WO2013103248A1 - Ｄｌｋ１ 세포 외 수용성 도메인을 유효성분으로 포함하는 미오스타틴 저해제 - Google Patents

Ｄｌｋ１ 세포 외 수용성 도메인을 유효성분으로 포함하는 미오스타틴 저해제 Download PDF

Info

Publication number
WO2013103248A1
WO2013103248A1 PCT/KR2013/000033 KR2013000033W WO2013103248A1 WO 2013103248 A1 WO2013103248 A1 WO 2013103248A1 KR 2013000033 W KR2013000033 W KR 2013000033W WO 2013103248 A1 WO2013103248 A1 WO 2013103248A1
Authority
WO
WIPO (PCT)
Prior art keywords
dlk1
myostatin
extracellular
soluble domain
delta
Prior art date
Application number
PCT/KR2013/000033
Other languages
English (en)
French (fr)
Inventor
박영우
이동희
박범찬
박재은
장명희
유석호
김혜난
Original Assignee
(주)에이앤알쎄라퓨틱스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by (주)에이앤알쎄라퓨틱스 filed Critical (주)에이앤알쎄라퓨틱스
Priority to US14/370,341 priority Critical patent/US9388223B2/en
Publication of WO2013103248A1 publication Critical patent/WO2013103248A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00—Drugs for disorders of the muscular or neuromuscular system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00—Drugs for disorders of the muscular or neuromuscular system
    • A61P21/06—Anabolic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/04—Anorexiants; Antiobesity agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • C07K14/4703—Inhibitors; Suppressors
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475—Growth factors; Growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • C07K14/4705—Regulators; Modulating activity stimulating, promoting or activating activity
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present invention relates to a myostatin inhibitor comprising DLK1 extracellular water soluble domain as an active ingredient, and more specifically, extracellular water soluble domain of DLK1 (delta-like 1 homolog) or extracellular water of DLK1 (delta-like 1 homolog).
  • the present invention relates to a composition for inhibiting myostatin activity comprising a deletion mutant of a water-soluble domain as an active ingredient, and a pharmaceutical composition for preventing or treating myostatin-related diseases.
  • Myostatin is a transforming growth factor- ⁇ superfamily that acts as an inhibitor of autocrine / paracrine, which is critical for muscle growth (AC McPherron, AM Lawler, SJ Lee, Nature . 387, 83-90, 1997).
  • Myostatin is composed of 376 amino acids and the precursor protein is activated by the cleavage of two proteinases. The first step is the cleavage of the 24 amino acid signal peptide by enzymes of the purine family, and the next step is the cleavage by the BMP1 / Tolloid matrix metalloproteinase, the RSRR (Arg-Ser-Arg-), the 240th to 243th amino acids.
  • Cleavage occurs at the N-terminus, 27.64 kDa myostatin propeptide, and at the C-terminus, 12.4 kDa (SJ Lee, Annu. Rev. Cell. Dev. Biol. 20, 61-86, 2004).
  • Myostatin which has mature activity, forms a dimer at the C-terminal disulfide bond, which is known to show 100% homology in mice, rats, pigs, chickens, turkeys, and dogs. have.
  • myostatin is a muscle atrophy caused by glucocorticoids (DL Allen et. Al. J. Appl. Physiol. 109, 692-701, 2010; K. Ma et. Al., Am. J. Physiol. 285, E363-E371, 2003), skeletal muscle degeneration related diseases caused by HIV infection (NF Gonzalez-Cadavid et. Al., Proc. Natl. Acad. Sci. USA 95, 14938-14943, 1998) and increased expression in chronic illnesses (KA Reardon, et. Al., Muscle Nerve. 24, 893-899, 2001).
  • Increased expression of myostatin is also known to be associated with metabolic disorders such as obesity and diabetes (DS Hittel et. Al., Diabetes. 58, 30-38, 2009; G. Milan et. Al., J. Clin. Endocrinol. Metab. 89, 2724-2727, 2004; YW Chen et. Al., Biochem. Biophys. Res. Commun. 388, 112-116, 2009).
  • Obesity is associated with metabolic imbalances that increase adipose tissue mass and increase insulin resistance.
  • Increased expression of myostatin mRNA and protein has been reported in muscles of humans with obesity and insulin resistance (DS Hittel et. Al., Diabetes. 58, 30-38, 2009; G. Milan et. Al.
  • mice have been reported to have reduced fat mass and high fat-induced insulin resistance (AC McPherron, and SJ Lee, J. Clin. Invest. 109, 595-601). 40, 2002).
  • mice that do not express myostatin are known to have lower body fat gain due to a high fat diet compared to wild type mice (AC Dilger et. Al., Anim. Sci. J.
  • myostatin has been found to promote glucose consumption in muscle cells and to regulate glucose metabolism via AMPK signal pathway to promote glucose uptake (YW Chen et. Al., Int. J. Biochem. Cell. Biol. 42, 2072-2081, 2010).
  • DLK1 (Delta-like protein 1), belonging to the notch / delta / serrate family, is a transmembrane glycoprotein encoded by the dlk1 gene located on chromosome 14q32. It consists of amino acids. The protein is divided into 280 extracellular regions, 24 membrane transmembrane regions, and 56 intracellular regions, and has six epidermal growth factor like repeat domains outside the double membrane, and three It has N-glycosylation and seven O-glycosylation sites.
  • DLK1 is a membrane protein, it is well known as a protein that functions as a function of tumor necrosis factor alpha converting enzyme (TACE) that sheds the outer membrane of the cell membrane and functions separately (Yuhui). Wang and Hei Sook Sul, Molecular and cellular biology.26 (14): 5421-5435, 2006).
  • DLK1 is found in a variety of forms from 50 to 60 kDa by glycosylation in cell membranes (Smas CM and Sul HS, Cell. 73: 725-34, 1993), and four splicing variants by selective splicing ( splicing variant) (Smas CM et al., Biochemistry. 33: 9257-65, 1994). Two of these large variants have protease cleavage sites and are cleaved by the proteolytic enzyme TACE to produce two water soluble forms, 50 kDa and 25 kDa (Yuhui Wang et al., Journal of Nutrition. 136: 2953-2956, 2006).
  • DLK1 is expressed predominantly at the developmental stage and is embedded in embryonic tissue (Smas CM et al., Cell. 73: 725-34, 1993; Kaneta M et al., Journal of Immunology. 164: 256-64, 2000). And fetal antigen 1 (FA1), which is mainly expressed in the placenta, and is detected in high concentrations in maternal serum, in particular (Jensen CH et al., European Journal of Biochemistry. 225: 83-92, 1994). See also glandular cells of the pancreas (Kaneta M et al., Journal of Immunology.
  • FA1 fetal antigen 1
  • DLK1 is absent in most tissues after birth, preadipocyte (Smas CM et al., Cell. 73: 725-34, 1993), pancreatic islet cells (Carlsson C et al) , Endocrinology. 138: 3940-8, 1997), thymic stromal cells (Kaneta M et al., Journal of Immunology. 164: 256-64, 2000), adrenal gland cells (Halder SK) et al., Endocrinology.
  • DLK1 DLK1-dependent chromosomes
  • the expression of DLK1 is known to be a external monoallelic expression only in the paternal chromosomes due to the effect of methylation (Schmidt JV et al., Genes and Development. 14: 1997-2002, 2000; Takada S et al., Current Biology 10: 1135-8, 2000; Wylic AA et al, Genome Research. 10: 1711-8, 2000).
  • activin receptor type 2B (ACVR2B, activin receptor type II B) is a protein encoded by the ACVR2B gene and is involved in the activin signaling mechanism. Signal transduction by activin is known to be involved in the production, secretion of follicle-stimulating hormone (FSH), regulation of the menstrual cycle, and proliferation, differentiation and apoptosis of cells. (Chen et al., Exp. Biol. And Med. 231 (5): 534-544, 2006).
  • FSH follicle-stimulating hormone
  • DLK1 functional studies are known to be known as preadipocyte factor-1, a factor that inhibits adipocyte differentiation (Smas CM et al., Cell. 73: 725-34; Villena JA et al., Hormone and Metabolic Research. 34: 664-70, 2002). Apart from its ability to inhibit adipocyte differentiation, DLK1 inhibits the differentiation of hematopoietic stem cells (Sakajiri S et al., Leukemia. 19: 1404-10, 2005; LiLetal., Oncogene. 24: 4472 -6,2005), regulating the differentiation of lymphoid progenitor cells (Bauer SR et al., Molecular and Cellular Biology.
