ PCR; TAQMAN®). RTQ PCR was performed on a Perkin-Elmer Biosystems ABI PRISM® 7700 Sequence Detection System. Various collections of samples are assembled on the plates, and referred to as Panel 1 (containing cells and cell lines from normal and cancer sources), Panel 2 (containing samples derived from tissues, in particular from surgical samples, from normal and cancer sources), Panel 3 (containing samples derived from a wide variety of cancer sources), Panel 4 (containing cells and cell lines from normal cells and cells related to inflammatory conditions) and Panel CNSD.01 (containing samples from normal and diseased brains).

First, the RNA samples were normalized to constitutively expressed genes such as β -actin and GAPDH. RNA (-50 ng total or ~1 ng polyA+) was converted to cDNA using the TAQMAN® Reverse Transcription Reagents Kit (PE Biosystems, Foster City, CA; Catalog No. N808-0234) and random hexamers according to the manufacturer's protocol. Reactions were performed in 20 ul and incubated for 30 min. at 48°C. cDNA (5 ul) was then transferred to a separate plate for the TAQMAN® reaction using β-actin and GAPDFI TAQMAN® Assay Reagents (PE Biosystems; Catalog Nos. 431088 IE and 4310884E, respectively) and TAQMAN® universal PCR Master Mix (PE Biosystems; Catalog No. 4304447) according to the manufacturer's protocol. Reactions were performed in 25 ul using the following parameters: 2 min. at 50°C; 10 min. at 95°C; 15 sec. at 95°C/1 min. at 60°C (40 cycles). Results were recorded as CT values (cycle at which a given sample crosses a threshold level of fluorescence) using a log scale, with the difference in RNA concentration between a given sample and the sample with the lowest CT value being represented as 2 to the power of delta CT. The percent relative expression is then obtained by taking the reciprocal of this RNA difference and multiplying by 100. The average CT values obtained for β-actin and GAPDH were used to normalize RNA samples. The RNA sample generating the highest CT value required no further diluting, while all other samples were diluted relative to this sample according to their β -actin /GAPDH average CT values.

Normalized RNA (5 ul) was converted to cDNA and analyzed via TAQMAN® using One Step RT-PCR Master Mix Reagents (PE Biosystems; Catalog No. 4309169) and gene-specific primers according to the manufacturer's instructions. Probes and primers were designed for each assay according to Perkin Elmer Biosystem's Primer Express Software package (version I for Apple Computer's Macintosh Power PC) or a similar algorithm using the target sequence as input. Default settings were used for reaction conditions and the following parameters were set before selecting primers: primer concentration = 250 nM, primer melting temperature (Tm) range = 58°-60° C, primer optimal Tm = 59° C, maximum primer difference = 2° C, probe does not have 5' G, probe Tm must be 10° C greater than primer Tm, amplicon size 75 bp to 100 bp. The probes and primers selected (see below) were synthesized by Synthegen (Houston, TX, USA). Probes were double purified by HPLC to remove uncoupled dye and evaluated by mass spectroscopy to verify coupling of reporter and quencher dyes to the 5' and 3' ends of the probe, respectively. Their final concentrations were: forward and reverse primers, 900 nM each, and probe, 200nM.

PCR conditions:

Normalized RNA from each tissue and each cell line was spotted in each well of a

96 well PCR plate (Perkin Elmer Biosystems). PCR cocktails including two probes (a probe specific for the target clone and another gene-specific probe multiplexed with the target probe) were set up using IX TaqMan™ PCR Master Mix for the PE Biosystems 7700, with 5 mM MgC12, dNTPs (dA, G, C, U at 1 :1 : 1 :2 ratios), 0.25 U/ml AmpliTaq Gold™ (PE Biosystems), and 0.4 UA '1 RNase inhibitor, and 0.25 U/μl reverse transcriptase. Reverse transcription was performed at 48° C for 30 minutes followed by amplification/PCR cycles as follows: 95° C 10 min, then 40 cycles of 95° C for 15 seconds, 60° C for 1 minute.

In the results for Panel 1 , the following abbreviations are used: ca. = carcinoma,

* = established from metastasis, met = metastasis, s cell var= small cell variant, non-s = non-sm =non-small, squam = squamous, pi. eff = pi effusion = pleural effusion, glio = glioma, astro = astrocytoma, and neuro = neuroblastoma.

Panel 2

The plates for Panel 2 generally include 2 control wells and 94 test samples composed of RNA or cDNA isolated from human tissue procured by surgeons working in close cooperation with the National Cancer Institute's Cooperative Human Tissue Network (CHTN) or the National Disease Research Initiative (NDRI). The tissues are derived from human malignancies and in cases where indicated many malignant tissues have "matched margins" obtained from noncancerous tissue just adjacent to the tumor. These are termed normal adjacent tissues and are denoted "NAT" in the results below. The tumor tissue and the "matched margins" are evaluated by two independent pathologists (the surgical pathologists and again by a pathologists at NDRI or CHTN). This analysis provides a gross histopathological assessment of tumor differentiation grade. Moreover, most samples include the original surgical pathology report that provides information regarding the clinical stage ofthe patient. These matched margins are taken from the tissue surrounding (i.e. immediately proximal) to the zone of surgery (designated "NAT", for normal adjacent tissue, in Table RR). In addition, RNA and cDNA samples were obtained from various human tissues derived from autopsies performed on elderly people or sudden death victims (accidents, etc.). These tissues were ascertained to be free of disease and were purchased from various commercial sources such as Clontech (Palo Alto, CA), Research Genetics, and Invitrogen.

RNA integrity from all samples is controlled for quality by visual assessment of agarose gel electropherograms using 28S and 18S ribosomal RNA staining intensity ratio as a guide (2:1 to 2.5: 1 28s: 18s) and the absence of low molecular weight RNAs that would be indicative of degradation products. Samples are controlled against genomic DNA contamination by RTQ PCR reactions run in the absence of reverse transcriptase using probe and primer sets designed to amplify across the span of a single exon.

Panel 3D

The plates of Panel 3D are comprised of 94 cDNA samples and two control samples. Specifically, 92 of these samples are derived from cultured human cancer cell lines, 2 samples of human primary cerebellar tissue and 2 controls. The human cell lines are generally obtained from ATCC (American Type Culture Collection, Manassas, VA), National Cancer Institute or the German tumor cell bank and fall into the following tissue groups: Squamous cell carcinoma of the tongue, breast cancer, prostate cancer, melanoma, epidermoid carcinoma, sarcomas, bladder carcinomas, pancreatic cancers, kidney cancers, leukemias/lymphomas, ovarian/uterine/cervical, gastric, colon, lung and CNS cancer cell lines. In addition, there are two independent samples of cerebellum. These cells are all cultured under standard recommended conditions and RNA extracted using the standard procedures. The cell lines in panel 3D and 1.3D are of the most common cell lines used in the scientific literature.

RNA integrity from all samples is controlled for quality by visual assessment of agarose gel electropherograms using 28S and 18S ribosomal RNA staining intensity ratio as a guide (2: 1 to 2.5:1 28s: 18s) and the absence of low molecular weight RNAs that would be indicative of degradation products. Samples are controlled against genomic DNA contamination by RTQ PCR reactions run in the absence of reverse transcriptase using probe and primer sets designed to amplify across the span of a single exon.

Panel 4

Panel 4 includes samples on a 96 well plate (2 control wells, 94 test samples) composed of RNA (Panel 4r) or cDNA (Panel 4d) isolated from various human cell lines or tissues related to inflammatory conditions. Total RNA from control normal tissues such as colon and lung (Stratagene ,La Jolla, CA) and thymus and kidney (Clontech) were employed. Total RNA from liver tissue from cirrhosis patients and kidney from lupus patients was obtained from BioChain (Biochain Institute, Inc., Hayward, CA). Intestinal tissue for RNA preparation from patients diagnosed as having Crohn's disease and ulcerative colitis was obtained from the National Disease Research Interchange (NDRI) (Philadelphia, PA). Astrocytes, lung fibroblasts, dermal fibroblasts, coronary artery smooth muscle cells, small airway epithelium, bronchial epithelium, microvascular dermal endothelial cells, microvascular lung endothelial cells, human pulmonary aortic endothelial cells, human umbilical vein endothelial cells were all purchased from Clonetics (Walkersville, MD) and grown in the media supplied for these cell types by Clonetics. These primary cell types were activated with various cytokines or combinations of cytokines for 6 and/or 12- 14 hours, as indicated. The following cytokines were used; IL-1 beta at approximately 1-5 ng/ml, TNF alpha at approximately 5-10 ng/ml, IFN gamma at approximately 20-50 ng/ml, IL-4 at approximately 5-10 ng/ml, IL-9 at approximately 5-10 ng/ml, IL-13 at approximately 5-10 ng/ml. Endothelial cells were sometimes starved for various times by culture in the basal media from Clonetics with 0.1% serum.

Mononuclear cells were prepared from blood of employees a CuraGen Corporation, using Ficoll. LAK cells were prepared from these cells by culture in DMEM 5% FCS (Hyclone), 100 μM non essential amino acids (Gibco/Life Technologies, Rockville, MD), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10° M (Gibco), and 10 mM Hepes (Gibco) and Interleukin 2 for 4-6 days. Cells were then either activated with 10-20 ng/ml PMA and 1-2 μg/ml ionomycin, IL-12 at 5-10 ng/ml, IFN gamma at 20-50 ng/ml and IL-18 at 5-10 ng/ml for 6 hours. In some cases, mononuclear cells were cultured for 4-5 days in DMEM 5% FCS (Hyclone), 100 μM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10° M (Gibco), and 10 mM Hepes (Gibco) with PHA (phytohemagglutinin) or PWM (pokeweed mitogen) at approximately 5 μg/ml. Samples were taken at 24, 48 and 72 hours for RNA preparation. MLR (mixed lymphocyte reaction) samples were obtained by taking blood from two donors, isolating the mononuclear cells using Ficoll and mixing the isolated mononuclear cells 1 :1 at a final concentration of approximately 2x106 cells/ml in DMEM 5% FCS (Hyclone), 100 μM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol (5.5 x 10"5 M) (Gibco), and 10 mM Hepes (Gibco). The MLR was cultured and samples taken at various time points ranging from 1- 7 days for RNA preparation. Monocytes were isolated from mononuclear cells using CD 14 Miltenyi Beads, +ve VS selection columns and a Vario Magnet according to the manufacturer's instructions. Monocytes were differentiated into dendritic cells by culture in DMEM 5% fetal calf serum (FCS) (Hyclone, Logan, UT), 100 μiM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10"5 M (Gibco), and 10 mM Hepes (Gibco), 50 ng/ml GMCSF and 5 ng/ml IL-4 for 5-7 days. Macrophages were prepared by culture of monocytes for 5-7 days in DMEM 5% FCS (Hyclone), 100 μM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10"5 M (Gibco), 10 M Hepes (Gibco) and 10% AB Human Serum or MCSF at approximately 50 ng/ml. Monocytes, macrophages and dendritic cells were stimulated for 6 and 12-14 hours with lipopolysaccharide (LPS) at 100 ng/ml. Dendritic cells were also stimulated with anti-CD40 monoclonal antibody (Pharmingen) at 10 μg/ml for 6 and 12-14 hours.

CD4 lymphocytes, CD8 lymphocytes and NK cells were also isolated from mononuclear cells using CD4, CD8 and CD56 Miltenyi beads, positive VS selection columns and a Vario Magnet according to the manufacturer's instructions. CD45RA and CD45RO CD4 lymphocytes were isolated by depleting mononuclear cells of CD8, CD56, CD14 and CD19 cells using CD8, CD56, CD14 and CD19 Miltenyi beads and positive selection. Then CD45RO beads were used to isolate the CD45RO CD4 lymphocytes with the remaining cells being CD45RA CD4 lymphocytes. CD45RA CD4, CD45RO CD4 and CD8 lymphocytes were placed in DMEM 5% FCS (Hyclone), 100 μM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10° M (Gibco), and 10 mM Hepes (Gibco) and plated at 106 cells/ml onto Falcon 6 well tissue culture plates that had been coated overnight with 0.5 μg/ml anti-CD28 (Pharmingen) and 3 iig/ml anti-CD3 (OKT3, ATCC) in PBS. After 6 and 24 hours, the cells were harvested for RNA preparation. To prepare chronically activated CD8 lymphocytes, we activated the isolated CD8 lymphocytes for 4 days on anti-CD28 and anti-CD3 coated plates and then harvested the cells and expanded them in DMEM 5% FCS (Hyclone), 100 μM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10° M (Gibco), and 10 M Hepes (Gibco) and IL-2. The expanded CD8 cells were then activated again with plate bound anti-CD3 and anti-CD28 for 4 days and expanded as before. RNA was isolated 6 and 24 hours after the second activation and after 4 days of the second expansion culture. The isolated NK cells were cultured in DMEM 5% FCS (Hyclone), 100 μM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10° M (Gibco), and 10 mM Hepes (Gibco) and IL-2 for 4-6 days before RNA was prepared.