  • DLK1 is also required for skeletal muscle development and regeneration (Jolena N. et. Al., PLoS One 5 (11), e15055, 2010), and overexpression of DLK1 shows a calipyge phenotype that produces large muscles. (Erica Davis et. Al., Current Biology, 14, 1858-1862, 2004).
  • DLK1 can increase muscles and inhibit adipocyte differentiation. Therefore, DLK1 has an advantage that it can play a role of both inhibiting the production of fat cells and promoting the production of muscle cells, compared to the existing myostatin inhibitors.
  • the present inventors have made diligent efforts to elucidate the mechanism of promoting myocyte differentiation and inhibiting adipocyte differentiation of the extracellular domain soluble domain of DLK1.
  • the extracellular domain soluble domain of DLK1 acts as a receptor for myostatin. It binds to thybin receptor type 2B (ACVR2B) and blocks the binding of myostatin to ACVR2B, which not only inhibits myostatin's muscle differentiation, but also regulates myostatin by directly binding to myostatin. It was found that the mechanisms were affected, and the present invention was completed.
  • DLK1 binds to activin receptor type 2B (ACVR2B) and myostatin, thereby promoting the differentiation of muscle cells, and thus to the prevention of new myostatin inhibitors and diseases associated with myostatin.
  • ACVR2B activin receptor type 2B
  • the present invention provides an extracellular water soluble domain of DLK1, a fragment of the extracellular water soluble domain of DLK1, a variant of the extracellular water soluble domain of DLK1, or a fragment of the variant. It provides a composition for inhibiting myostatin (myostatin) activity comprising as an active ingredient.
  • the present invention also provides a composition for inhibiting myostatin activity comprising DLK1-Fc fusion protein conjugated with an extracellular water-soluble domain or fragment thereof of a delta-like 1 homolog (DLK1) and a human antibody Fc region. do.
  • DLK1-Fc fusion protein conjugated with an extracellular water-soluble domain or fragment thereof of a delta-like 1 homolog (DLK1) and a human antibody Fc region. do.
  • the present invention also includes an extracellular water soluble domain of DLK1 (delta-like 1 homolog), a fragment of the extracellular water soluble domain of DLK1, a variant of the extracellular water soluble domain of DLK1, or a fragment of the variant as an active ingredient. It provides a pharmaceutical composition for the prevention or treatment of myostatin-related diseases.
  • the present invention provides a method for the prevention of myostatin-related diseases comprising a DLK1-Fc fusion protein conjugated with an extracellular water-soluble domain of DLK1 (delta-like 1 homolog) or a fragment thereof and a human antibody Fc region.
  • a therapeutic pharmaceutical composition comprising a DLK1-Fc fusion protein conjugated with an extracellular water-soluble domain of DLK1 (delta-like 1 homolog) or a fragment thereof and a human antibody Fc region.
  • the present invention also provides a diagnostic kit for myostatin related diseases comprising an antibody or aptamer that specifically binds DLK1-myostatin, DLK1-ACVR2B or a soluble fragment thereof.
  • Myostatin inhibitors of the present invention bind to myostatin or activin receptor type 2B and inhibit the mechanism of action of myostatin, thereby promoting muscle differentiation and preventing differentiation into adipocytes, preventing obesity, It can play an important role in improving metabolic disorders, and is expected to be used for the prevention and treatment of diseases requiring muscle cell differentiation such as myotroposis.
  • Figure 2 shows the results confirmed by fingerprinting the diversity of monoclonal antibodies against water-soluble DLK1.
  • Figure 3 shows the results of analyzing the polypeptides in the CDRs of monophageclonal antibodies against water soluble DLK1.
  • FIG. 5 shows a cleavage map of the pNATAB L vector.
  • Figure 6 shows the flow cytometry analysis results (top) and fluorescence immunostaining results (bottom) showing that the B09 antibody specifically binds to the water-soluble portion of DLK1.
  • FIG. 7 shows fragments of monoclonal phage antibodies truncated by BstNI by PCR.
  • Figure 8 shows the results of the analysis of the polypeptides in the CDRs of the monophageclonal antibody heavy chain for water-soluble ACVR2B.
  • FIG. 9 shows the results of the analysis of the polypeptides in the CDRs of monophageclonal antibody light chain against water-soluble ACVR2B
  • FIG. 10 is an experimental result confirming that DLK1-Fc inhibits the muscle differentiation inhibitory effect of myoxtatin in myoblast C2C12 cell line.
  • Figure 11 shows the results of immunoprecipitation assay to confirm the binding of DLK1 and myostatin or ACVR2B.
  • Figure 13 is an ELISA analysis result for confirming the binding capacity of myostatin and DLK1 or ACVR2B.
  • Figure 15 shows the results of the consensus ELISA analysis for measuring the binding strength of DLK1 and ACVR2B to myostatin.
  • 16 shows the pYK602-DLK1-Fc construct.
  • Figure 17 illustrates the structure of DLK1 EGF-like repeat deletion mutants.
  • Figure 21 shows the results of the CAGA (pTAL-SBE-SEAP) reporter assay to confirm the myostatin inhibitory effect of DLK1.
  • the present invention provides an extracellular water soluble domain of DLK1, a fragment of the extracellular water soluble domain of DLK1, a variant of the extracellular water soluble domain of DLK1, or a fragment of the variant. It provides a composition for inhibiting myostatin (myostatin) activity comprising as an active ingredient.
  • the present invention provides a composition for inhibiting myostatin activity comprising a DLK1-Fc fusion protein conjugated with an extracellular water-soluble domain or fragment thereof of a delta-like 1 homolog (DLK1) and a human antibody Fc region. to provide.
  • DLK1 delta-like 1 homolog
  • delta-like 1 homolog refers to a transmembrane glycoprotein consisting of 383 amino acids encoded in the dlk1 gene located on chromosome 14q32.
  • extracellular domain water soluble domain of DLK1 refers to the water soluble domain of the extracellular domain of the DLK1 protein divided into extracellular, transmembrane and intracellular regions.
  • the anticancer effect of the extracellular domain water soluble domain of DLK1 was first identified by the present inventors. In the present invention, the effect of promoting the myocyte differentiation and adipocyte differentiation of the extracellular water soluble domain of DLK1 was found.
  • extracellular water-soluble domain of DLK1 may be expressed in combination with water-soluble DLK1.
  • the water-soluble DLK1 of the present invention may consist of 200 to 300 amino acids having water-soluble DLK1 activity, and more preferably, may consist of the amino acid sequence of SEQ ID NO: 29, but the amino acid sequence showing water-soluble DLK1 activity is limited. Can be included without.
  • the mutant of the extracellular soluble domain of DLK1 (delta-like 1 homolog) is characterized in that the deletion mutant of the extracellular soluble domain of DLK1.
  • the term "delete mutant of the extracellular soluble domain of delta-like 1 homolog (DLK1)” refers to epidermal growth factor-like repeat (EGF-like repeat) or juxtamembrane sequences.
  • a deletion mutation including, it means a deletion mutation in which the epidermal growth factor-like repeat domain of the water-soluble DLK1 is sequentially deleted.
  • the deletion mutant of the extracellular water-soluble domain of the delta-like 1 homolog (DLK1) of the present invention is EGF 3-6 which has deleted the first and second domains of the six EGF-like repeat domains.
  • EGF 4-6 deleting the first to third domains
  • EGF 5-6 deleting the first to fourth domains
  • EGF 6 deleting the first to fifth domains
  • JM deleting all six domains may be any one of the group, and more preferably may be composed of any one of the amino acid sequence of SEQ ID NO: 30 to SEQ ID NO: 34, but is not limited.
  • the extracellular water soluble domain of DLK1 (delta-like 1 homolog), fragment of the extracellular water soluble domain of DLK1, a mutant of the extracellular water soluble domain of DLK1, or a fragment of the variant is myostatin or It binds to activin receptor type 2B (ACVR2B) and inhibits the action of myostatin, thereby promoting muscle cell differentiation and / or inhibiting adipocyte differentiation.
  • DLK1 delta-like 1 homolog
  • ACVR2B activin receptor type 2B
  • epithelial growth factor-like repeat 5, 6 or juxtamembrane sequences are important in the relationship between DLK1 and ACVR2B, and membranes in the relationship between DLK1 and myostatin.
  • a juxtamembrane sequence is important, which is shown in the examples of the present invention.
  • the term "activin” is a kind of peptide hormone having a molecular weight of about 25,000, and is a homodimer of activin A which is a homo-dimer ( ⁇ A ⁇ A) of inhibin A and a beta chain of inhibin B.
  • activin B which is ((beta) B (beta) B)
  • activin AB which is these heterodimers ((beta) A (beta) B).
  • the activin may be activin A.