To obtain B cells, tonsils were procured from NDRI. The tonsil was cut up with sterile dissecting scissors and then passed through a sieve. Tonsil cells were then spun down and resupended at 106 cells/ml in DMEM 5% FCS (Hyclone), 100 μM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10"D M (Gibco), and 10 mM Hepes (Gibco). To activate the cells, we used PWM at 5 μg/ml or anti-CD40 (Pharmingen) at approximately 10 μg/ml and IL-4 at 5-10 ng/ml. Cells were harvested for RNA preparation at 24,48 and 72 hours. To prepare the primary and secondary Thl/Th2 and Trl cells, six-well Falcon plates were coated overnight with 10 μg/ml anti-CD28 (Pharmingen) and 2 μg/ml OKT3 (ATCC), and then washed twice with PBS. Umbilical cord blood CD4 lymphocytes

5 6

(Poietic Systems, German Town, MD) were cultured at 10 -10 cells/ml in DMEM 5% FCS (Hyclone), 100 μiM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10° M (Gibco), 10 mM Hepes (Gibco) and IL-2 (4 ng/ml). IL-12 (5 ng/ml) and anti-IL4 (1 Dg/ml) were used to direct to Thl, while IL-4 (5 ng/ml) and anti-IFN gamma (1 l.jg/ml) were used to direct to Th2 and IL-10 at 5 ng/ml was used to direct to Trl . After 4-5 days, the activated Thl, Th2 and Trl lymphocytes were washed once in DMEM and expanded for 4-7 days in DMEM 5% FCS (Hyclone), 100 μM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10° M (Gibco), 10 mM Hepes (Gibco) and IL-2 (1 ng/ml). Following this, the activated Th l, Th2 and Trl lymphocytes were re-stimulated for 5 days with anti-CD28/OKT3 and cytokines as described above, but with the addition of anti-CD95L (1 ϋg/ml) to prevent apoptosis. After 4-5 days, the Thl, Th2 and Trl lymphocytes were washed and then expanded again with IL-2 for 4-7 days. Activated Thl and Th2 lymphocytes were maintained in this way for a maximum of three cycles. RNA was prepared from primary and secondary Thl, Th2 and Trl after 6 and 24 hours following the second and third activations with plate bound anti-CD3 and anti-CD28 mAbs and 4 days into the second and third expansion cultures in Interleukin 2. The following leukocyte cells lines were obtained from the ATCC: Ramos, EOL-1,

KU-812. EOL cells were further differentiated by culture in 0.1 mM dbcAMP at 5 xlO5 cells/ml for 8 days, changing the media every 3 days and adjusting the cell concentration to 5 xlO3 cells/ml. For the culture of these cells, we used DMEM or RPMI (as recommended by the ATCC), with the addition of 5% FCS (Hyclone), 100 μM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10"5 M (Gibco), 10 mM Hepes (Gibco). RNA was either prepared from resting cells or cells activated with PMA at 10 ng/ml and ionomycin at 1 μg/ml for 6 and 14 hours. Keratinocyte line CCD 106 and an airway epithelial tumor line NCI-H292 were also obtained from the ATCC. Both were cultured in DMEM 5% FCS (Hyclone), 100 μM non essential amino acids (Gibco), 1 mM sodium pyruvate (Gibco), mercaptoethanol 5.5 x 10° M (Gibco), and 10 mM Hepes (Gibco). CCD 1 106 cells were activated for 6 and 14 hours with approximately 5 ng/ml TNF alpha and 1 ng/ml IL-1 beta, while NCI-H292 cells were activated for 6 and 14 hours with the following cytokines: 5 ng/ml IL-4, 5 ng/ml IL-9, 5 ng/ml IL-13 and 25 ng/ml IFN gamma.

For these cell lines and blood cells, RNA was prepared by lysing approximately 107 cells/ml using Trizol (Gibco BRL). Briefly, 1/10 volume of bromochloropropane (Molecular Research Corporation) was added to the RNA sample, vortexed and after 10 minutes at room temperature, the tubes were spun at 14,000 rpm in a Sorvall SS34 rotor. The aqueous phase was removed and placed in a 15 ml Falcon Tube. An equal volume of isopropanol was added and left at -20 degrees C overnight. The precipitated RNA was spun down at 9,000 rpm for 15 min in a Sorvall SS34 rotor and washed in 70% ethanol. The pellet was redissolved in 300 μl of RNAse-free water and 35 μl buffer (Promega) 5 μl DTT, 7 μl RNAsin and 8 μl DNAse were added. The tube was incubated at 37 degrees C for 30 minutes to remove contaminating genomic DNA, extracted once with phenol chloroform and re-precipitated with 1/10 volume of 3 M sodium acetate and 2 volumes of 100% ethanol. The RNA was spun down and placed in

RNAse free water. RNA was stored at -80 degrees C.

Panel CNSD.01

The plates for Panel CNSD.01 include two control wells and 94 test samples comprised of cDNA isolated from postmortem human brain tissue obtained from the Harvard Brain Tissue Resource Center. Brains are removed from calvaria of donors between 4 and 24 hours after death, sectioned by neuroanatomists, and frozen at -80°C in liquid nitrogen vapor. All brains are sectioned and examined by neuropathologists to confirm diagnoses with clear associated neuropathology. Disease diagnoses are taken from patient records. The panel contains two brains from each of the following diagnoses: Alzheimer's disease, Parkinson's disease, Huntington's disease, Progressive Supernuclear Palsy, Depression, and "Normal controls". Within each of these brains, the following regions are represented: cingulate gyrus, temporal pole, globus palladus, substantia nigra, Brodman Area 4 (primary motor strip), Brodman Area 7 (parietal cortex), Brodman Area 9 (prefrontal cortex), and Brodman area 17 (occipital cortex). Not all brain regions are represented in all cases; e.g., Huntington's disease is characterized in part by neurodegeneration in the globus palladus, thus this r region is impossible to obtain from confirmed Huntington's cases. Likewise Parkinson's disease is characterized by degeneration of the substantia nigra making this region more difficult to obtain. Normal control brains were examined for neuropathology and found to be free of any pathology consistent with neurodegeneration.

RNA integrity from all samples is controlled for quality by visual assessment of agarose gel electropherograms using 28S and 18S ribosomal RNA staining intensity ratio as a guide (2: 1 to 2.5: 1 28s: l 8s) and the absence of low molecular weight RNAs that would be indicative of degradation products. Samples are controlled against genomic

DNA contamination by RTQ PCR reactions run in the absence of reverse transcriptase using probe and primer sets designed to amplify across the span of a single exon.

In the labels employed to identify tissues in the CNS panel, the following abbreviations are used:

PSP = Progressive supranuclear palsy

Sub Nigra = Substantia nigra Glob Palladus= Globus palladus Temp Pole = Temporal pole

Cing Gyr = Cingulate gyrus BA 4 = Brodman Area 4

A. MOLla Expression of gene SC29674552_EXT was assessed using the primer-probe sets Ag267 and Agl308, described in Tables 10 and 11. Results of the RTQ-PCR runs are shown in Tables 12, 13, 14, 15, and 16

Table 10. Probe Name Ag267

Figure imgf000233_0001

Table 11. Probe Name: Agl308

Figure imgf000233_0002

Table 12. Panel 1

Figure imgf000233_0003

Figure imgf000234_0001

Table 13. Panel 1.2

Figure imgf000234_0002
Figure imgf000235_0001
Figure imgf000236_0001

Table 14. Panel 2D

Figure imgf000236_0002
Figure imgf000237_0001
Figure imgf000238_0001

Table 15. Panel 2.2

Figure imgf000238_0002
Figure imgf000239_0001
Figure imgf000240_0001

Table 16. Panel 4D

Figure imgf000240_0002
Figure imgf000241_0001

Figure imgf000242_0001

Panel 1 Summary: Ag267 Among the normal tissues on this panel, highest expression of the MOLla gene is detected in testis (CT value = 25) and adipose. High expression in adipose might suggest that the MOLla gene plays a role in the development of metabolic diseases, such as obesity or diabetes. In addition, expression of this gene is high in a renal cancer cell line (CT value = 25). Moderate expression of the MOLla gene is also seen in most regions of normal brain. Strikingly, the MOLla transcript appears at much higher levels in a number of CNS cancer cell lines. Therefore, inhibition of the MOLla gene product using a monoclonal antibody and/or small molecule therapeutic may be useful for the treatment of some renal cell and CNS carcinomas.

Panel 1.2 Summary: Ag267 Expression of the MOLla gene is highest in the cerebral cortex (CT value = 25) with more moderate expression detected in most other regions of normal brain, suggesting a role for this gene in neurological function. Consistent with the results seen in Panel 1, this gene is strikingly overexpressed in a number of CNS cancer cell lines (specifically glioma and astrocytoma). Moderate overexpression of the MOLla gene is also detected in renal cell cancer and lung cancer cell lines relative to the normal controls. The MOLla gene product displays moderate similarity to the Notch protein that has been shown to be involved in cell signalling and has been implicated in oncogenesis. Therefore, the MOLla gene may be a good marker for CNS or other cancers and would potentially serve as a good drug target for the treatment of certain cancers. This gene is also well expressed in several metabolic tissues (specifically adipose, liver and pancreas) and may thus have application for the treatment of metabolic diseases such as diabetes and obesity. Of particular interest is the good expression (CT value = 30.6) in pancreas. The human pancreas-specific gene SEL-11 is thought to be a negative regulator of the notch receptor (Harada, Y. et al. J Hum Genet 44(5):330-6, 1999). Thus, the notch-like MOLla gene and notch receptor may have potential therapeutic use in diseases involving the pancreas.

Panel 1.3D Summary: Ag267 Among normal tissues, highest MOLl a transcript levels are found in adipose (CT value = 30). As was seen for Panels 1 and 1.2, moderate expression of this gene is detected in most regions of normal brain and the gene is strikingly over expressed in a number of CNS cancer cell lines. In general, expression of the MOLla gene appears to be higher in cell lines when compared to tissue samples. A cluster of expression associated with brain, breast and renal cancer cell lines is evident. Thus, the expression of this gene could be associated with cancer cells when compared to normal, since these cell lines are derived from cancers. Alternatively, the expression of this gene could be associated with cell division, since a high percentage of cells in culture are actively dividing when compared to cells in tissue.

Panel 2D Summary: Ag267 Expression of the MOLla gene in panel 2D appears to be widespread across most of the samples. However, there seems to be significant dysregulation in breast cancers when compared to normal adjacent tissues. Thus, therapeutic modulation of this gene might show utility in the treatment of breast cancers.

Panel 2.2 Summary: Agl308 The expression of this gene appears to be widespread across most ofthe samples in panel 2.2. In a couple of instances of renal cell cancer, there seems to be significant dysregulation ofthe expression of this gene when compared to normal adjacent tissue. Thus, therapeutic modulation of this gene might be useful in the treatment of a sub-set of renal cancers.

Panel 4D Summary: Ag267/Agl308 The MOL la transcript is broadly expressed in fibroblasts, keratinocytes, B cells, and T cells, although at a moderate level. High expression of the transcript is also found in monocytes, whether activated or not. In addition, the transcript is up-regulated (7 fold) in keratinocytes and small airway epitheliun by treatment with TNFa and IL-1. The Notch-like protein encoded by the

MOLla gene may regulate cell survival based on its homology to other Notch proteins.

Therefore, protein therapeutics (agonist or antagonists) against the MOLla gene product may be beneficial in the treatment of lung diseases, such as asthma and emphysema, or in the treatment of skin diseases, such as psoriasis and contact sensitivity.


Expression of gene MOL2 was assessed using the primer-probe set Ag2120, described in Table 17. Results ofthe RTQ-PCR runs are shown in Tables 18, 19, 20, and 21

Table 17. Probe Name Ag2120

Figure imgf000244_0001

Table 18. Panel 1.3D

Figure imgf000244_0002
Figure imgf000245_0001

Figure imgf000246_0001

Table 19. Panel 2D

Figure imgf000246_0002
Figure imgf000247_0001
Figure imgf000248_0001
Figure imgf000249_0001

Table 20. Panel 4D

Figure imgf000249_0002
Figure imgf000250_0001

Figure imgf000251_0001

Table 21. Panel CNSD.01

Figure imgf000251_0002

Figure imgf000252_0001

Panel 1.3D Summary: Ag2120 Two replicate experiments using the same probe and primer set show very comparable results. Expression of the MOL2 gene is highest in the cerebral cortex (CT value = 29). Moderate expression is detected in all other regions ofthe brain except thalamus and substantia nigra; this observation suggests that the MOL2 gene may be associated with normal brain homeostasis. Thus, this protein shows a brain- preferential expression; see write-up on Panel CNS.01 for discussion of utility. In addition, expression of the MOL2 gene appears to be down-regulated in CNS cancer cell lines. Overexpression ofthe MOL2 gene is also detected in several lung cancer cell lines relative to normal control. Therefore, this gene might be a good target for the detection or treatment of CNS and lung cancers. Panel 2D Summary: Ag2120 Two replicate experiments using the same probe and primer set show very comparable results. Expression ofthe MOL2 gene in panel 2D reveals an association of expression in thyroid, breast and kidney cancers when compared to their respective normal adjacent tissues. Thus, therapeutic modulation of this gene with inhibitory monoclonal antibodies and/or small moleculte therapeutics may show utility in treatment of these diseases. In addition, the MOL2 gene might be useful as a marker for thyroid, breast and kidney cancers.