  • activin receptor type 2B is a protein encoded by the ACVR2B gene and is known as a representative receptor of myostatin. Signaling by the binding of myostatin and activin receptor type 2B promotes myostatin inhibition of myocyte differentiation and causes adipocyte differentiation and is involved in various muscle-related and metabolic diseases.
  • the invention provides an extracellular water soluble domain of DLK1 (delta-like 1 homolog), a fragment of the extracellular water soluble domain of DLK1, a variant of the extracellular water soluble domain of DLK1, or a It provides a pharmaceutical composition for the prevention or treatment of myostatin-related diseases comprising a fragment as an active ingredient.
  • the present invention provides a method for the prevention of myostatin-related diseases comprising a DLK1-Fc fusion protein conjugated with an extracellular water-soluble domain of DLK1 (delta-like 1 homolog) or a fragment thereof and a human antibody Fc region.
  • a therapeutic pharmaceutical composition comprising a DLK1-Fc fusion protein conjugated with an extracellular water-soluble domain of DLK1 (delta-like 1 homolog) or a fragment thereof and a human antibody Fc region.
  • the present invention provides a method of treating a disease comprising administering a pharmaceutical composition according to the present invention to a subject having or likely to develop a myostatin-related disease. to provide.
  • prevention refers to any action that inhibits or delays the onset of a disease by the administration of the pharmaceutical composition of the invention
  • treatment refers to the disease by administration of the pharmaceutical composition of the invention. Means any act that improves or beneficially changes symptoms.
  • the term "individual” means a human and an animal such as a monkey, dog, goat, pig, or mouse having a disease that can improve symptoms by administering the composition of the present invention.
  • the composition according to the invention can be applied not only for humans (treatment, inhibition or prevention) but also to other commercially useful animals.
  • the pharmaceutical composition of the present invention can be used without limitation as long as it is a myostatin-related disease caused by overexpression of myostatin or signaling of myostatin / activin receptor type 2B.
  • Myostatin-related diseases may include, but are not limited to, various forms of muscle wasting disease, metabolic disease, degenerative bone disease, hypogonadism and cachexia of various causes.
  • the muscle wasting disease of the present invention includes Duchenne's muscular dystrophy, progressive muscular dystrophy, Becker's type muscular dystrophy, facial scapula dystrophy, Dejerine-Landouzy muscular dystrophy, facioscapulohumeral muscular dystrophy, limb girdle muscular dystrophy (Erb's muscular dystrophy), Emery Dreifuss muscular dystrophy, rigid spine syndrome, muscle-eye-encephalopathy ( muscle-eye-brain disease, amyotrophic lateral sclerosis, congenital muscular dystrophy, infantile neuroaxonal muscular dystrophy, myotonic dystrophy, Steinert's disease ), Nondystrophic myotonia, Charcot-Marie-Tooth disea se), chronic inflammatory neuropathy, distal myopathy, and other Emery Lancet 359: 687-695 (2002) and Khurana et al, Nat. Rev. It may include, but is not limited to, various diseases disclosed in Drug Disc 2: 379
  • the metabolic disease of the present invention includes, but is not limited to, diabetes mellitus such as type 2 diabetes, noninsulin-dependent diabetes mellitus, hyperglycemia, obesity and diabetic nephropathy. Do not.
  • Additional muscle wasting disorders resulting from chronic diseases include pulmonary cachexia, heart disease cachexia, such as chronic obstructive pulmonary disease (COPD) and cystic fibrosis.
  • COPD chronic obstructive pulmonary disease
  • cardiac cachexia, cancer or tumor related cachexia, rheumatoid cachexia, and cachexia caused by chemotherapeutic agents are examples of chronic diseases.
  • cachexis refers to a condition that promotes muscle loss and lean body mass loss due to the various diseases.
  • compositions of the present invention may comprise existing therapeutically active ingredients, other adjuvants, pharmaceutically acceptable carriers.
  • suitable carriers, excipients and diluents that may be included in such compositions include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia rubber, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, Methyl cellulose, amorphous cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, mineral oil and the like.
  • the composition may further include conventional fillers, extenders, binders, disintegrants, surfactants, anticoagulants, lubricants, wetting agents, fragrances, emulsifiers, preservatives, and the like.
  • the pharmaceutical composition of the present invention may be used in the form of a general pharmaceutical preparation, and when formulated, a pharmaceutically acceptable diluent or excipient may be used.
  • the composition of the present invention may be formulated in various forms such as powders, granules, tablets, capsules, suspensions, emulsions, syrups, aerosols, oral formulations, sterile injectable solutions, etc. It may be used orally or may be administered through various routes including intravenous, intraperitoneal, subcutaneous, rectal, topical administration and the like.
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, and the like, which may contain at least one excipient such as starch, calcium carbonate, sucrose, lactose, gelatin, and the like. Mix and formulate. In addition to simple excipients, lubricants such as magnesium stearate and talc are also used.
  • Oral liquid preparations include suspensions, solvents, emulsions, and syrups, and may include various excipients, such as wetting agents, sweeteners, fragrances, preservatives, etc., in addition to commonly used simple diluents such as water and liquid paraffin.
  • Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilized preparations, suppositories.
  • non-aqueous solvent and suspending agent propylene glycol, polyethylene glycol, vegetable oil such as olive oil, injectable ester such as ethyl oleate and the like can be used.
  • Bases for injectables may include conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifiers, stabilizers and preservatives.
  • administration in the present invention is meant to provide the patient with the desired material in any suitable way, the route of administration of the composition of the present invention being oral or parenteral via all common routes as long as the target tissue can be reached. May be administered.
  • the composition can be administered by any device in which the active agent can migrate to the target cell.
  • composition of the present invention is administered in a pharmaceutically effective amount.
  • compositions of the present invention may be administered as individual therapeutic agents or in combination with other therapeutic agents, may be administered sequentially or simultaneously with conventional therapeutic agents, and may be single or multiple doses. Taking all of the above factors into consideration, it is important to administer an amount that can obtain the maximum effect in a minimum amount without side effects, which can be easily determined by those skilled in the art.
  • the dosage of the compound according to the present invention may be changed according to body absorption, weight, age, sex, health condition, diet, administration time, administration method, excretion rate, severity of disease, and the like.
  • the compound of the present invention is preferably administered at 0.001 to 150 mg, preferably 0.01 to 100 mg per kg of body weight per day. Administration may be once a day or may be divided several times. The dosage does not limit the scope of the invention in any aspect.
  • the invention provides a diagnostic kit for a myostatin related disease comprising an antibody or aptamer specifically binding to DLK1-myostatin, DLK1-ACVR2B or a soluble fragment thereof.
  • the diagnostic kit of the present invention includes, but is not limited to, an enzyme immunoassay (ELISA) kit or a sandwich ELISA kit.
  • the kit for diagnosing myostatin-related diseases may further include one or more other component compositions, solutions or devices suitable for analytical methods.
  • it may be a diagnostic kit characterized by including the necessary elements necessary to perform the ELISA.
  • ELISA kits include antibodies specific for the protein. Antibodies are antibodies that have high specificity and affinity for each marker protein and have little cross-reactivity to other proteins. They are monoclonal antibodies, polyclonal antibodies, or recombinant antibodies.
  • the ELISA kit can also include antibodies specific for the control protein. Other ELISA kits can bind reagents that can detect bound antibodies, such as labeled secondary antibodies, chromophores, enzymes (eg conjugated with the antibody) and substrates or antibodies thereof. Other materials and the like.
  • the extracellular region water soluble domain (hereinafter referred to as water soluble DLK1) of DLK1 and DLK1-Fc fusion protein (hereinafter referred to as DLK1-Fc) in which the water-soluble DLK1 and the human antibody Fc region are conjugated as used in the Examples of the present specification are Prepared according to the method disclosed in 0982170.
  • ACVR2B-Fc used in the Examples herein, the extracellular domain of ACVR2B (SEQ ID NO: 1) was fused to the human antibody Fc, the same vector as in Example 1, the same expression method, Prepared using the same purification method.
  • Example 2 30 ⁇ g of the purified DLK1-Fc obtained in Example 1 was added to an Immunosorb tube (Nunc 470319) in 4 ml of a coating buffer; 1.59 g of Na 2 CO 3 (sigma, S7795), 2.93 g of NaHCO 3 (sigma, S8875), NaN 3 (sigma, S2002), 0.2 g] and coated with a rotator at 4 ° C. for about 16 hours. It was dissolved in PBS for 2 hours at and blocked in immunotubes using skim milk [(BD, 232100) -4% in 1XPBS].
  • the cultured cells were centrifuged (4500 rpm, 15 min, 4 ° C.) and the supernatant (panned poly scFv-phage) was transferred to a new tube.
  • 96-well immune plates (NUNC 439454) were coated with antigen at 100 ng per well with coating buffer for 16 hours at 4 ° C., and then each well was blocked using skim milk (4%) dissolved in PBS. Wash each well with 0.2 ml of PBS-tween20 (0.05%), and add 100 ⁇ l of the diluted solution of panned poly scFV-phage and 5, 25, 125, 625, and 3125 times to each well. Reacted for a while.
  • the secondary antibody anti-M13-HRP (Amersham 27-9421-01) was diluted 1: 2000 and reacted at room temperature for 1 hour. It was. After washing with 0.2 ml of PBS-tween20 (0.05%), OPD tablets (Sigmap 8787-TAB) were added to PC buffer [C6H8O7H2O (sigma, C0706) 5.1 g, Na 2 HPO 4 (sigma, S7907) 7.3 g]. After dissolving the prepared substrate solution was added 100 ⁇ l per well and developed for 10 minutes, the absorbance at 490 nm was measured with a spectrophotometer (MolecularDevice, USA).
  • Colonies obtained from the polyclonal phage antibody group having high binding capacity were incubated for 16 hours at 37 ° C. in a 96-deep well plate (Bionia 90030) containing 2 ml of YTCM, 2% glucose, and 1 ml of 5 mM MgCl 2 medium. It was. Take 100-200 ⁇ l of the cultured cells so that the OD600 value is 0.1 and dilute in 1 ml 2 ⁇ YTCM, 2% glucose, 5 mM MgCl 2 medium, and then measure the OD600 value at 37 ° C. in a 96-deep well plate. Incubated for 2-3 hours so as to be 0.5-0.7.
  • M1 helper phages were infected with a MOI of 1:20, and then incubated for 16 hours at a temperature of 30 ° C. in 2 ⁇ YTCMK, 5 mM MgCl 2 , and 1 mM IPTG medium. After culturing the cells were centrifuged (4500 rpm, 15 minutes, 4 °C), the supernatant was taken, dissolved by adding 4% PEG 6000 and 3% NaCl, and reacted for 1 hour on ice.
  • each well was washed with 0.2 ml of PBS-tween20 (0.05%), and 100 ⁇ l of monoclonal scFv-phage (each 100 scFv-phage) obtained by the above method was added to each well and allowed to react at room temperature for 2 hours. .
  • each well was washed four times with 0.2 ml of PBS-tween20 (0.05%), and the second antibody, anti-M13-HRP, was diluted to 1/2000 and reacted at room temperature for 1 hour. After washing with 0.2 ml of PBS-tween20 (0.05%), color development was measured at 490 nm. As a result, as shown in Table 2, 27 single phage clones having a binding capacity of 2 or more antigens were selected.
  • the colony PCR product was identified on 1% agarose gel (Seakem LE, CAMERES 50004), and 0.2 ⁇ l of BstNI (Roche11288075001, 10 U / ⁇ l) was added and reacted at 37 ° C. for 2-3 hours.
  • the reaction conditions are shown in Table 4 below.
  • the cleaved product was identified on an 8% DNA polyacrylamide gel.
  • the heavy chain was 1 ⁇ l of monoclonal DNA, 10 pmole / ⁇ l of heavy chain forward and reverse primers in Table 6, 5 ⁇ l of 10 ⁇ buffer, 1 ⁇ l of 10 mM dNTP mix.
  • Colony PCR iCycler iQ, BIO-RAD was performed by mixing 0.5 ⁇ l of pfu DNA polymerase (solgent, 2.5 U / ⁇ l) and distilled water.
  • Light Chain Colony PCR was performed in the same manner using the light chain forward and reverse primers in Table 6.
  • the heavy chain gene obtained by PCR was purified by DNA-gel extraction kit (Qiagen), and then 1 ⁇ l (10 ng) of pNATAB H vector (Fig. 4), 15 ⁇ l of heavy chain (100 to 200 ng), 2 ⁇ l of 10 ⁇ buffer, 1 ⁇ l of ligase (1 U / ⁇ l) and distilled water were mixed and left at room temperature for 1-2 hours to connect with the vector.
  • the vector was allowed to stand on ice with transformed cells (XL1-blue) for 30 minutes, and then transduced with heat shock at 42 ° C. for 90 seconds. After standing again on ice for 5 minutes, 1 ml of LB medium was injected and incubated at 37 ° C. for 1 hour.
  • the plate was plated on LB Amp solid medium, and then cultured at 37 ° C. for 16 hours. Single colonies were inoculated in 5 ml of LB Amp liquid medium and incubated at 37 ° C. for 16 hours. DNA-prep. DNA was extracted using the kit (Nuclogen). In addition, the light chain was extracted DNA by the same method using the pNATAB L vector (Fig. 5).
  • the obtained DNA was requested for sequencing using CMV-proF primer (SEQ ID NO: 4: AAA TGG GCG GTA GGC GTG) (solgent). As a result, it was confirmed that the sequences of the heavy and light chains of the six clone phages for DLK1-Fc converted to total IgG match the sequences of the phage antibody.
  • CMV-proF primer SEQ ID NO: 4: AAA TGG GCG GTA GGC GTG
  • Example 3-1 In order to confirm the binding ability of a human antibody that specifically binds to the water-soluble portion of DLK1 prepared in Example 3-1, 293E cells, which are representative of six human antibodies, expressing DLK1 using a B09 antibody, are typically used. Flow cytometry migration analysis was performed as shown in FIG. 6. At this time, the binding force between DLK1 monoclonal antibody and ACVR2B antibody purchased from R & D was measured.
  • Example 2 30 ⁇ g of the ACVR2B-Fc prepared in Example 2 was added to an Immunosorb tube (Nunc 470319) in 4 ml of a coating buffer; 1.59 g of Na 2 CO 3 (sigma, S7795), 2.93 g of NaHCO 3 (sigma, S8875), NaN 3 (sigma, S2002), 0.2 g] and coated with a rotator at 4 ° C. for about 16 hours. It was dissolved in PBS for 2 hours at and blocked in immunotubes using skim milk [(BD, 232100) -4% in 1XPBS].
  • the cultured cells were centrifuged (4500 rpm, 15 min, 4 ° C.) and the supernatant (panned poly scFv-phage) was transferred to a new tube.
  • 96-well immune plates (NUNC 439454) were coated with antigen at 100 ng per well with coating buffer for 16 hours at 4 ° C., and then each well was blocked using skim milk (4%) dissolved in PBS. Wash each well with 0.2 ml of PBS-tween20 (0.05%), and add 100 ⁇ l of the diluted solution of panned poly scFV-phage and 5, 25, 125, 625, and 3125 times to each well. Reacted for a while.
  • the secondary antibody anti-M13-HRP (Amersham 27-9421-01) was diluted 1: 2000 and reacted at room temperature for 1 hour. It was.
  • OPD tablet (Sigmap 8787-TAB) was added with PC buffer [C 6 H 8 O 7 OH 2 O (sigma, C0706) 5.1 g, Na 2 HPO 4 (sigma). , S7907) 7.3 g] was prepared and the substrate solution dissolved in 100 ⁇ l per well was developed for 10 minutes and the absorbance at 490 nm was measured with a spectrophotometer (MolecularDevice, USA).
  • Colonies obtained from the polyclonal phage antibody group having high binding capacity were incubated for 16 hours at 37 ° C. in a 96-deep well plate (Bionia 90030) containing 2 ml of YTCM, 2% glucose, and 1 ml of 5 mM MgCl 2 medium. It was. Take 100-200 ⁇ l of the cultured cells so that the OD600 value is 0.1 and dilute in 1 ml 2 ⁇ YTCM, 2% glucose, 5 mM MgCl 2 medium, and then measure the OD600 value at 37 ° C. in a 96-deep well plate. Incubated for 2-3 hours so as to be 0.5-0.7.
  • M1 helper phages were infected with a MOI of 1:20, and then incubated for 16 hours at a temperature of 30 ° C. in 2 ⁇ YTCMK, 5 mM MgCl 2 , and 1 mM IPTG medium. After culturing the cells were centrifuged (4500 rpm, 15 minutes, 4 °C), the supernatant was taken, dissolved by adding 4% PEG 6000 and 3% NaCl, and reacted for 1 hour on ice.
  • each well was washed with 0.2 ml of PBS-tween20 (0.05%), and 100 ⁇ l of monoclonal scFv-phage (each 100 scFv-phage) obtained by the above method was added to each well and allowed to react at room temperature for 2 hours. .