Panel 4D Summary: Ag 2120 The MOL2 gene is expressed at highest levels in the thymus (CT value =31), In addition, the transcript is also expressed in eosinophils, monocytes, macrophages and coronary artery. Interestingly, it is down regulated in LPS- treated monocytes and to a lesser degree in LPS treated macrophages. Therefore, protein therapeutics (agonists or antagonists) designed against the protein encoded for by this transcript could reduce inflammatory process observed in asthma, emphysema, osteoarthritis and sepsis. Panel CNSD.01 Summary: Ag2120 The insulin and insulin-like growth factors belong to a family of polypeptides essential for proper regulation of physiologic processes such as energy metabolism, cell proliferation, development, and differentiation. The insulin-like growth factors bind to IGF with high affinity and compete with the IGF receptor for IGF binding. Transgenic mice overexpressing insulin-like growth factor binding proteins (IGFBPs) tend to show brain developmental abnormalities, suggesting a role for these proteins in neurodevelopment. Furthermore, treatment with glycosaminoglycans (which increases muscle re-innervation after motor neuron death) upregulates serum levels of both IGF and IGFBP. Thus, the novel IGFBP encoded by the MOL2 gene may be useful in the treatment of diseases such as ALS, multiple sclerosis, and peripheral nerve injury on the basis of its homology to other established IGFBPs. The expression profile of this gene suggests that it is expressed preferentially in the brain, with highest levels in the cerebral cortex and hippocampus, two regions that are known to degenerate in Alzheimer's disease. Examination of the expression profile on Panel CNS.01 shows that most regions of both control and diseased brains express this protein; however the levels are decreased in the motor cortex in progressive supranuclear palsy and depression. Thus, this protein may additionally be of use in the treatment of Alzheimer's disease, progressive supranuclear palsy, and depression. C. MOL3a

Expression of gene MOL3a was assessed using the primer-probe set Agl493, described in Table 22. Results of the RTQ-PCR runs are shown in Tables 23, 24, 25, and 26.

Table 22. Probe Name Agl493

Figure imgf000254_0001

Table 23. Panel 1.2

Figure imgf000254_0002

Figure imgf000255_0001

Table 24. Panel 1.3D

Figure imgf000255_0002
Figure imgf000256_0001
Table 25. Panel 2D

Figure imgf000257_0001

Figure imgf000258_0001

Table 26. Panel 4.1D

Figure imgf000259_0001
Figure imgf000260_0001
Figure imgf000261_0001

Table 27. Panel CNSD.01

Figure imgf000261_0002

Figure imgf000262_0001

Panel 1.2 Summary: Agl493 The high expression ofthe MOL3a gene seen in adipose (CT value = 25) is most likely skewed due to genomic DNA contamination in this sample. Otherwise, the gene is expressed mainly in normal tissues, including brain (particularly cerebral cortex), kidney, and prostate. Expression ofthe MOL3a gene in skeletal muscle and liver may suggest function in metabolic diseases, including obesity and diabetes. Furthermore, MOL3a expression is down regulated in a number of tumor cell lines relative to the normal controls suggesting a potential utility of this gene in the treatment of cancer.

Panel 1.3D Summary: Agl493 In this panel, highest expression of the MOL3a gene is detected in the amygdala ofthe brain (CT value = 29.6). This may suggest that the MOL3a gene plays a role in normal brain function, including fear and anxiety response. In addition, high expression is also observed in adipose and bone marrow suggesting potential roles in metabolic and immune function. Overall, expression ofthe MOL3a gene in panel 1.3D reveals that it is associated mostly with normal tissues. In a couple of instances, the expression of this gene is seen in clusters of cell lines, specifically in breast and ovarian cancer cell lines. Thus, therapeutic modulation of expression of this gene may be of utility in the treatment breast and ovarian cancers. Alternatively, replacement ofthe MOL3a protein that is missing from some cancer cells using recombinant protein might provide a useful treatment for these types of cancers. Panel 2D Summary: Agl493 Expression ofthe MOL3a gene is highest in thyroid and appears to be widespread across many samples on Panel 2D. However, overall there appears to be generally higher expression in normal tissues when compared to cancerous counterparts. Thus, therapeutic modulation of this gene or gene product might show utility for a range of oncology indications. Semaphorins and their receptors are known signals for axon guidance; they are also suspected to regulate developmental processes involving cell migration and morphogenesis, and have been implicated in immune function and tumor progression.

Panel 4.1D Summary: Agl493 The MOL3a transcript is highly expressed in a B cell line as well as in B cells stimulated with CD40L and IL4. Expression of this transcript is also found to a lesser degree in monocytes and macrophages independently of their activation status. Of interest, CD 100, which is an activation molecule on T cells, is a member of the semaphorin protein family. The semaphorin B-like protein encoded by the MOL3a transcript could therefore also serve as a B cell activation marker. The semaphorin family has additionally been reported to play a role in che otaxis. Thus, protein therapeutics or monoclonal antibodies raised against the MOL3a protein, could inhibit spontaneous and chemokine induced migration of B cells and monocytes and potentially regulate B cell differentiation and B cell isotype switching. Regulation of this molecule by protein therapeutics or monoclonal antibodies could also function to regulate immunity and be important for the treatment of autoimmune diseases, allergic diseases, and immune rejection in transplantation. In support of this hypothesis, recent studies indicate that semaphorins bind with high affinity to at least two different receptor families and are biologically active on immune cells as well as neuronal cells (Curr Opin Immunol 1999 Aug;l l(4):387-91). Panel CNSD.01 Summary: Agl493 Semaphorins can act as axon guidance proteins, specifically through their ability to act as chemorepellents that inhibit CNS regenerative capacity. Although there is considerable variance between individuals in MOL3a gene expression levels in this panel, levels of this protein are reduced to less than 1/3 of that seen in controls in the temporal cortex of Alzheimer's patients (which shows marked synaptogenic loss in mid to late phases of the disease) as well as in diseases not associated with neurodegeneration of the temporal cortex. Therefore, manipulation of levels of this protein may be of use in inducing a compensatory synaptogenic response to neuronal death in Alzheimer's disease. D. MOL4a

Expression of gene MOL4a was assessed using the primer-probe set Agl216, described in Table 28. Results of the RTQ-PCR runs are shown in Tables 29, 30, 31, and


Table 28. Probe Name: Agl216

Figure imgf000264_0001

Table 29. Panel 1.2

Figure imgf000264_0002

Figure imgf000265_0001

Table 30. Panel 2.2

Figure imgf000265_0002
Figure imgf000266_0001

Figure imgf000267_0001

Table 31. Panel 4D

Figure imgf000267_0002
Figure imgf000268_0001
Figure imgf000269_0001
Figure imgf000270_0001

Panel 32. Panel CNSD.01

Figure imgf000270_0002

Figure imgf000271_0001

Panel 1.2 Summary: Agl216 The MOL4a gene is well expressed in a variety of normal tissues including kidney, heart, brain, thymus and lung. Of interest is the robust expression in activated endothelial cells, which may indicate that this gene is important for angiogenesis or lymphocyte trafficking. Inflammatory lymphocytes preferentially traffic into tissues by crossing activated endothelium. Expression of the MOL4a gene appears to be up regulated in renal cell carcinomas. In contrast, expression of the MOL4a gene is down regulated in a number of cancer cell lines (including pancreatic, CNS, breast, and lung) relative to the normal controls. No expression of this gene is detected in a variety of melanoma cell lines. Therefore, modulation of MOL4a gene function may provide an effective treatment for a variety of cancers.

Panel 2.2 Summary: Agl216 Expression ofthe MOL4a gene appears to be associated with kidney cancers. This is in good agreement with the data obtained in Panel 1.2 and suggests that therapeutic modulation of this gene using inhibitory monoclonal antibodies or small molecules may prove useful in the treatment of kidney cancers. In addition, the MOL4a gene may be a useful marker for the detection of renal cell carcinomas.

Panel 4D Summary: Agl216 Two replicate experiments using the same probe and primer set were in good agreement. The MOL4a transcript is highly expressed in thymus. To a much lesser degree, the transcript is also expressed in the lung as well as in small airway epithelium treated with TNF-a and IL-lb. Therefore, protein therapeutics designed against the protein encoded for by this transcript could reduce inflammation in asthma or other lung disease such as emphysema.

Panel CNSD.01 Summary: Agl216 Semaphorins can act as axon guidance proteins, specifically through their ability to act as chemorepellents that inhibit CNS regenerative capacity. Manipulation of levels ofthe MOL4a semaphorin-like protein may therefore be of use in inducing a compensatory synaptogenic response to neuronal death in Alzheimer's disease, Parkinson's disease, Huntington's disease, spinocerebellar ataxia, progressive supranuclear palsy, multiple sclerosis, ALS, head trauma, stroke, or any other disease/condition associated with neuronal loss. MOL4b

Table A Agl216

Figure imgf000272_0001

Table AA. Panel 1.2

Figure imgf000272_0002
Figure imgf000273_0001
Figure imgf000274_0001

Table AB. Panel 2.2

Figure imgf000274_0002
Figure imgf000275_0001
Figure imgf000276_0001

Table AC. Panel 4D

Figure imgf000276_0002
Figure imgf000277_0001
Figure imgf000278_0001

Potential Role(s) of MOL4b in Tumorgenesis: Semaphorins are cell surface receptors involved in axon guidance molecules with chemorepulsive activity, and are suggested to play a major role in navigating axonal networks throughout development into their correct destinations. They have been found to act as receptor for neurophilin both in neuronal and non-neuronal cell, specifically endothelial cells. Panel 1 indicate that MOL4b is induced in activated endothelial cells and it is expressed by tumor cell derived from Kidney and ovarian tumors. It therefore likely that in these cell types, MOL4b expression contributes to migration and survival activities Impact of therapeutic targeting of MOL4b: Therapeutic targeting with a human monoclonal antibody of MOL4b might block the migration of cancer cells, and/or supporting stromal elements, specifically endothelial cells, and promote cell death rather than cell survival especially in those cancer types, like kidney and ovarian tumors where the gene is overexpressed in the tumor compared to the normal adjacent tissue

E. MOL5a

Expression of gene MOL5a was assessed using the primer-probe sets Agl215 and Agl382 (identical sequences), described in Tables 33 and 34. Results of the RTQ-PCR runs are shown in Tables 35, 36, and 37.

Table 33. Probe Name Agl215/Agl382

Figure imgf000279_0001

Table 34. Panel 1.2

Figure imgf000279_0002
Figure imgf000280_0001

Figure imgf000281_0001

Table 35. Panel 2.2

Figure imgf000281_0002
Figure imgf000282_0001

Figure imgf000283_0001

Panel 36. Panel 4D

Relative Relative

Expression(%_ )|Expression(%)

4Dtm2070f_ 4Dtm2425t_

Tissue Name ag!215 ag!382

Figure imgf000284_0001
Figure imgf000285_0001

Figure imgf000286_0001

Table 37. Panel CNSD.01

Figure imgf000286_0002

Figure imgf000287_0001

Panel 1.2 Summary: Agl215/Agl382 Two replicate experiments were performed using probe and primer sets of identical sequences; however, relatively disparate results were obtained on this panel. For Agl215, the MOL5a gene is expressed at high levels across most of the tissues on this panel with highest expression in treated endothelial cells (CT value = 23). For Agl382, the MOL5a gene is expressed at high levels across most ofthe tissues on this panel with highest expression in an ovarian cancer cell line (CT value = 22). To summarize the expression profile, there appears to be widespread expression of the MOL5a gene in a number of tissues and cell lines. Furthermore, the expression of this gene seems to be associated with reproductive tissues and cancer cell lines whose origins are such. For instance, there is significant expression in ovarian cell lines, breast cell lines and placenta tissue. There is also moderate expression in kidney tissues and lung cell lines.

Panel 2.2 Summary: Agl215 There appears to be widespread expression of the MOL5a gene in the samples of panel 2.2. Specifically, there seems to be an association of expression in breast cancer and normal ovarian tissue. This is reasonably consistent with the results obtained from Panel 1.2. In addition, there is also some correlation with expression in normal kidney tissue when compared to kidney cancers, also consistent with the observations in Panel 1.2. Thus, therapeutic modulation of this gene or gene product might show utility in the treatment of breast cancer, ovarian cancer or kidney cancer.

Panel 4D Summary: Agl215/Agl382 Results from two replicate experiments performed using probe and primer sets of identical sequences are in reasonable agreement. The MOL5a transcript is widely expressed in cell lines from this panel (CT values = 25- 30), including thymus, lung, muco-epidermoid cell lines, fibroblasts from diverse origin, and activated T cells. In addition, the MOL5a gene is expressed in normal colon but not in colons from patients with Crohn's disease or colitis. Thus, protein therapeutics designed with the putative semaphorin encoded for by this protein could reduce or eliminate inflammation and tissue destruction due to IBD. High expression of this transcript was found on primary resting Thl T cells, and also primary resting Th2 and Trl T cells. The high expression of this transcript in secondary T cells treated with CD95 suggests that this transcript encodes for a protein involved in activation of cell death. Furthermore, high expression of the MOL5A transcript is also found in activated basophils and eosinophils, suggesting a role for this protein in allergic disorder such as asthma, contact hypersensitivity, and hypersensitive immediate reactions. Antibody or protein therapeutics designed against the protein encoded for by this transcript could therefore reduce or inhibit inflammation in allergy, asthma, emphysema, psoriasis and/or autoimmunity.

Panel CNSD.01 Summary: Agl215 Semaphorins can act as axon guidance proteins, specifically through their ability to act as chemorepellents that inhibit CNS regenerative capacity. Manipulation of levels ofthe MOL4 semaphorin-like protein may therefore be of use in inducing a compensatory synaptogenic response to neuronal death in Alzheimer's disease, Parkinson's disease, Huntington's disease, spinocerebellar ataxia, progressive supranuclear palsy, multiple sclerosis, ALS, head trauma, stroke, or any other disease/condition associated with neuronal loss.

F. MOL5d

Table BA. Probe Name: Agl215

Figure imgf000288_0001
Figure imgf000289_0001

Table BC. Panel 1.2

Figure imgf000289_0002
Figure imgf000290_0001
Figure imgf000291_0001

Table BD. Panel 2.2

Figure imgf000291_0002
Figure imgf000292_0001
Figure imgf000293_0001

Table BE. Panel 4D

Figure imgf000293_0002
Figure imgf000294_0001
Figure imgf000295_0001

Table BF. Panel 1.2

Figure imgf000295_0002
Figure imgf000296_0001
Figure imgf000297_0001

Table BG. Panel 4D

Figure imgf000297_0002
Figure imgf000298_0001
Figure imgf000299_0001

Table BH. Panel 1.4

Figure imgf000299_0002
Figure imgf000300_0001
Figure imgf000301_0001

Table Bl. Panel 3.2

Figure imgf000301_0002
Figure imgf000302_0001
Figure imgf000303_0001

Table BJ. Panel Hass

Figure imgf000303_0002


Figure imgf000304_0001
Figure imgf000305_0001

Example 2: TaqMan Data for MOL7

TaqMan data was acquired for MOL7 as described in Eaxample 1 using the primers specified. The relative expression of MOL7 in the described tissues is represented in the graphs below.


Figure imgf000306_0001

Figure imgf000307_0001

305 Example 3 SeqCallingTM Technology cDNA was derived from various human samples representing multiple tissue types, normal and diseased states, physiological states, and developmental states from different donors. Samples were obtained as whole tissue, cell lines, primary cells or tissue cultured primary cells and cell lines. Cells and cell lines may have been treated with biological or chemical agents that regulate gene expression for example, growth factors, chemokines, steroids. The cDNA thus derived was then sequenced using CuraGen's proprietary SeqCalling technology. Sequence traces were evaluated manually and edited for corrections if appropriate. cDNA sequences from all samples were assembled with themselves and with public ESTs using bioinformatics programs to generate CuraGen's human SeqCalling database of SeqCalling assemblies. Each assembly contains one or more overlapping cDNA sequences derived from one or more human samples. Fragments and ESTs were included as components for an assembly when the extent of identity with another component ofthe assembly was at least 95% over 50 bp. Each assembly can represent a gene and/or its variants such as splice forms and/or single nucleotide polymorphisms (SNPs) and their combinations.

Variant sequences are included in this application. A variant sequence can include a single nucleotide polymorphism (SNP). A SNP can, in some instances, be referred to as a "cSNP" to denote that the nucleotide sequence containing the SNP originates as a cDNA. A SNP can arise in several ways. For example, a SNP may be due to a substitution of one nucleotide for another at the polymorphic site. Such a substitution can be either a transition or a transversion. A SNP can also arise from a deletion of a nucleotide or an insertion of a nucleotide, relative to a reference allele. In this case, the polymorphic site is a site at which one allele bears a gap with respect to a particular nucleotide in another allele. SNPs occurring within genes may result in an alteration ofthe amino acid encoded by the gene at the position ofthe SNP. Intragenic SNPs may also be silent, however, in the case that a codon including a SNP encodes the same amino acid as a result ofthe redundancy ofthe genetic code. SNPs occurring outside the region of a gene, or in an intron within a gene, do not result in changes in any amino acid sequence of a protein but may result in altered regulation ofthe expression pattern for example, alteration in temporal expression, physiological response regulation, cell type expression regulation, intensity of expression, stability of transcribed message. Method of novel SNP Identification: SNPs are identified by analyzing sequence assemblies using CuraGen's proprietary SNPTool algorithm. SNPTool identifies variation in assemblies with the following criteria: SNPs are not analyzed within 10 base pairs on both ends of an alignment; Window size (number of bases in a view) is 10; The allowed number of mismatches in a window is 2; Minimum SNP base quality (PHRED score) is 23; Minimum number of changes to score an SNP is 2/assembly position. SNPTool analyzes the assembly and displays SNP positions, associated individual variant sequences in the assembly, the depth of the assembly at that given position, the putative assembly allele frequency, and the SNP sequence variation. Sequence traces are then selected and brought into view for manual validation. The consensus assembly sequence is imported into CuraTooIs along with variant sequence changes to identify potential amino acid changes resulting from the SNP sequence variation. Comprehensive SNP data analysis is then exported into the SNPCalling database.

Method of novel SNP Confirmation: SNPs are confirmed employing a validated method know as Pyrosequencing (Pyrosequencing, Westborough, MA). Detailed protocols for Pyrosequencing can be found in:

Alderborn et al. Determination of Single Nucleotide Polymorphisms by Real-time Pyrophosphate DNA Sequencing. (2000). Genome Research. 10, Issue 8, August. 1249- 1265. In brief, Pyrosequencing is a real time primer extension process of genotyping.

This protocol takes double-stranded, biotinylated PCR products from genomic DNA samples and binds them to streptavidin beads. These beads are then denatured producing single stranded bound DNA. SNPs are characterized utilizing a technique based on an indirect bioluminometric assay of pyrophosphate (PPi) that is released from each dNTP upon DNA chain elongation. Following Klenow polymerase-mediated base incorporation, PPi is released and used as a substrate, together with adenosine 5'-phosphosulfate (APS), for ATP sulfurylase, which results in the formation of ATP. Subsequently, the ATP accomplishes the conversion of luciferin to its oxi-derivative by the action of luciferase. The ensuing light output becomes proportional to the number of added bases, up to about four bases. To allow processivity of the method dNTP excess is degraded by apyrase, which is also present in the starting reaction mixture, so that only dNTPs are added to the template during the sequencing. The process has been fully automated and adapted to a 96-well format, which allows rapid screening of large SNP panels. Example 4 SAGE data

Serial Analysis of Gene Expression, or SAGE, is an experimental technique designed to gain a quantitative measure of gene expression. The SAGE technique itself includes several steps utilizing molecular biological, DNA sequencing and bioinformatics techniques. These steps (reviewed in Adams MD, "Serial analysis of gene expression:

ESTs get smaller." Bioessays. 18(4):261-2 (1996)) have been used to produce 9 or 10 base "tags", which are then, in some manner, assigned gene descriptions. For experimental reasons, these tags are immediately adjacent to the 3' end ofthe 3'-mostNlaIlI restriction site in cDNA sequences. The Cancer Genome Anatomy Project, or CGAP, is an NCI- initiated and sponsored project, which hopes to delineate the molecular fingerprint ofthe cancer cell. It has created a database of those cancer-related projects that used SAGE analysis in order to gain insight into the initiation and development of cancer in the human body. The SAGE expression profiles reported in this invention are generated by first identifying the Unigene accession ID associated with the given MTC gene by querying the Unigene database at This page has then a link to the SAGE : Gene to Tag mapping ("unigenelD").

This generated the reports that are included in this application, which list the number of tags found for the given gene in a given sample along with the relative expression. This information is then used to understand whether the gene has a more general role in tumorogenesis and/or tumor progression. A list ofthe SAGE libraries generated by CGAP and used in the analysis can be found at


SAGE data

Hs 6138- : KIAA1445 rjrotein

SAGE library data and reliable tag summarr

Reliable tags found m SAGE libraries

Tagsper Tag

Li&rarr name million ratal tags

SAGE Duke 1273 51 <■*> 2 3SS36

SAGE Duke HI D_π 19 1 52371

SAGE ooolerl GBlJΪ 32 2 61841

SAGE Duke mhh-1 20 1 4S4S8

SAGE Meso-12 28 1 35032

SAGE Duke H247.ιormal 33 Λ* 2 60543

SAGE Duke H1043 26 2 7ι5673 NOV5d SAGE data

SAGE data

Figure imgf000311_0001

Example 5. Identification of NOVX clones

The novel target sequences identified in the present invention were subjected to the exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. Table AAO shows the sequences ofthe PCR primers used for obtaining different clones. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or,' in the case ofthe reverse primer, until the stop codon was reached. Such primers were designed based on in silico predictions for the full length cDNA, part (one or more exons) ofthe DNA or protein sequence of he target sequence, or by translated homology ofthe predicted exons to closely related human sequences from other species. These primers were then employed in PCR amplification based on the following pool of human cDNAs: adrenal gland, bone marrow, brain - amygdala, brain - cerebellum, brain - hippocampus, brain - substantia nigra, brain - thalamus, brain -whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. Usually the resulting amplicons were gel purified, cloned and sequenced to high redundancy. The PCR product derived from exon linking was cloned into the pCR2.1 vector from Invitrogen. The resulting bacterial clone has an insert covering the entire open reading frame cloned into the pCR2.1 vector. Table AAP shows a list of these bacterial clones. The resulting sequences from all clones were assembled with themselves, with other fragments in CuraGen Corporation's database and with public ESTs. Fragments and ESTs were included as components for an assembly when the extent of their identity with another component ofthe assembly was at least 95% over 50 bp. In addition, sequence traces were evaluated manually and edited for corrections if appropriate. These procedures provide the sequence reported herein.

Table AAO. PCR Primers for Exon Linking

Figure imgf000312_0001
Figure imgf000313_0001

Physical clone: Exons were predicted by homology and the intron/exon boundaries were determined using standard genetic rules. Exons were further selected and refined by means of similarity determination using multiple BLAST (for example, tBlastN, BlastX, and BlastN) searches, and, in some instances, GeneScan and Grail. Expressed sequences from both public and proprietary databases were also added when available to further define and complete the gene sequence. The DNA sequence was then manually corrected for apparent inconsistencies thereby obtaining the sequences encoding the full-length protein.

Table 11B. Physical Clones for PCR products

NOVX Clone Bacterial Clone

NOV1 Physical clone 128940: : 83420733.698715.E24

NOV2 Physical clone A 357059, AL022344, A 3555530, AL356100, AC016042

NOV4 Physical clone AC009785

NOV5 Genomic clone: GMChromosome4

NO 7a Genomic file: gb_AC010319 HTG Homo sapiens [ chromosome 19 CTD- 2521M24

NOV8 Physical clone AC008803, AC010449, AC026718

Example 6. Preparation of expression vector pCEP4/Sec

The oligonucleotide primers, pSec-V5-His Forward 5'-CTCGTCCTCG AGGGTAAGCC TATCC CTAAC-3' (SEQ ID NO: 178) and pSec-V5-His Reverse 5'- CTCGTCGGGC CCCTGATCAG CGGGTTTAAA C-3' (SEQ ID NO: 179), were designed to amplify a fragment from the pcDNA3.1-V5His (Invitrogen, Carlsbad, CA) expression vector. The PCR product was digested with Xhol and Apal and ligated into the Xhol/Apal digested pSecTag2 B vector harboring an Ig kappa leader sequence (Invitrogen, Carlsbad CA). The correct structure ofthe resulting vector, pSecV5His, was verified by DNA sequence analysis. The vector pSecV5His was digested with Pmel and Nhel, and the Pmel-Nhel fragment was ligated into the BamHI/Klenow and Nhel treated vector pCEP4 (Invitrogen, Carlsbad, CA). The resulting vector was named pCEP4/Sec. Example 7. Expression of hll753149 in human embryonic kidney 293 cells.