  • each well was washed four times with 0.2 ml of PBS-tween20 (0.05%), and the second antibody, anti-M13-HRP, was diluted to 1/2000 and reacted at room temperature for 1 hour. After washing with 0.2 ml of PBS-tween20 (0.05%), color development was measured at 490 nm. As a result, 36 single phage clones having a binding capacity of 2 or more antigens were selected as shown in Table 8 below.
  • the colony PCR product was identified on 1% agarose gel (Seakem LE, CAMERES 50004), and 0.2 ⁇ l of BstNI (Roche 11288075001, 10 U / ⁇ l) was added and reacted at 37 ° C. for 2-3 hours.
  • the reaction conditions are shown in Table 10 below.
  • the cleaved product was identified on an 8% DNA polyacrylamide gel.
  • the heavy chain was 1 ⁇ l of monoclonal DNA, 10 pmole / ⁇ l of heavy chain forward and reverse primers in the table below, 5 ⁇ l of 10 ⁇ buffer, 1 ⁇ l of 10 mM dNTP mix, Colony PCR (iCycler iQ, BIO-RAD) was performed by mixing 0.5 ⁇ l of pfu DNA polymerase (solgent, 2.5 U / ⁇ l) and distilled water. Light Chain Colony PCR was performed in the same manner using the light chain forward and reverse primers in Table 12 below.
  • the heavy chain gene obtained by PCR was purified by DNA-gel extraction kit (Qiagen), and then 1 ⁇ l (10 ng) of pNATAB H vector (Fig. 4), 15 ⁇ l of heavy chain (100-200 ng), 2 ⁇ l of 10 ⁇ buffer, 1 ⁇ l of ligase (1 U / ⁇ l) and distilled water were mixed and left at room temperature for 1-2 hours to connect with the vector.
  • the vector was allowed to stand on ice with transformed cells (XL1-blue) for 30 minutes, and then transduced with heat shock at 42 ° C. for 90 seconds. After standing again on ice for 5 minutes, 1 ml of LB medium was injected and incubated at 37 ° C. for 1 hour.
  • the plate was plated on LB Amp solid medium, and then cultured at 37 ° C. for 16 hours. Single colonies were inoculated in 5 ml of LB Amp liquid medium and incubated at 37 ° C. for 16 hours. DNA-prep. DNA was extracted using the kit (Nuclogen). In addition, the light chain was extracted DNA by the same method using the pNATAB L vector (Fig. 5).
  • the obtained DNA was requested for sequencing using CMV-proF primer (SEQ ID NO: 4: AAA TGG GCG GTA GGC GTG) (solgent).
  • CMV-proF primer SEQ ID NO: 4: AAA TGG GCG GTA GGC GTG
  • Myocytes after expression and purification of the extracellular domain of DLK1 protein known to be involved in the inhibition of adipogenesis in the stage of development and differentiation in human blood, in the form of an Fc fusion protein, as in Example 1 above.
  • the purpose of this study was to investigate the effect of water-soluble DLK1 on myoblast differentiation by treatment with.
  • myoblast C2C12 when myoblast C2C12 is at about 90% level, 2% horse serum (HS) is exchanged with differentiation media (DM), divided into six experimental groups, and then ACVR2B-Fc (0.5). ⁇ M), DLK1-Fc (0.5 ⁇ M) and / or myostatin (8 ⁇ g / ml) were treated in each experimental group as follows and the differentiation progress was observed under the microscope for 72 hours.
  • myostatin was purchased from R & D Systems.
  • myostatin 8 ⁇ g / ml of myoblast C2C12 cell line inhibited muscle differentiation, and treatment with ACVR2B-Fc or DLK1-Fc prevented myostatin's muscle differentiation inhibitory effect. Muscle cell differentiation was found to occur well.
  • the immunoprecipitated pellets were washed three times with RIPA buffer, 80 ⁇ l of RIPA buffer was added and suspended, and then 20 ⁇ l of 5X sample buffer was added and reacted at 95 ° C. for 5 minutes. Then, the supernatant was collected by centrifugation and Western blot experiment was performed. 25 ⁇ l of samples each were loaded and 5% of cell lysate used for immunoprecipitation was loaded and used as a control. Next, it was transferred to a nitrocellulose membrane (NC membrane, Bio-Rad), and then blocked with 0.05% of 5% skim milk / TBST tween20 for 30 minutes, and DLK1 (R & D mAb1144).
  • NC membrane nitrocellulose membrane, Bio-Rad
  • KD values were determined by analyzing one site binding (hyperbola) using the GraphPad Reism 4 program based on the above experiments, and the results are shown in FIG. 14.
  • the KD value for myostatin was 256.2 nM ⁇ 4.897 for ACVR2B and 22.77 nM ⁇ 3.665 for DLK1, indicating that the binding force of DLK1 to myostatin was about 11 times higher than ACVR2B.
  • ACVR1A-Fc which does not bind to myostatin
  • the second antibody used Fc-HRP the second antibody used Fc-HRP.
  • Myostatin is a control group used to confirm only that binding to ACVR2B is inhibited by DLK1.
  • FIG. 15 Competitive standard immunoassay results are shown in FIG. 15, and as can be seen in FIG. 15, myostatin binds well to ACVR2B-Fc. At this time, it can be seen that when FLAG reacts tagged DLK1 with increasing concentration, it can prevent myostatin from binding to ACVR2B.
  • each deletion mutant is obtained by sequentially removing the epithelial cell-like repeat domain using the pYK602-DLK1-Fc construct (FIG. 16) as a template.
  • the structure of the resulting deletion mutant is shown in Figure 17, the amino acid sequence is shown in SEQ ID NO: 28 to SEQ ID NO: 34 (Table 14).
  • Primer set used in the PCR for the deletion mutant in this Example is shown in Table 13 below.
  • PCR reaction mixture was 10 ⁇ l 10X buffer, 10 ⁇ l dNTP mix, 1 unit pfu (Stratagene), 5 ⁇ l Forward primer, 5 ⁇ l Reverse primer, template pYK602-DLK1-Fc, sterilized tertiary distilled water 68 ⁇ l was used, and PCR conditions were denatured at 94 ° C for 30 seconds, followed by 30 cycles at 94 ° C for 30 seconds, 68 ° C for 1 minute, and 72 ° C for 5 minutes. The reaction was terminated by further reaction. PCR products were washed using a PCR clean up kit (Qiagen) and then cleaved by treatment with SfiI (NEB) restriction enzyme at 50 ° C.
  • the cleaved DNA fragment was purified using a gel elution kit (Qiagen).
  • the ligation reaction was performed using the prepared insert and the vector, and the composition of the ligation reaction was 1 ⁇ l of 10X ligase buffer, 1 ⁇ l of pYK602-Fc vector / SfiI, insert PCR product / SfiI 3 ⁇ l, ligase 1 ⁇ l (Roche) and sterilized tertiary distilled water 4 ⁇ l.
  • the ligation composition was allowed to react by overnight (O / N) at 4 ° C., and transformed into DH5 ⁇ competent cells.
  • the transformed cells were spread on LB / ampicillin plates and placed in a 37 ° C incubator. The next day the resulting colonies were collected in 5 ml of LB / ampicillin medium, incubated for 18 hours, and plasmid mini-prep. After the plasmid was separated using kit (NucleoGen), the separated plasmid was sequenced.
  • 293E cells were used. Specifically, 10 ⁇ g of DNA and 20 ⁇ g of PEI (# 23966, Polysciences, USA) were mixed at a cell level of about 70% of a 100 mm plate, and reacted for 20 minutes at room temperature to prepare a mixture and then treated the cells. After 16 to 10 hours, the medium was changed to serum-free DMEM medium, and the medium was collected every other day and then replaced with fresh medium. Cells that might remain in the medium by centrifugation were clearly removed and then filtered using a 0.22 ⁇ m filter (# PR02890 Millipore, USA). Purification was then performed using a Protein A column.
  • the coated chip was terminated by flowing 1 M ethanolamine-HCl (pH 8.5) for 200 seconds.
  • the chip was rotated 90 degrees and stabilized by flowing for 30 minutes with DPBST (PBS with 0.005% Tween 20).
  • DLK1-Fc or each of the purified deletion mutant proteins to be reacted was flowed at a rate of 30 ⁇ l / min for 120 seconds to determine the association constant and DPBST (PBS with 0.005% Tween 20 for 240 seconds).
  • Dissociation constant was determined.
  • DLK1 deletion mutations were used to determine the binding site of DLK1 and myostatin.
  • 1 ⁇ g / ml of C-terminal active myostatin (R & D systems) was coated onto immunoplate overnight at 4 ° C. (O / N) and 10 nM of each DLK1-Fc or DLK1 deletion mutant was maintained at room temperature for 2 hours.