The Bglll-Xhol fragment containing the human clone 1 1753149 sequence was isolated from 1 1753149-pCR2.1 and subcloned into the vector pCEP4/Sec to generate expression vector pCEP4/Sec-l 1753149. The pCEP4/Sec-l 1753149 vector was transfected into 293 cells using LipofectaminePlus™ reagent (Life Technologies,

Rockville, MD) following the manufacturer's instructions. The cell pellet and supernatant were harvested 72 hours after transfection and examined for hi 1753149 expression by Western blotting (reducing conditions) with an anti-V5 antibody. Table AAQ shows that hi 1753149 is expressed as a protein secreted by 293 cells that is broadly distributed around 64 IdDa, with a minor band at 35 kDa. The predicted molecular weight ofthe cloned fragment of 1 1753149 is about 32 kDa. The low intensity band, observed at about 35 kDa in Table AAQ, corresponds closely to the predicted molecular weight ofthe unmodified gene product. The program PROSITE predicts seven potential N- glycosylation sites in this fragment. Variable glycosylation ofthe recombinant 1 1753149 protein would account for the broad distribution of protein observed around 64 kDa in Table AAQ


Figure imgf000314_0001

Table AAQ. hi 1753149 protein secreted by 293 cells. Example 8. In-frame Cloning Clone 4437909

The expected 717 bp amplified product was detected by agarose gel electrophoresis. The fragment was purified from agarose gel and ligated to pCR2.1 vector (Invitrogen, Carlsbad, CA) following the manufacturer's recommendation. The cloned insert was sequenced using vector specific M13 Forward and M13 Reverse primers and the following gene-specific primers: 4437909 SI: 5'-GAGGACGGCTCCGTGAAC-3' (SEQ ID NO:180), 4437909 S2: 5'-GTTCACGGAGCCGTCCTC-3' (SEQ ID NO:181), 4437909 S3: 5'-CAGCGGCATGAGGTTCACC-3' (SEQ ID NO:182), and 4437909 S4: 5'-GGTGAACCTCATGCCGCTG-3' (SEQ ID NO:183).

Example 9. Expression of h4437909 in human embryonic kidney 293 cells.

The Bglll-Xhol fragment containing the human 4437909 sequence was isolated from plasmid 4437909-pCR2.1 and subcloned into the vector pCEP4/Sec to generate expression vector pCEP4/Sec-4437909. The pCEP4/Sec-4437909 vector was transfected into 293 cells using the LipofectaminePlus™ reagent following the manufacturer's instructions (Gibco BRL, Life Technologies, Inc., Rockville, MD).). The cell pellet and supernatant were harvested 72 hours after transfection and examined for h4437909 expression by Western blotting (reducing conditions) with an anti-V5 antibody. Table AAS shows that h4437909 is expressed in 293 cells as three discrete secreted protein bands of 16, 40, and 70 kDa. The predicted molecular weight is 27064 Da. There is one N- glycosylation site predicted at residue 118. Accordingly it is believed that the band at about 40 kDa corresponds to the full sized monomeric form of the protein encoded by pCEP4/Sec-4437909.

Figure imgf000315_0001
ssrk-ϊv - ϋϋ Table AAS. h4437909 protein secreted by 293 cells.

Example 10. Expression of h4437909 in recombinant E. coli cells using the expression vector pETMY- h4437909.

The vector pRSETA (InVitrogen Inc., Carlsbad, CA) was digested with Xhol and Ncol restriction enzymes. Oligonucleotide linkers used include Linker 1 : 5'- CATGGTCAGCCTAC-3' (SEQ ID NO: 184) and Linker 2: 5'-TCGAGTAGGCTGAC-3' (SEQ ID NO: 185). Linker 1 and Linker 2 were annealed at 37 degree Celsius and ligated into the Xhol-Ncol treated pRSETA. The resulting vector was confirmed by restriction analysis and sequencing and was named as pETMY. The Bgllll-Xhol fragment (see above) was ligated into the pETMY that was digested with BamHI and Xhol restriction enzymes. The expression vector is named as pETMY-4437909. In this vector, h4437909 was fused to the 6 X His tag and T7 epitope at its N-terminus. The plasmid pETMY- 4437909 was then transformed into the E. coli expression host BL21(DE3, pLys) (Novagen, Madison, WI). Expression of protein 4437909 was induced according to the manufacturer's instructions. After induction, total cells were harvested, and proteins were analyzed by Western blotting using anti-HisGly antibody (Invitrogen, Carlsbad, CA). FIG. 17 shows h4437909 was expressed as a 34 kDa protein in E. coli cells. This corresponds approximately to the molecular weight of 27064 Da expected for the protein encoded by pETMY-4437909.

Example 11. Quantitative expression analysis of 3883556 nucleic acid The quantitative expression of clone 3883556 was assessed in 41 normal and 55 tumor samples (see Table 2) by real time quantitative PCR (TAQMAN") performed on a Perkin-Elmer Biosystems ABI PRISM® 7700 Sequence Detection System.

First, 96 RNA samples were normalized to beta-actin and GAPDH. RNA (-50 ng total RNA or ~1 ng polyA+ RNA) was converted to cDNA using the TAQMAN® Reverse Transcription Reagents Kit (PE Biosystems, Foster City, CA; cat # N808-0234) and random hexamers according to the manufacturer's protocol. Reactions were performed in 20 μl and incubated for 30 min. at 48°C. The cDNA (5 μl) was then transferred to a separate plate for the TAQMAN® reaction using beta-actin and GAPDH TAQMAN® Assay Reagents (PE Biosystems; cat. #'s 4310881E and 4310884E, respectively) and TAQMAN® universal PCR Master Mix (PE Biosystems; cat # 4304447) according to the manufacturer's protocol. Reactions were performed in 25 μl using the following parameters: 2 min. at 50°C; 10 min. at 95°C; 15 sec. at 95°C/1 min. at 60°C (40 cycles). Results were recorded as CT values (cycle at which a given sample crosses a threshold level of fluorescence) using a log scale, with the difference in RNA concentration between two samples being represented as 2 to the power of delta CT (i.e., 2ΔCT). The average CT values obtained for β-actin and GAPDH were used to normalize RNA samples. The RNA sample generating the highest CT value required no further diluting, while all other samples were diluted relative to this sample according to their beta-actin /GAPDH average CT values.

Normalized RNA (5 μl) was converted to cDNA and analyzed via TAQMAN® using One Step RT-PCR Master Mix Reagents (PE Biosystems; cat. # 4309169) and gene- specific primers according to the manufacturer's instructions. Probes and primers were designed for each assay according to Perkin Elmer Biosystem's Primer Express Software package (version I for Apple Computer's Macintosh Power PC) using the sequence of 3352358 as input. The primers used were Ag 45 (F): 5'-TCCCTGGGAA ATGTCACACA-3' (SEQ ID NO: 186) and Ag 45 (R): 5'-TTCCTGGTGC CAAAGAATGA G-3' (SEQ ID NO: 187). and the labeled probe was Ag 45 (P): TET-5'- AGAACATCAA TCTTCCTTCC CCACTCCTGA G-3'-TAM (SEQ ID NO: 188).

Default settings were used for reaction conditions and the following parameters were sef before selecting primers: primer concentration = 250 nM, primer melting temperature (Tm) range = 58°-60° C, primer optimal Tm = 59° C, maximum primer difference = 2° C, probe does not have 5' G, probe T,n must be 10° C greater than primer Tm, amplicon size = 75 bp to 100 bp. The probes and primers selected (see below) were synthesized by Synthegen (Houston, TX, USA). Probes were double FIPLC purified to remove uncoupled dye and evaluated by mass spectroscopy to verify coupling of reporter and quencher dyes to the 5' and 3' ends ofthe probe, respectively. The final concentrations for the forward and reverse primers were 900 nM each, and probe concentration was 200 nM.

PCR conditions: Normalized RNA from each tissue and each cell line was spotted in each well of a 96 well PCR plate (Perkin Elmer Biosystems). PCR cocktails including two probes (SEQX-specific and another gene-specific probe multiplexed with the SEQX probe) were set up using IX TaqMan™ PCR Master Mix for the PE Biosystems 7700, with 5 M MgCl2, dNTPs (dA, G, C, U at 1:1 :1 :2 ratios), 0.25 U/ml AmpliTaq Gold™ (PE Biosystems), and 0.4 U/μl RNase inhibitor, and 0.25 U/μl reverse transcriptase. Reverse transcription was performed at 48° C for 30 minutes followed by PCR amplification cycles as follows: 95° C 10 min, then 40 cycles of 95° C for 15 seconds, 60° C for 1 minute.

The TaqMan panel is shown in Table AAU, Panels A, B and C. Tissues with high levels of expression include fetal brain, cerebellum, hippocampus, hypothalamus, liver, kidney, breast cancer, and uterus. These results suggest therapeutic indications for targeting 3883556 include brain tumors, preferably astrocytomas and gliomas; carcinomas such as selected renal cell and ovarian carcinomas.

Table AAT. Tissue Sources of RNA

Figure imgf000318_0001
Figure imgf000319_0002

Table AAU

Tissue Expression of 3883556 (A)

Figure imgf000319_0001

Tissue Source of RNA

Table AAV. TaqMan results for 3883556. Panel B. Relative Expression (%)


- φ m x

H o

—i 55" <D c CO O

Cfl δ" o 3

00 __: o ro ω o oo oo

73 co tn cn


Lung ca (small cell) LX 1

Lung ca (small cell) NCI-H69

Lung ca (s cell var ) SHP-77

Lung ca (large cell)NCI-H460

Lung ca (non-s cl) NCI H522

Lung ca (squam ) ΞW900

Table AAW. TaqMan results for 3883556. Panel C.

Tissue Expression of 3883556 (C)

Figure imgf000321_0001

Tissue Source of RNA

Example 12. Quantitative expression analysis of 4324229 nucleic acids

The quantitative expression of clone 4324229 was assessed in normal and tumor by real time quantitative PCR (TAQMAN®) as described in EXAMPLE 8. The 4324229 clone-specific primers used were AblO(F): 5'-GCCTGGCTCTCTGGATAGACA-3' (SEQ ID NO: 189) and Abl O(R): 5'-CACGAGCAGC TGTTCCAGAC-3' (SEQ ID NO: 190), and the labeled probe was Abl O(P):-FAM-5'-TGGCGGCACA TTCACCTGCA G-3'-TAMRA (SEQ ID NO: 191). The tissue sources are listed in Table AAT. The results are shown in Tables AAX-AAZ, Panels A, B and C. Among the tissues showing a high level of expression is lung (NCI-H460). The results suggest that therapeutic indications for targeting 4324229 include selected lung, breast and ovarian carcinomas. Table AAX. TaqMan results for 4324229. Panel A.

Cl (idcoonenngas Stomac i Slilttnmaes

Figure imgf000322_0001

Table AAY. TaqMan results for 4324229. Panel B.

Tissue Expression of 4324229 (B)

Figure imgf000322_0002

Figure imgf000322_0003

Tissue Source of RNA Table AAZ. TaqMan results for 4324229. Panel C.

Tissue Expression of 4324229 (C)

Figure imgf000323_0001

Tissue Source of RNA

Example 13. Quantitative expression analysis of 4339264 nucleic acid

The quantitative expression of clone 4339264 was assessed in normal and tumor by real time quantitative PCR (TAQMAN"5) as described in Example 8. The clone- specific primers used were Ag 120 (F): 5'-AAAGGCGGAGGAAAGAAGTACTC-3' (SEQ ID NO: 192) and Ag 120 (R): 5'-GCTCCCGTTC CCTCTCCA-3' (SEQ ID NO: 193), and the labeled probe was Ag 120 (P): FAM-5'-CCTCTTTGTT CTTCTTGCCC GAGTTTTCTT T-3'-TAMRA (SEQ ID NO: 194).

The tissue sources are listed in Table AAT. The results are shown in Table ABA- ABC, Panels A, B and C. The highest expression was shown in Prostate ca (bone met) PC- 3. Other tissues showing a high level expression include adipose, colon ca. (HCT-1 16), renal ca. ( A498), lung ca. (S. CELL var.) SHP-77, lung ca. (large cell) NCI-H460, ovary, testis and melanoma (LOX IMVI). Furthermore the results suggest that clone 4339264 is downregulated in astrocytoma, when compared with normal brain or glioma. Therefore restoring the expression of 4339264 could be useful for the treatment of astrocytomas. Since it is a multiple membrane spanning protein, some kind of gene therapy would be necessary. Table ABA. TaqMan results for 4339264. Panel A.

Figure imgf000324_0001

Table ABB. TaqMan results for 4339264. Panel B.

Relative Expression (%)


Figure imgf000325_0001

Table ABC. TaqMan results for 4339264. Panel C.

Figure imgf000326_0001

Example 14. Quantitative expression analysis of 4391184 nucleic acid.

The quantitative expression of clone 4391 184 was assessed in normal and tumor by real time quantitative PCR (TAQMAN®) as described in Example 8. The clone- specific primers used were Abl 1 (F): 5'-TGGAAGTCCCTCGGTAAAGGA-3' (SEQ ID NO: 195) and Abl 1 (R): 5'-AGGACACCTG TGCCCTGTCT-3' (SEQ ID NO: 196), and the labeled probe was Abl 1 (P): FAM-5'-CCCGCCTTGC CATTCCCTTC A -3'- TAMRA (SEQ ID NO: 197).

The tissue sources are listed in Table AAT. The results are shown in Tables ABD- ABF, Panels (A), (B) and (C). The highest expression was shown in prostate ca. (bone met) PC-3. Other tissues showing a high level expression include adipose, colon ca. (HCT-116), renal ca. ( A498), lung ca. (S. CELL var.) SHP-77, lung ca. (large cell)NCI- H460, ovary, testis and melanoma (LOX IMVI). Furthermore the results suggest that clone 4391184 is downregulated in astrocytoma, when compared with normal brain or glioma. Therefore restoring the expression of 4339264 could be useful for the treatment of astrocytomas. Since it is a multiple membrane spanning protein, some kind of gene therapy would be necessary. Clone 4391184 is up-regulated in hematopoietic organs, bone marrow, thymus, spleen and lymph node, therefore it can have a hematopoietic activity, useful as protein drug after chemotherapy treatment. This exclude a systemic delivery of a targeting agent. If specific delivery could be achieved, targeting agent could be useful to treat breast tumors and selected melanomas.

Table ABD. TaqMan results for Tissue Expression of 4391184. Panel A.

Tissue Expression of 4391184 (A)

Figure imgf000327_0001

Table ABE. TaqMan results for Tissue Expression of 4391184. Panel B.

Figure imgf000328_0001

Table ABF. TaqMan results for Tissue Expression of 4391184. Panel C.

Tissue Expression of 4391184 (C)

100 c o 90 an

(0 70


Q. 50

X 40



> 20

+- 10

CB 0

Figure imgf000329_0001

0) i- > ro r- 1- ^f n

S? > >

SF S o O to

< o o ό 5

> o > > n > rr ri _; o c" |ϊ ccT n Q o o o o ε ε to O

_3 _ m; V <

-L CΛ _>

E i- r- ro * ro ro * ro ro ε h o ε ε b h o ω » £ !2 ω

P ω S ro ro ,_ ro r cn ro. c cu ro

> >

O o o D- :≥ Ξ ≥ s ≥ _= 2 ≥

Tissue Source of RNA

Example 15. Radiation Hybrid Mapping Identifies the Chromosomal Location of Clones of the Invention.

Radiation hybrid mapping using human chromosome markers was carried out for many ofthe clones described in the present invention. The procedure used to obtain these results is analogous to that described in Steen et al. (A High-Density Integrated Genetic Linkage and Radiation Hybrid Map ofthe Laboratory Rat, Genome Research 1999 (Published Online on May 21, 1999) Vol. 9, AP1-AP8, 1999). A panel of 93 cell clones containing the randomized radiation-induced human chromosomal fragments was screened in 96 well plates using PCR primers designed to identify the sought clones in a unique fashion. The results are presented in Table ABG, which provides four columns giving, respectively, the clone number, the chromosome on which the clone is found, the distance in cR from a marker gene to the sought clone, and the identity ofthe marker gene. Table ABG. Radiation Hybrid Mapping Results for Clones of the Invention

Figure imgf000330_0001

Example 16. Quantitative expression analysis of 4324229 nucleic acids

The quantitative expression of clone 4324229-02 was assessed in normal and tumor by real time quantitative PCR (TAQMAN®) as described in EXAMPLE 1 1. The 4324229-02 clone-specific primers used were as follows:

Table ABH

Figure imgf000330_0002

The tissue sources are listed in Table AAT. The results are shown in FIG. 24. Among the tissues showing a high level of expression is, for example but not limited to lung (NCI-H460). The results suggest that therapeutic indications for targeting 4324229 include selected lung, breast, bladder and ovarian carcinomas. For example, therapeutic targeting with an antibody or domain thereof will block the migration and growth of cancer cells and promote cell death in cells where the gene is overexpressed in the tumor compared to normal adjacent tissues.

Table ABI. TaqMan results for Tissue Expression of 4324229-2. Panel A.

Figure imgf000331_0001
Figure imgf000332_0001
Figure imgf000333_0001

Figure imgf000333_0002
Figure imgf000334_0001
Figure imgf000335_0001

Figure imgf000335_0002
Figure imgf000336_0001
Figure imgf000337_0001

Panel E.

Figure imgf000337_0002
Figure imgf000338_0001

Figure imgf000339_0001
Figure imgf000340_0001


Figure imgf000341_0001

Panel G.

Figure imgf000342_0001
Figure imgf000343_0001
Figure imgf000344_0001

Example 16. Molecular Cloning of CG52643-02

Clone CG52643-02 encodes a follistatin-like protein, similar to clones AC012614J.0.123 and 4324229-2 described above, and has the same properties and uses described for these clones, i.e., regulation of cellular proliferation, cancers, and reproduction.

Exon Linking: The cDNA coding for the full-length of CG52643-02 from residue 1 to 842 and 23-842 were targeted for "in-frame" cloning by PCR. The PCR template is based on the previously identified plasmid, when available, or on human cDNA(s).

Table ABJ

Figure imgf000344_0002
For downstream cloning purposes, the forward primer includes an in-frame Xho I restriction site and the reverse primer contains an in-frame Xho I restriction site. Two parallel PCR reactions were set up using a total of 0.5-1.0 ng human pooled cDNAs as template for each reaction. The pool is composed of 5 micrograms of each ofthe following human tissue cDNAs: adrenal gland, whole brain, amygdala, cerebellum, thalamus, bone marrow, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, liver, lymphoma, Burkitt's Raji cell line, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small Intestine, spleen, stomach, thyroid, trachea, uterus. When the tissue of expression is known and available, the second PCR was performed using the above primers and 0.5ng-1.0 ng of one ofthe following human tissue cDNAs: skeleton muscle, testis, mammary gland, adrenal gland, ovary, colon, normal cerebellum, normal adipose, normal skin, bone marrow, brain amygdala, brain hippocampus, brain substantia nigra, brain thalamus, thyroid, fetal lung, fetal liver, fetal brain, kidney, heart, spleen, uterus, pituitary gland, lymph node, salivary gland, small intestine, prostate, placenta, spinal cord, peripheral blood, trachea, stomach, pancreas, hypothalamus. The reaction mixtures contained 2 microliters of each ofthe primers (original concentration: 5 pmol/ul), 1 microliter of lOmM dNTP (Clontech Laboratories, Palo Alto CA) and 1 microliter of Pfu DNA polymerase (Strategene) in 50 microliter- reaction volume. The following reaction conditions were used: PCR condition 1 : a) 96°C 3 minutes b) 96°C 30 seconds denaturation c) 60°C 30 seconds, primer annealing d) 72°C 6 minutes extension Repeat steps b-d 15 times e) 96°C 15 seconds denaturation f) 60°C 30 seconds, primer annealing g) 72°C 6 minutes extension Repeat steps e-g 29 times e) 72°C 10 minutes final extension

PCR condition 2: a) 96°C 3 minutes b) 96°C 15 seconds denaturation c) 76°C 30 seconds, reducing the temperature by 1 °C per cycle d) 72°C 4 minutes extension Repeat steps b-d 34 times e) 72°C 10 minutes final extension.

An amplified product was detected by agarose gel electrophoresis. The fragment was gel-purified and ligated into the pCR2.1-TOPO vector (Invitrogen, Carlsbad, CA) following the manufacturer's recommendation. Twelve clones per PCR reaction were picked and sequenced. The inserts were sequenced using vector-specific M13 Forward and Ml 3 Reverse primers and the following gene-specific primers for assembly 259341359:

Table ABK

Figure imgf000346_0001
The insert assembly 259341359 shown at Table ABM was found to encode an open reading frame between residues 1 and 842 ofthe target sequence of CG52643-02, shown at Table ABL The cloned insert is 100% identical to the original sequence. A comparison ofthe polypeptide sequences of CG52643-02 and 259341359 is shown at Table ABN.

Table ABL DNA Sequence of CG52643-02 (SEQ ID NO:228)

















Table ABM DNA sequence of assembly 259341359 (SEQ ID NO:229)








Table ABN. Comparison ofthe Polypeptide Sequences of CG52643-02 (SEQ ID NO:230) and 259341359 (SEQ ID NO:231).

Multiple Alignment:

CG52643-02 •κ*xtiti_vs_ :»ιt_*i(tr mn_'XΛ tw,HM_*_;itrΛt_ιiti-itrJM^ 259341359 60





CG52643-02 »r_wi<teiw-mt _________________t _____* _——____——v_9 _ 358 259341359 9 as m_Ψt_ WMmι ssϊaϊfXimmm_* _π^iiτ>__9tϊ ?i ιmn3_s_'a 360

CG52643-02 i a -i*- ___*__! ■ nSfi_!ilil___IAUriαιM«S__ l_R 418 259341359 ιιιaw;ιaiMwaffli;ιr<_ιt_<ιιι«gt«--i_t_κ_ιg»iMtat<»ιiMwιii8(^ 420



CG52643-02 539 _* ι]'JIIVAMI-».β»a:ii-allAV_)Jll^^ι3αt>!lc«t:l_K|ia r*iTO(t»-«ti:.iH;**ra,.tt_-tii]-;j 598 259341359 541 VDPLPA LS YDKSHDOV VLSWGDVHKSRPSLOVITEASTGQSOHLIRTPFAGVDDFFI 600


CG52643-02 659 Λ*a«n _τ iWΛ;miMM*j w*aΛ Λt__tιιm rt__ai_Mm*itia&t β x Λ«! naviwit-wai 718 259341359 661 720



CG52643-02 839 842 259341359 841 . 846

Table ABT. DNA sequence of assembly 268824728 (SEQ ID NO:232)









Table ABU. DNA sequence of assembly 268825987 (SEQ ID NO:233)








Table ABV. DNA sequence of assembly 268825997 (SEQ ID NO:234)









Frame: 1 - Nucleotide 1 to 2511












801 T V L T C A V H G D L R P P I I K R N G L T L N F L






















Frame: 1 - Nucleotide 1 to 2439


























Frame: -1 - Nucleotide 1 to 2472



161 E A C R




























Translated Protein - Frame: -1 - Nucleotide 1 to 2538 Polynucleotide (SEQ ID NO:238)

Polypeptide (SEQ ID NO:239)






321 R F Y E N H C K L H R A A C L L G K R I T V I H S K D



561 L D A D G N G H L S S S E L A Q H V L K K Q D L D E D


641 L L G C S P G D L L R F D D Y N S D S S L T L R E F





961 Y T C H A S G H E Q L F Q T H V L Q V N V P P V T R V


1041 Y P E S Q A Q E P G V A A S L R C H A E G I P M P R I



1201 H I S S V R Y E D T G A Y T C I A K N E V G V D E D I


1281 S S L F I E D S A R K T L A N I L R E E G L S V G N


1361 M F Y V F S D D G I I V I H P V D C E I Q R H L K P


1441 T E K I F M S Y E E I C P Q R E K N A T Q P C Q W V S


1521 A V N V R N R Y I Y V A Q P A L S R V L V V D I Q A Q


1601 K V L Q S I G V D P L P A K L S Y D K S H D Q V V


1681 L S W G D V H K S R P S L Q V I T E A S T G Q S Q H L



1841 I F N K S D P A V H K V D L E T M M P L K T I G L H








Other inserts encoding CG52643-02 were sequenced using vector-specific Ml 3 Forward and Ml 3 Reverse primers, and gene-specific primers as described above. For assemblies 268824728 and 268825987 the following gene-specific primers were used:

Table ABO


Figure imgf000359_0001
assembly 268825997 the following gene-specific primers were used: Table ABP

Figure imgf000360_0001

The insert assemblies 268824728 (SEQ ID NO: 268 and SEQ ID NO:269) and

268825987 (SEQ ID NO: XX and SEQ ID NO:XX) were found to encode an open reading frame between residues 1 and 842, and assembly 268825997 (SEQ ID NO: 270 and SEQ

ID NO:271) was found to encode an open reading frame between residues 23 and 842 of the target sequence of CG52643-02. The protein associated with 268825997 is encoded in a negative reading frame. The sequence shown has been reverse-complemented and renumbered to allow reading ofthe protein in the expected N to C direction. The cloned inserts differ from the original sequence. Assembly 268824728 has a deletion of 9 amino acids (439-447) and two amino acid changes: M433I and T757M. Assembly 268825987 has a 33 amino acid deletion (88-120) and one amino acid change: T757M. Assembly

268825997 one amino acid change: A620T. For assembly 275698334 the following gene-specific primers were used: Table ABQ

Figure imgf000361_0001

The insert assembly 275698334 was found to encode an open reading frame between residues 1 and 842 ofthe target sequence of CG52643-02. The cloned insert differs from the original sequence at one position: T757M. The protein associated with 275698334 is encoded in a negative reading frame. The sequence shown below has been reverse-complemented and renumbered to allow reading ofthe protein in the expected N to C direction. EQUIVALENTS

Although particular embodiments have been disclosed herein in detail, this has been done by way of example for purposes of illustration only, and is not intended to be limiting with respect to the scope ofthe appended claims, which follow. In particular, it is contemplated by the inventors that various substitutions, alterations, and modifications may be made to the invention without departing from the spirit and scope ofthe invention as defined by the claims. The choice of nucleic acid starting material, clone of interest, or library type is believed to be a matter of routine for a person of ordinary skill in the art with knowledge ofthe embodiments described herein. Other aspects, advantages, and modifications considered to be within the scope ofthe following claims.