  • Fc and ACVR2A-Fc which do not bind myostatin, were used as negative controls.
  • the anti-human Fc HRP (1: 1000, Pierce) was reacted at room temperature for 1 hour, and then developed using TMB solution (Sigma) and terminated with 2.5M H2SO4 solution.
  • the absorbance of myostatin and DLK1-Fc and DLK1 deletion mutants was measured at absorbance 450 and the results are shown in FIG. 20.
  • Myostatin is well known mechanism of inhibiting muscle differentiation by binding to ACVR2B and activating Smad signaling to raise pSmad2 / 3 expression level and reduce MyoD expression level. Therefore, it was confirmed through CAGA reporter analysis whether Smad signaling could be inhibited by treating DLK1 with myostatin.
  • PTAL-SBE-SEAP having a Smab binding element (SBE) in cells was transfected using Lipofectamine TM 2000 (Invitrogen). The next day, the cells were transferred to a 96-well plate, and then cultured for 16 hours in a medium without FBS the next day (serum starvation). Before activation with myostatin, DLK1 was treated by dilution from 10 ⁇ g / ml, and pretreated for 2 hours with B09 antibody, DLK1 antibody mAb1144 (R & D), ACVR2B antibodies AF339 and F08 which increase the binding of ACVR2B and DLK1. After that, 1 nM of myostatin was treated and activated. After 36 hours, reporter analysis was performed using the SEAP assay kit of Applied Biosystems, and the results are shown in FIG. 21.
  • Cells were incubated in a 60 mm dish for 24 hours to prepare for filling about 70% of the dish surface. Change to a medium containing no serum and incubated for 16 hours. The cells were treated with 10 ⁇ g / ml of DLK1-Fc for 2 hours before harvesting the cells, the cells were washed twice with cold DPBS (Welgene), and then cell lysate was prepared using RIPA buffer. Prepared. The prepared cell lysate was determined by concentration of BCA assay kit (Thermo.) And loaded into SDS-PAGE by 30 ⁇ g.
  • BCA assay kit Thermo.
  • DLK1 was found to increase Smad7 inhibits Smad signaling. This suggests that DLK1 is a very efficient inhibitor that not only inhibits Smad signaling by decreasing pSmad2 / 3 but also inhibits Smad signaling through Smad7.
  • composition comprising the DLK1 extracellular water-soluble domain of the present invention as an active ingredient can be developed as a prophylactic or therapeutic agent for metabolic diseases such as diabetes and muscle loss diseases such as muscle dwarfism by inhibiting the mechanism of action of myostatin. Do. In addition, it can be developed as a prophylactic or therapeutic agent by modification in various forms such as fragments, variants of DLK1 extracellular soluble domains, or fusion proteins in which these and human antibody Fc regions are bound.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Epidemiology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Diabetes (AREA)
  • Rheumatology (AREA)
  • Cell Biology (AREA)
  • Hematology (AREA)
  • Neurology (AREA)
  • Endocrinology (AREA)
  • Obesity (AREA)
  • Emergency Medicine (AREA)
  • Child & Adolescent Psychology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

본 발명은 DLK1 세포 외 수용성 도메인을 유효성분으로 포함하는 미오스타틴 저해제에 관한 것으로서, 보다 구체적으로는 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인 또는 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인의 결실 돌연변이체(delete mutant)를 유효성분으로 포함하는 미오스타틴(myostatin) 활성 저해용 조성물 등에 관한 것이다. 본 발명의 미오스타틴(myostatin) 저해제 등은 미오스타틴 또는 액티빈 수용체 타입 2B에 결합하여 미오스타틴의 작용 기작을 저해함으로써, 근육분화를 촉진시키고 지방세포로의 분화를 막아, 근육왜소증 등 근육세포 분화가 필요한 질병 또는 대사질환의 예방 및 치료에 사용될 수 있을 것으로 기대된다.

Description

ＤＬＫ１ 세포 외 수용성 도메인을 유효성분으로 포함하는 미오스타틴 저해제
본 발명은 DLK1 세포 외 수용성 도메인을 유효성분으로 포함하는 미오스타틴 저해제에 관한 것으로서, 보다 구체적으로는 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인 또는 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인의 결실 돌연변이체(delete mutant)를 유효성분으로 포함하는 미오스타틴(myostatin) 활성 저해용 조성물, 및 미오스타틴(myostatin) 관련 질환의 예방 또는 치료용 약학적 조성물에 관한 것이다.
미오스타틴(Myostatin)은 형질전환 생장인자-β(TGF-β, transforming growth factor-β) 슈퍼패밀리 중의 하나로 근육 성장에 매우 중요한 오토크린/파라크린(autocrine/paracrine)의 저해제로 작용하고 있다 (A.C. McPherron, A.M. Lawler, S.J. Lee, Nature. 387, 83-90, 1997). 미오스타틴은 376개의 아미노산으로 구성되어 있으며 2번의 프로테이나아제(proteinase)의 절단에 의해 프리커서 단백질이 활성화 된다. 그 첫 번째 단계는 퓨린 패밀리(purine family)의 효소에 의한 24개 아미노산 시그널 펩티드의 절단이며, 다음 단계는 BMP1/Tolloid matrix metalloproteinase에 의한 절단으로 240 ~ 243번째 아미노산인 RSRR (Arg-Ser-Arg-Arg)에서 절단이 일어나서 N-말단 쪽의 27.64 kDa 미오스타틴 프로텝타이드(myostatin propeptide)와 C-말단 쪽의 12.4 kDa으로 나누어지게 된다 (S.J. Lee, Annu. Rev. Cell. Dev. Biol. 20, 61-86, 2004). 성숙한 활성을 가지는 미오스타틴은 C-말단 부위가 이황화 결합(disulfide bond)을 통해 이합체(dimer)를 형성하게 되고, 이는 마우스, 래트, 돼지, 닭, 칠면조, 개 등에서 100%의 상동성을 보인다고 알려져 있다.