1. An isolated polypeptide comprising an amino acid sequence selected from the group consisting of:
(a) a mature form of an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1, 1 14, 116, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167;
(b) a variant of a mature form of an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 11 1, 1 14, 1 16, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, wherein one or more amino acid residues in said variant differs from the amino acid sequence of said mature form, provided that said variant differs in no more than 15% ofthe amino acid residues from the amino acid sequence of said mature form;
(c) an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 111, 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167; and
(d) a variant of an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 11 , 1 14, 1 16, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, wherein one or more amino acid residues in said variant differs from the amino acid sequence of said mature form, provided that said variant differs in no more than 15% of amino acid residues from said amino acid sequence.
2 The polypeptide of claim 1, wherein said polypeptide comprises the amino acid sequence of a naturally-occurring allelic variant of an amino acid sequence selected from the group consisting of SEQ ID NOS :2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 111, 114, 1 16, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167.
3. The polypeptide of claim 2, wherein said allelic variant comprises an amino acid sequence that is the translation of a nucleic acid sequence differing by a single nucleotide from a nucleic acid sequence selected from the group consisting of SEQ ID NOS:l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101 , 103, 105, 107, 109, 112, 1 15, 117, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166.
4. The polypeptide of claim 1, wherein the amino acid sequence of said variant comprises a conservative amino acid substitution.
5. An isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the group consisting of:
(a) a mature form of an amino acid sequence selected from the group consisting of SEQ ID OS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1, 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167;
(b) a variant of a mature form of an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 11 1, 1 14, 116, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, wherein one or more amino acid residues in said variant differs from the amino acid sequence of said mature form, provided that said variant differs in no more than 15% ofthe amino acid residues from the amino acid sequence of said mature form;
(c) an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1, 1 14, 1 16, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167;
(d) a variant of an amino acid sequence selected from the group consisting SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1, 114, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, wherein one or more amino acid residues in said variant differs from the amino acid sequence of said mature form, provided that said variant differs in no more than 15%> of amino acid residues from said amino acid sequence; (e) a nucleic acid fragment encoding at least a portion of a polypeptide comprising an amino acid sequence chosen from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1, 1 14, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, or a variant of said polypeptide, wherein one or more amino acid residues in said variant differs from the amino acid sequence of said mature form, provided that said variant differs in no more than 15% of amino acid residues from said amino acid sequence; and
(f) a nucleic acid molecule comprising the complement of (a), (b), (c), (d) or (e).
6. The nucleic acid molecule of claim 5, wherein the nucleic acid molecule comprises the nucleotide sequence of a naturally-occurring allelic nucleic acid variant.
7. The nucleic acid molecule of claim 5, wherein the nucleic acid molecule encodes a polypeptide comprising the amino acid sequence of a naturally-occurring polypeptide variant.
8. The nucleic acid molecule of claim 5, wherein the nucleic acid molecule differs by a single nucleotide from a nucleic acid sequence selected from the group consisting of SEQ ID NOS:l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 115, 117, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166.
9. The nucleic acid molecule of claim 5, wherein said nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of:
(a) a nucleotide sequence selected from the group consisting of SEQ ID NOS:l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 1 15, 117, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166;
(b) a nucleotide sequence differing by one or more nucleotides from a nucleotide sequence selected from the group consisting of SEQ ID NOS:l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 112, 1 15, 117, 1 19, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166, provided that no more than 20% ofthe nucleotides differ from said nucleotide sequence;
(c) a nucleic acid fragment of (a); and
(d) a nucleic acid fragment of (b).
10. The nucleic acid molecule of claim 5, wherein said nucleic acid molecule hybridizes under stringent conditions to a nucleotide sequence chosen from the group consisting of SEQ ID NOS: l , 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 101, 103, 105, 107, 109, 1 12, 1 15, 1 17, 119, 121, 124, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, and 166, or a complement of said nucleotide sequence.
1 1. The nucleic acid molecule of claim 5, wherein the nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of:
(a) a first nucleotide sequence comprising a coding sequence differing by one or more nucleotide sequences from a coding sequence encoding said amino acid sequence, provided that no more than 20% ofthe nucleotides in the coding sequence in said first nucleotide sequence differ from said coding sequence;
(b) an isolated second polynucleotide that is a complement ofthe first polynucleotide; and
(c) a nucleic acid fragment of (a) or (b).
12. A vector comprising the nucleic acid molecule of claim 1 1 .
13. The vector of claim 12, further comprising a promoter operably-linked to said nucleic acid molecule.
14. A cell comprising the vector of claim 12.
15. An antibody that binds immunospecifically to the polypeptide of claim 1.
16. The antibody of claim 15, wherein said antibody is a monoclonal antibody.
17. The antibody of claim 15, wherein the antibody is a humanized antibody.
18. A method for determining the presence or amount ofthe polypeptide of claim 1 in a sample, the method comprising:
(a) providing the sample;
(b) contacting the sample with an antibody that binds immunospecifically to the polypeptide; and
(c) determining the presence or amount of antibody bound to said polypeptide, thereby determining the presence or amount of polypeptide in said sample.
19. A method for determining the presence or amount ofthe nucleic acid molecule of claim 5 in a sample, the method comprising:
(a) providing the sample;
(b) contacting the sample with a probe that binds to said nucleic acid molecule; and
(c) determining the presence or amount ofthe probe bound to said nucleic acid molecule, thereby determining the presence or amount ofthe nucleic acid molecule in said sample.
20. The method of claim 19 wherein presence or amount ofthe nucleic acid molecule is used as a marker for cell or tissue type.
21. The method of claim 20 wherein the cell or tissue type is cancerous.
22. A method of identifying an agent that binds to a polypeptide of claim 1, the method comprising:
(a) contacting said polypeptide with said agent; and
(b) determining whether said agent binds to said polypeptide.
23. The method of claim 22 wherein the agent is a cellular receptor or a downstream effector.
24. A method for identifying an agent that modulates the expression or activity ofthe polypeptide of claim 1, the method comprising:
(a) providing a cell expressing said polypeptide;
(b) contacting the cell with said agent, and
(c) determining whether the agent modulates expression or activity of said polypeptide, whereby an alteration in expression or activity of said peptide indicates said agent modulates expression or activity of said polypeptide.
25. A method for modulating the activity ofthe polypeptide of claim 1, the method comprising contacting a cell sample expressing the polypeptide of said claim with a compound that binds to said polypeptide in an amount sufficient to modulate the activity ofthe polypeptide.
26. - A method of treating or preventing a MOLX-associated disorder, said method comprising administering to a subject in which such treatment or prevention is desired the polypeptide of claim 1 in an amount sufficient to treat or prevent said MOLX-associated disorder in said subject.
27. The method of claim 26 wherein the disorder is selected from the group consisting of cardiomyopathy and atherosclerosis.
28. The method of claim 26 wherein the disorder is related to cell signal processing and metabolic pathway modulation.
29. The method of claim 26, wherein said subject is a human.
30. A method of treating or preventing a MOLX-associated disorder, said method comprising administering to a subject in which such treatment or prevention is desired the nucleic acid of claim 5 in an amount sufficient to treat or prevent said MOLX-associated disorder in said subject.
31. The method of claim 30 wherein the disorder is selected from the group consisting of cardiomyopathy and atherosclerosis.
32. The method of claim 30 wherein the disorder is related to cell signal processing and metabolic pathway modulation.
33. The method of claim 30, wherein said subject is a human.
34. A method of treating or preventing a MOLX-associated disorder, said method comprising administering to a subject in which such treatment or prevention is desired the antibody of claim 15 in an amount sufficient to treat or prevent said MOLX-associated disorder in said subject.
35. The method of claim 34 wherein the disorder is diabetes.
36. The method of claim 34 wherein the disorder is related to cell signal processing and metabolic pathway modulation.
37. The method of claim 34, wherein the subject is a human.
38. A pharmaceutical composition comprising the polypeptide of claim 1 and a pharmaceutically-acceptable carrier.
39. A pharmaceutical composition comprising the nucleic acid molecule of claim 5 and a pharmaceutically-acceptable carrier.
40. A pharmaceutical composition comprising the antibody of claim 15 and a pharmaceutically-acceptable carrier.
41. A kit comprising in one or more containers, the pharmaceutical composition of claim 38.
42. A kit comprising in one or more containers, the pharmaceutical composition of claim 39.
43. A kit comprising in one or more containers, the pharmaceutical composition of claim 40.
44. A method for determining the presence of or predisposition to a disease associated with altered levels ofthe polypeptide of claim 1 in a first mammalian subject, the method comprising:
(a) measuring the level of expression ofthe polypeptide in a sample from the first mammalian subject; and (b) comparing the amount of said polypeptide in the sample of step (a) to the amount ofthe polypeptide present in a control sample from a second mammalian subject known not to have, or not to be predisposed to, said disease; wherein an alteration in the expression level ofthe polypeptide in the first subject as compared to the control sample indicates the presence of or predisposition to said disease.
45. The method of claim 44 wherein the predisposition is to cancers.
46. A method for determining the presence of or predisposition to a disease associated with altered levels ofthe nucleic acid molecule of claim 5 in a first mammalian subject, the method comprising:
(a) measuring the amount ofthe nucleic acid in a sample from the first mammalian subject; and
(b) comparing the amount of said nucleic acid in the sample of step (a) to the amount ofthe nucleic acid present in a control sample from a second mammalian subject known not to have or not be predisposed to, the disease; wherein an alteration in the level ofthe nucleic acid in the first subject as compared to the control sample indicates the presence of or predisposition to the disease.
47. The method of claim 46 wherein the predisposition is to a cancer.
48. A method of treating a pathological state in a mammal, the method comprising administering to the mammal a polypeptide in an amount that is sufficient to alleviate the pathological state, wherein the polypeptide is a polypeptide having an amino acid sequence at least 95% identical to a polypeptide comprising an amino acid sequence of at least one of SEQ ID NOS :2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1, 1 14, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, or a biologically active fragment thereof.
49. A method of treating a pathological state in a mammal, the method comprising administering to the mammal the antibody of claim 15 in an amount sufficient to alleviate the pathological state.
50. A method for the screening of a candidate substance interacting with an olfactory receptor polypeptide selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 11 1, 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, or fragments or variants thereof, comprises the following steps: a) providing a polypeptide selected from the group consisting ofthe sequences of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1, 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, or a peptide fragment or a variant thereof; b) obtaining a candidate substance; c) bringing into contact said polypeptide with said candidate substance; and d) detecting the complexes formed between said polypeptide and said candidate substance.
51. A method for the screening of ligand molecules interacting with an olfactory receptor polypeptide selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 111, 114, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, wherein said method comprises: a) providing a recombinant eukaryotic host cell containing a nucleic acid encoding a polypeptide selected from the group consisting ofthe polypeptides comprising the amino acid sequences SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 1 1 1, 114, 116, 118, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167; b) preparing membrane extracts of said recombinant eukaryotic host cell; c) bringing into contact the membrane extracts prepared at step b) with a selected ligand molecule; and d) detecting the production level of second messengers metabolites.
52. A method for the screening of ligand molecules interacting with an olfactory receptor polypeptide selected from the group consisting of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 111, 114, 116, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167, wherein said method comprises: a) providing an adenovirus containing a nucleic acid encoding a polypeptide selected from the group consisting of polypeptides comprising the amino acid sequences SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 102, 104, 106, 108, 11 1, 1 14, 1 16, 1 18, 120, 123, 125, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, and 167; b) infecting an olfactory epithelium with said adenovirus; c) bringing into contact the olfactory epithelium b) with a selected ligand molecule; and d) detecting the increase ofthe response to said ligand molecule.
PCT/US2002/021268 1999-04-09 2002-07-03 Novel proteins and nucleic acids encoding same WO2003003984A2 (en)

Priority Applications (22)

Application Number Priority Date Filing Date Title
US30316801P true 2001-07-05 2001-07-05
US30324101P true 2001-07-05 2001-07-05
US60/303,168 2001-07-05
US60/303,241 2001-07-05
US09/966,545 2001-09-26
US09/966,546 2001-09-26
US09/966,546 US20020168716A1 (en) 1999-04-09 2001-09-26 Novel amino acid sequences for human microfibril glycoprotein 4-like polypeptides
US09/965,212 US20030003462A1 (en) 1999-04-09 2001-09-26 Novel human interleukin-like proteins and polynucleotides encoding them
US09/965,212 2001-09-26
US09/966,545 US20020172999A1 (en) 1999-04-09 2001-09-26 Novel KIAA1061-like cell adhesion molecule-like proteins and polynucleotides encoding them
US36906502P true 2002-04-01 2002-04-01
US36899602P true 2002-04-01 2002-04-01
US60/369,065 2002-04-01
US60/368,996 2002-04-01
US37873002P true 2002-05-08 2002-05-08
US60/378,730 2002-05-08
US38432702P true 2002-05-30 2002-05-30
US60/384,327 2002-05-30
US38681602P true 2002-06-07 2002-06-07
US60/386,816 2002-06-07
US17437202A true 2002-06-17 2002-06-17
US10/174,372 2002-06-17

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
AU2002327198A AU2002327198A1 (en) 2001-07-05 2002-07-03 Novel proteins and nucleic acids encoding same

Publications (3)

Publication Number Publication Date
WO2003003984A2 true WO2003003984A2 (en) 2003-01-16
WO2003003984A9 WO2003003984A9 (en) 2009-05-22
WO2003003984A8 WO2003003984A8 (en) 2009-08-13



Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2002/021268 WO2003003984A2 (en) 1999-04-09 2002-07-03 Novel proteins and nucleic acids encoding same

Country Status (1)

Country Link
WO (1) WO2003003984A2 (en)

Cited By (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003085096A2 (en) * 2002-04-01 2003-10-16 Curagen Corporation Therapeutic polypeptides, nucleic acids encoding same, and methods of use
EP2260858A2 (en) 2003-11-06 2010-12-15 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
EP2286844A2 (en) 2004-06-01 2011-02-23 Genentech, Inc. Antibody-drug conjugates and methods
WO2011031870A1 (en) 2009-09-09 2011-03-17 Centrose, Llc Extracellular targeted drug conjugates
WO2011056983A1 (en) 2009-11-05 2011-05-12 Genentech, Inc. Zirconium-radiolabeled, cysteine engineered antibody conjugates
WO2011130598A1 (en) 2010-04-15 2011-10-20 Spirogen Limited Pyrrolobenzodiazepines and conjugates thereof
WO2011156328A1 (en) 2010-06-08 2011-12-15 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2012074757A1 (en) 2010-11-17 2012-06-07 Genentech, Inc. Alaninyl maytansinol antibody conjugates
WO2012155019A1 (en) 2011-05-12 2012-11-15 Genentech, Inc. Multiple reaction monitoring lc-ms/ms method to detect therapeutic antibodies in animal samples using framework signature pepides
WO2013130093A1 (en) 2012-03-02 2013-09-06 Genentech, Inc. Biomarkers for treatment with anti-tubulin chemotherapeutic compounds
WO2014057074A1 (en) 2012-10-12 2014-04-17 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
WO2014140862A2 (en) 2013-03-13 2014-09-18 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2014140174A1 (en) 2013-03-13 2014-09-18 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
WO2014159981A2 (en) 2013-03-13 2014-10-02 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2015023355A1 (en) 2013-08-12 2015-02-19 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
WO2015095212A1 (en) 2013-12-16 2015-06-25 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
WO2015095227A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2015095223A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2016037644A1 (en) 2014-09-10 2016-03-17 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2016040825A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anthracycline disulfide intermediates, antibody-drug conjugates and methods
WO2016040856A2 (en) 2014-09-12 2016-03-17 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2016090050A1 (en) 2014-12-03 2016-06-09 Genentech, Inc. Quaternary amine compounds and antibody-drug conjugates thereof
EP3088004A1 (en) 2004-09-23 2016-11-02 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2017059289A1 (en) 2015-10-02 2017-04-06 Genentech, Inc. Pyrrolobenzodiazepine antibody drug conjugates and methods of use
WO2017064675A1 (en) 2015-10-16 2017-04-20 Genentech, Inc. Hindered disulfide drug conjugates
WO2017068511A1 (en) 2015-10-20 2017-04-27 Genentech, Inc. Calicheamicin-antibody-drug conjugates and methods of use
WO2017165734A1 (en) 2016-03-25 2017-09-28 Genentech, Inc. Multiplexed total antibody and antibody-conjugated drug quantification assay
EP3235820A1 (en) 2014-09-17 2017-10-25 Genentech, Inc. Pyrrolobenzodiazepines and antibody disulfide conjugates thereof
WO2017201449A1 (en) 2016-05-20 2017-11-23 Genentech, Inc. Protac antibody conjugates and methods of use
WO2017205741A1 (en) 2016-05-27 2017-11-30 Genentech, Inc. Bioanalytical method for the characterization of site-specific antibody-drug conjugates
WO2017214024A1 (en) 2016-06-06 2017-12-14 Genentech, Inc. Silvestrol antibody-drug conjugates and methods of use
WO2018031662A1 (en) 2016-08-11 2018-02-15 Genentech, Inc. Pyrrolobenzodiazepine prodrugs and antibody conjugates thereof
US9919056B2 (en) 2012-10-12 2018-03-20 Adc Therapeutics S.A. Pyrrolobenzodiazepine-anti-CD22 antibody conjugates
US9931414B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9931415B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
WO2018065501A1 (en) 2016-10-05 2018-04-12 F. Hoffmann-La Roche Ag Methods for preparing antibody drug conjugates
US9950078B2 (en) 2013-10-11 2018-04-24 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9956299B2 (en) 2013-10-11 2018-05-01 Medimmune Limited Pyrrolobenzodiazepine—antibody conjugates
US10010624B2 (en) 2013-10-11 2018-07-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US10029018B2 (en) 2013-10-11 2018-07-24 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP6307519B2 (en) 2012-12-21 2018-04-04 メドイミューン・リミテッドMedImmune Limited Pyrrolo benzodiazepines and its conjugate
JP2016505586A (en) 2012-12-21 2016-02-25 スパイロジェン・エス・アー・エール・エルSpirogen Sarl Asymmetric pyrrolobenzodiazepine dimer for use in the treatment of proliferative diseases and autoimmune diseases

Cited By (47)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003085096A3 (en) * 2002-04-01 2004-09-23 Curagen Corp Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2003085096A2 (en) * 2002-04-01 2003-10-16 Curagen Corporation Therapeutic polypeptides, nucleic acids encoding same, and methods of use
EP2478912A1 (en) 2003-11-06 2012-07-25 Seattle Genetics, Inc. Auristatin conjugates with anti-HER2 or anti-CD22 antibodies and their use in therapy
EP2260858A2 (en) 2003-11-06 2010-12-15 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
EP2489364A1 (en) 2003-11-06 2012-08-22 Seattle Genetics, Inc. Monomethylvaline compounds onjugated to antibodies
EP2486933A1 (en) 2003-11-06 2012-08-15 Seattle Genetics, Inc. Monomethylvaline compounds conjugated with antibodies
EP2286844A2 (en) 2004-06-01 2011-02-23 Genentech, Inc. Antibody-drug conjugates and methods
EP3088004A1 (en) 2004-09-23 2016-11-02 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2011031870A1 (en) 2009-09-09 2011-03-17 Centrose, Llc Extracellular targeted drug conjugates
WO2011056983A1 (en) 2009-11-05 2011-05-12 Genentech, Inc. Zirconium-radiolabeled, cysteine engineered antibody conjugates
WO2011130598A1 (en) 2010-04-15 2011-10-20 Spirogen Limited Pyrrolobenzodiazepines and conjugates thereof
WO2011156328A1 (en) 2010-06-08 2011-12-15 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2012074757A1 (en) 2010-11-17 2012-06-07 Genentech, Inc. Alaninyl maytansinol antibody conjugates
WO2012155019A1 (en) 2011-05-12 2012-11-15 Genentech, Inc. Multiple reaction monitoring lc-ms/ms method to detect therapeutic antibodies in animal samples using framework signature pepides
WO2013130093A1 (en) 2012-03-02 2013-09-06 Genentech, Inc. Biomarkers for treatment with anti-tubulin chemotherapeutic compounds
WO2014057074A1 (en) 2012-10-12 2014-04-17 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
US9931415B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9919056B2 (en) 2012-10-12 2018-03-20 Adc Therapeutics S.A. Pyrrolobenzodiazepine-anti-CD22 antibody conjugates
US9889207B2 (en) 2012-10-12 2018-02-13 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
EP2839860A1 (en) 2012-10-12 2015-02-25 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
US9931414B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
WO2014159981A2 (en) 2013-03-13 2014-10-02 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2014140862A2 (en) 2013-03-13 2014-09-18 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2014140174A1 (en) 2013-03-13 2014-09-18 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
WO2015023355A1 (en) 2013-08-12 2015-02-19 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
US9950078B2 (en) 2013-10-11 2018-04-24 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9956299B2 (en) 2013-10-11 2018-05-01 Medimmune Limited Pyrrolobenzodiazepine—antibody conjugates
US10029018B2 (en) 2013-10-11 2018-07-24 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US10010624B2 (en) 2013-10-11 2018-07-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
WO2015095227A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2015095223A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2015095212A1 (en) 2013-12-16 2015-06-25 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
WO2016037644A1 (en) 2014-09-10 2016-03-17 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US10188746B2 (en) 2014-09-10 2019-01-29 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2016040825A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anthracycline disulfide intermediates, antibody-drug conjugates and methods
WO2016040856A2 (en) 2014-09-12 2016-03-17 Genentech, Inc. Cysteine engineered antibodies and conjugates
EP3235820A1 (en) 2014-09-17 2017-10-25 Genentech, Inc. Pyrrolobenzodiazepines and antibody disulfide conjugates thereof
WO2016090050A1 (en) 2014-12-03 2016-06-09 Genentech, Inc. Quaternary amine compounds and antibody-drug conjugates thereof
WO2017059289A1 (en) 2015-10-02 2017-04-06 Genentech, Inc. Pyrrolobenzodiazepine antibody drug conjugates and methods of use
WO2017064675A1 (en) 2015-10-16 2017-04-20 Genentech, Inc. Hindered disulfide drug conjugates
WO2017068511A1 (en) 2015-10-20 2017-04-27 Genentech, Inc. Calicheamicin-antibody-drug conjugates and methods of use
WO2017165734A1 (en) 2016-03-25 2017-09-28 Genentech, Inc. Multiplexed total antibody and antibody-conjugated drug quantification assay
WO2017201449A1 (en) 2016-05-20 2017-11-23 Genentech, Inc. Protac antibody conjugates and methods of use
WO2017205741A1 (en) 2016-05-27 2017-11-30 Genentech, Inc. Bioanalytical method for the characterization of site-specific antibody-drug conjugates
WO2017214024A1 (en) 2016-06-06 2017-12-14 Genentech, Inc. Silvestrol antibody-drug conjugates and methods of use
WO2018031662A1 (en) 2016-08-11 2018-02-15 Genentech, Inc. Pyrrolobenzodiazepine prodrugs and antibody conjugates thereof
WO2018065501A1 (en) 2016-10-05 2018-04-12 F. Hoffmann-La Roche Ag Methods for preparing antibody drug conjugates

Also Published As

Publication number Publication date
WO2003003984A8 (en) 2009-08-13
WO2003003984A9 (en) 2009-05-22

Similar Documents

Publication Publication Date Title
US7112668B2 (en) Polypeptides and nucleic acids encoded thereby
US20030170630A1 (en) Proteins and nucleic acids encoding same
US20040010118A1 (en) Novel proteins and nucleic acids encoding same
WO2004000997A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
US20040067882A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
US20040033491A1 (en) Proteins and nucleic acids encoding same
US20040067490A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
US20040162236A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
US6875570B2 (en) Proteins and nucleic acids encoding same
US20040068095A1 (en) Novel human proteins, polynucleotides encoding them and methods of using the same
WO2000039284A1 (en) Secreted proteins and nucleic acids encoding them
US20030219823A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
US7109000B2 (en) Proteins and nucleic acids encoding same
WO2002081517A2 (en) Novel polypeptides and nucleic acids encoded thereby
WO2002059315A2 (en) Human nucleic acids and polypeptides and methods of use thereof
WO2002057453A2 (en) Polypetides and nucleic acids encoding same
WO2001029217A2 (en) Novel polypeptides and polynucleotides encoding same
US20030204052A1 (en) Novel proteins and nucleic acids encoding same and antibodies directed against these proteins
WO2002029058A2 (en) Human proteins, polynucleotides encoding them and methods of using the same
US6964849B2 (en) Proteins and nucleic acids encoding same
US7034132B2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2002006339A2 (en) Proteins and nucleic acids encoding same
WO2003010327A2 (en) Novel proteins and nucleic acids encoding same
WO2002024733A2 (en) Human polynucleotides and polypeptides encoded thereby
WO2002057450A2 (en) Proteins and nucleic acids encoding same

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2


Kind code of ref document: A2


AL Designated countries for regional patents

Kind code of ref document: A2


121 Ep: the epo has been informed by wipo that ep was designated in this application
NENP Non-entry into the national phase in:

Ref country code: DE

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

ENP Entry into the national phase in:

Ref document number: 2004115106

Country of ref document: RU

Kind code of ref document: A

122 Ep: pct application non-entry in european phase
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
NENP Non-entry into the national phase in:

Ref country code: JP

WWW Wipo information: withdrawn in national office

Country of ref document: JP

DPE2 Request for preliminary examination filed before expiration of 19th month from priority date (pct application filed from 20040101)