마우스에서 미오스타틴의 발현이 없어지면 골격근(skeletal muscle)의 질량이 비약적으로 증가되어, 근육이상발달증(muscle hypertrophy)과 근육과형성(hyperplasia)을 보인다 (A.C. McPherron et al., Nature. 387, 83-90, 1997; J. Lin et al., Biochem. Biophys. Res. Commun. 291, 701-706, 2002; T.A. Zimmers et al. Science. 296, 1486-1488, 2002). 마우스뿐 아니라 일부의 소와 양에서도 미오스타틴의 돌연변이로 인한 근육이상발달증이 보고되어 있다 (G. Hadjipavlou, et.al., Anim. Genet. 39, 346-353, 2008; A.C. McPherron and S.J. Lee, Proc. Natl. Acad. Sci. 94, 12457-12461, 1997; R. Kambadur et al., Genome Res. 7, 910-916, 1997). 최근에는 미오스타틴의 작용이 액티빈 수용체 타입 2B (AVR2B, activin receptor II B)에 직접적으로 결합하여 (S.J. Lee, and A.C. McPherron, Proc. Natl. Acad. Sci. U.S.A. 98, 9306-9311, 2001; A. Rebbapragada, et. al., Mol. Cell. Biol. 23, 7230-7242, 2003; R.S. Thies et. Al., Growth Factors. 18, 251-259, 2001), Smads signaling을 통한 신호 전달기작들이 보고 되고 있다 (S.J. Lee, and A.C. McPherron, Proc. Natl. Acad. Sci. U.S.A. 98, 9306-9311, 2001; A. Rebbapragada, et. al., Mol. Cell. Biol. 23, 7230-7242, 2003; X. Zhu, et. al., Cytokine. 26, 262-272, 2004). 미오스타틴은 Smad signaling이외에도 p38 MAPK 신호 전달, Ras-ERK1/2 경로(pathway)와 JNK 신호전달에도 영향을 준다는 사실이 보고 되어 있다 (Z.Q. Huang et. al., Cell. Signal. 19, 2286-2295, 2007; B. Philip, et. al., Cell. Signal. 17, 365-375, 2005; C.A. Steelman, et. al., FASEBJ. 20, 580-582, 2006; W. Yang et. al., Cancer Res. 66, 1320-1326, 2006). 이외에도 미오스타틴은 글루코코르티코이드(glucocorticoid)에 의해 발생하는 근육왜소증(muscle atrophy) (D.L. Allen et. al. J. Appl. Physiol. 109, 692-701, 2010; K. Ma et. al., Am. J. Physiol. 285, E363-E371, 2003), HIV감염에 의해 야기되는 골근육퇴화증(skeletal muscle degenerationrelated diseases) (N.F. Gonzalez-Cadavid et. al., Proc. Natl. Acad. Sci. U.S.A. 95, 14938-14943, 1998) 및 만성질환(chronic illnesses) 등에서 발현이 증가하는 것이 보고 되었다 (K.A. Reardon, et. al., Muscle Nerve. 24, 893-899, 2001). 또한 미오스타틴의 발현 증가는 비만(obesity), 당뇨병(diabetes)과 같은 대사장애(metabolic disorders)와도 관련이 있다고 알려져 있다 (D.S. Hittel et. al., Diabetes. 58, 30-38, 2009; G. Milan et. al., J. Clin. Endocrinol. Metab. 89, 2724-2727, 2004; Y. W. Chen et. al., Biochem. Biophys. Res. Commun. 388, 112-116, 2009). 비만(obese)은 지방조직 질량(adipose tissue mass)을 증가 시키고 인슐린 저항성을 증가 시키는 대사불균형과 관련이 있다. 비만 및 인슐린 저항성을 나타내는 사람의 근육에서 미오스타틴의 mRNA와 단백질의 발현이 증가한다는 사실이 보고되었으며 (D.S. Hittel et. al., Diabetes. 58, 30-38, 2009; G. Milan et. al., J. Clin. Endocrinol. Metab. 89, 2724-2727, 2004; J.J. Park et. al., Physiol. Genomics. 27, 114-121, 2006). 미오스타틴 발현이 안되는 마우스(Myostatin-null mice)는 체지방(fat mass) 감소와 고지방 유도성 인슐린 저항력을 가지고 있다고 보고되었다 (A.C. McPherron, and S.J. Lee, J. Clin. Invest. 109, 595-601. 40, 2002). 또한 미오스타틴이 발현되지 않는 마우스는 정상 마우스(wild type mice)에 비해 고지방식(high fat diet)에 의한 체지방 상승이 낮은 것이 알려졌으며 (A.C. Dilger et. al., Anim. Sci. J. 81, 586-593, 2010), 미오스타틴의 억제능의 프로펩파이드(inhibitory propeptide) 도메인을 과발현 시키면 고지방식에 의해 유도되는 비만과 인슐린 저항성을 막을 수 있다는 보고도 있다 (B. Zhao et. al., Biochem. Biophys. Res. Commun. 337, 248-255, 2005). 또한 최근의 인 비보(in vivo) 연구에서 미오스타틴의 기능을 상실시키면 인슐린 감수성을 증가시켜 글루코스의 이용율이 올라갔다는 연구결과가 있다 (T. Guo et. al., PloS. ONE. 4, e4937, 2009; J.J. Wilkes et. al., Diabetes. 58, 1133-1143, 2009). 그리고 미오스타틴은 근육세포에서 글루코스의 소비를 촉진시키고 글르코스 흡수를 AMPK 시그날 경로를 통하여 글루코스 대사를 조절하는 것이 발혀졌다 (Y.W. Chen et. al., Int. J. Biochem. Cell. Biol. 42, 2072-2081, 2010).
즉 미오스타틴의 기작을 막으면 근육 분화를 촉진시키고 지방세포로의 분화를 막아 비만을 방지하며, 당뇨병 등과 같은 대사장애의 개선에 중요한 역할을 할 수 있을 것으로 생각되고 있다. 따라서 미오스타틴 저해제에 대한 연구가 중요한데 현재까지는 미오스타틴의 수용체인 ACVR2B를 Fc에 융합시킨 수용성 ACVR2B-Fc에 의한 보고가 있으며, ACVR2B-Fc에 의해 미오스타틴의 근육생성억제 기능을 막은 보고가 있다 (Lee et. al., Proc. Natl. Acad. Sci. U.S.A. 102, 1817-18122, 2005). 또 다른 시도로는 미오스타틴에 결합하는 것으로 알려진 폴리스타틴(follistatin)을 이용하여 미오스타틴의 저해 효과를 보인 사례가 있다 (Lee et al. Mol. Endocrinol. 24(10),1 998-2008, 2010).
한편, 노취/델타/서레이트계(notch/delta/serrate family)에 속하는 DLK1(Delta-like protein 1)은 염색체 14q32에 위치하는 dlk1 유전자에 암호화 되어 있는 막통과(transmembrane) 당단백질로서, 383개의 아미노산으로 구성되어 있다. 상기 단백질은 280개의 세포 외 지역과 24개의 막 통과 지역, 56개의 세포 내 지역으로 나뉘며, 이중 세포막 밖 부분에 6개의 상피세포 성장 인자 유사 반복(epidermal growth factor like repeat) 도메인을 가지고 있으며, 3개의 N-당화(glycosylation)와 7개의 O-당화 위치를 가지고 있다. DLK1은 막단백질이기도 하지만, 종양괴사인자 알파 전환 효소(Tumor necrosis factor alpha converting enzyme; TACE)에 의해 세포막 바깥 부분이 세포막에서 떨어져 나와(shedding), 따로 기능을 가지기도 하는 단백질로 잘 알려져 있다 (Yuhui Wang and Hei Sook Sul, Molecular and cellular biology. 26(14): 5421-5435, 2006).
DLK1은 세포막에서 당화에 의해 50 ~ 60 kDa의 다양한 형태로 발견되고 있으며 (Smas CM and Sul HS, Cell. 73: 725-34, 1993), 선택적 유전자 접합(alternative splicing)에 의해 4가지 접합 변이체(splicing variant)를 가진다 (Smas CM et al., Biochemistry. 33: 9257-65, 1994). 이중 큰 2가지의 변이체가 단백질 분해효소 절단 부위를 가지며, 단백질 분해 효소인 TACE에 의해 절단되어 50 kDa 크기와 25 kDa 크기의 2가지 수용성 형태가 생성된다 (Yuhui Wang et al., Journal of Nutrition. 136: 2953-2956, 2006).
DLK1은 발생 단계에서 주로 발현이 되며 배 조직(embryonic tissue) (Smas CM et al., Cell. 73: 725-34, 1993; Kaneta M et al., Journal of Immunology. 164: 256-64, 2000), 및 태반(placenta)에서 주로 발현되고, 특히 모자의 혈청(maternal serum)에서 고농도로 검출되고 있어 태아 항원1(fetal antigen 1; FA1)로도 알려져 있다 (Jensen CH et al., European Journal of Biochemistry. 225: 83-92, 1994). 또한 췌장의 성세포(glandular cell) (Kaneta M et al., Journal of Immunology. 164: 256-64, 2000), 난소 세포(ovary), 골격 근섬유(skeletal myotubes) (Floridon C et al., Differentiation. 66: 49-59, 2000) 등의 발현도 보고되어 있다. DLK1은 출생 이후 대부분의 조직에서 발현이 없어지고 지방 분화 전 세포(preadipocyte) (Smas CM et al., Cell. 73: 725-34, 1993), 췌장 섬 세포(pancreatic islet cell) (Carlsson C et al., Endocrinology. 138: 3940-8, 1997), 흉선 체세포(thymic stromal cell) (Kaneta M et al., Journal of Immunology. 164: 256-64, 2000), 부신 세포(adrenal gland cell) (Halder SK et al., Endocrinology. 139: 3316-28, 1998) 등의 특정 세포에서만 발현이 된다. DLK1의 발현은 메칠화에 의한 영향으로 부계의 염색체에서만 발현(paternal monoallelic expression)이 되는 것으로 알려져 있다 (Schmidt JV et al., Genes and Development. 14: 1997-2002, 2000; Takada S et al., Current Biology 10: 1135-8, 2000; Wylic AA et al, Genome Research. 10: 1711-8, 2000).
한편, 액티빈 수용체 타입 2B(ACVR2B, activin receptor type II B)는 ACVR2B 유전자에 의해 암호화 되어 있는 단백질로서, 액티빈 신호전달 기전에 관계된다. 액티빈에 의한 신호 전달은 난포 자극 호르몬(follicle-stimulating hormone, FSH)의 생성이나 분비, 월경 주기의 조절에 관여하는 것으로 알려져 있으며, 세포의 증식(proliferation), 분화(differentiation), 세포 사멸(apoptosis)에 작용한다 (Chen et al., Exp. Biol. And Med. 231(5): 534-544, 2006).
DLK1의 기능연구는 지방세포분화를 억제하는 인자 Pref-1(preadipocyte factor-1)로 알려져 가장 많은 연구가 이루어져 있다 (Smas CM et al., Cell. 73: 725-34; Villena JA et al., Hormone and Metabolic Research. 34: 664-70, 2002). 지방세포 분화 억제능력을 제외하고도 DLK1은 혈액 생성 줄기 세포 (hematopoietic stem cells)의 분화를 억제하고 (Sakajiri S et al., Leukemia. 19: 1404-10, 2005; LiLetal.,Oncogene.24:4472-6,2005), 임파선 전구세포(lymphoid progenitor cell)의 분화를 조절 (Bauer SR et al., Molecular and Cellular Biology. 18: 5247-55, 1998; Kaneta M et al., Journal of Immunology. 164: 256-64, 2000)하는 역할 및 상처 치유(wound healing)에 관계 (Samulewicz SJ et al., Wound Repair and Regeneration. 10: 215-21, 2002)된 것으로도 알려져 있다. 또한 DLK1은 골격근 발달과 재생성에 필요하며 (Jolena N. et. al., PLoS One 5(11), e15055, 2010), DLK1의 과발현은 큰 근육을 생성하는 칼리피지의 표현형(Callipyge Phenotype)을 보이는 것으로 보고되었다 (Erica Davis et. al., Current Biology, 14, 1858-1862, 2004).
지금까지의 알려진 바로는 DLK1은 근육을 증가 시키고, 지방세포 분화를 억제하는 작용을 하는 것을 알 수 있다. 따라서 기존의 미오스타틴 저해제들에 비해 DLK1은 지방세포의 생성도 억제하고 근육세포 생성을 촉진하는 두 가지 역할을 다 할 수 있는 장점을 가지고 있다.
이에, 본 발명자들은 DLK1의 세포 외 영역 수용성 도메인의 근육세포 분화 촉진 및 지방세포 분화 억제 작용 기전을 밝히기 위하여 예의 노력한 결과, DLK1의 세포 외 영역 수용성 도메인이 미오스타틴(myostatin)의 수용체로 작용하는 액티빈 수용체 타입 2B(ACVR2B, activin receptor type II B)에 결합하여, 미오스타틴과 ACVR2B의 결합을 차단함으로써 미오스타틴의 근육 분화 억제 작용을 저해할 뿐만 아니라, 미오스타틴에 직접적으로 결합함으로써 미오스타틴의 조절 기작에 영향을 미친다는 것을 발견하고, 본 발명은 완성하였다.
본 발명이 이루고자 하는 기술적 과제는 DLK1이 액티빈 수용체 타입 2B(ACVR2B) 및 미오스타틴(myostatin)에 결합함으로써 근육세포의 분화를 촉진시킨다는 점을 이용하여, 새로운 미오스타틴 저해제 및 미오스타틴과 관련된 질병의 예방 및 치료용 약학적 조성물을 제공하는 데 있다.
상기의 목적을 달성하기 위하여, 본 발명은 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인, DLK1의 세포 외 수용성 도메인의 단편, DLK1의 세포 외 수용성 도메인의 변이체(mutant) 또는 상기 변이체의 단편을 유효성분으로 포함하는 미오스타틴(myostatin) 활성 저해용 조성물을 제공한다.
또한, 본 발명은 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인 또는 이의 단편과 인간 항체 Fc 영역이 접합된 DLK1-Fc 융합 단백질을 유효성분으로 포함하는 미오스타틴(myostatin) 활성 저해용 조성을 제공한다.
또한, 본 발명은 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인, DLK1의 세포 외 수용성 도메인의 단편, DLK1의 세포 외 수용성 도메인의 변이체(mutant) 또는 상기 변이체의 단편을 유효성분으로 포함하는 미오스타틴(myostatin) 관련 질환의 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 본 발명은 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인 또는 이의 단편과 인간 항체 Fc 영역이 접합된 DLK1-Fc 융합 단백질을 유효성분으로 포함하는 미오스타틴(myostatin) 관련 질환의 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 본 발명은 DLK1-미오스타틴, DLK1-ACVR2B 또는 이의 가용성 단편에 특이적으로 결합하는 항체 또는 앱타머를 포함하는 미오스타틴 관련 질환의 진단 키트를 제공한다.
본 발명의 미오스타틴(myostatin) 저해제 등은 미오스타틴 또는 액티빈 수용체 타입 2B에 결합하여 미오스타틴의 작용 기작을 저해함으로써, 근육분화를 촉진시키고 지방세포로의 분화를 막아 비만을 방지하며, 당뇨병 등과 같은 대사 장애의 개선에 중요한 역할을 수행할 수 있으며, 근육왜소증 등 근육세포 분화가 필요한 질병의 예방 및 치료에 사용될 수 있을 것으로 기대된다.
도 1은 수용성 DLK1에 대한 다클론 파지 항체의 효소 면역 측정법 결과를 나타낸다.
도 2는 수용성 DLK1에 대한 단일클론 항체의 다양성을 핑거프린팅을 통해 확인한 결과를 나타낸다.
도 3은 수용성 DLK1에 대한 단일파지클론 항체의 CDR에서 폴리펩티드를 분석한 결과를 나타낸다.
도 4는 pNATAB H 벡터의 개열지도를 나타낸다.
도 5는 pNATAB L 벡터의 개열지도를 나타낸다.
도 6은 B09 항체가 DLK1의 수용성 부분에 특이적으로 결합하고 있음을 보이는 유세포 이동 분석 결과(상단) 및 형광면역염색 결과(하단)를 나타낸다.
도 7은 BstNI에 의해 잘려진 단일클론파지 항체들의 단편을 PCR로 확인한 것이다.
도 8은 수용성 ACVR2B에 대한 단일파지클론 항체 heavy chain의 CDR에서 폴리펩티드를 분석한 결과를 나타낸다.
도 9는 수용성 ACVR2B에 대한 단일파지클론 항체 light chain의 CDR에서 폴리펩티드를 분석한 결과를 나타낸다
도 10은 근아세포(myoblast) C2C12 세포주에서 DLK1-Fc가 미오스타틴(myoxtatin)의 근육분화 저해 효과를 억제하는 것을 확인한 실험 결과이다.
도 11은 DLK1과 미오스타틴 또는 ACVR2B의 결합을 확인하기 위한 면역침강분석 실험 결과이다.
도 12는 DLK1과 미오스타틴의 결합력 확인을 위한 ELISA 분석 결과이다.
도 13은 미오스타틴과 DLK1 또는 ACVR2B의 결합력 확인을 위한 ELISA 분석 결과이다.
도 14는 미오스타틴의 ACVR2B와 DLK1에 대한 Kd 값을 확인한 결과이다.
도 15는 DLK1과 ACVR2B의 미오스타틴에 대한 결합력 측정을 위한 결쟁 ELISA 분석 결과이다.
도 16은 pYK602-DLK1-Fc 구조(construct)를 나타낸 것이다.
도 17은 DLK1 EGF-유사 반복 서열 결실 돌연변이체(EGF-like repeat deletion mutants)의 구조를 도식화한 것이다.
도 18은 DLK1-Fc 및 각각의 결실 돌연변이 단백질의 발현을 SDS-PAGE 분석을 통하여 확인한 결과를 나타낸 것이다.
도 19는 DLK1의 ACVR2B에 대한 결합 부위를 확인하기 위해 SPR 실험을 수행한 결과이다.
도 20은 DLK1 결실 돌연변이를 이용하여 DLK1과 미오스타틴의 결합 부위를 확인한 실험 결과이다.
도 21은 DLK1의 미오스타틴 저해 효과를 확인하기 위한 CAGA (pTAL-SBE-SEAP) 리포터 분석 결과이다.
도 22는 DLK1에 의한 Smad7 증가를 확인한 웨스트 블랏 결과이다.
상기의 목적을 달성하기 위하여, 본 발명은 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인, DLK1의 세포 외 수용성 도메인의 단편, DLK1의 세포 외 수용성 도메인의 변이체(mutant) 또는 상기 변이체의 단편을 유효성분으로 포함하는 미오스타틴(myostatin) 활성 저해용 조성물을 제공한다.
또한, 본 발명은 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인 또는 이의 단편과 인간 항체 Fc 영역이 접합된 DLK1-Fc 융합 단백질을 유효성분으로 포함하는 미오스타틴(myostatin) 활성 저해용 조성물을 제공한다.
본 발명에서 용어, "DLK1(delta-like 1 homolog)"은 염색체 14q32에 위치하는 dlk1 유전자에 암호화되어 있는 383개의 아미노산으로 구성되어 있는 막 통과 당단백질을 의미한다.
본 발명에서 용어, "DLK1의 세포 외 영역 수용성 도메인"이란 세포 외 영역, 막 통과 영역 및 세포 내 영역으로 나뉘는 DLK1 단백질 중 세포 외 영역의 수용성 도메인을 의미한다. DLK1의 세포 외 영역 수용성 도메인의 항암효과는 본 발명자들에 의해서 최초로 규명된 바 있으며, 본 발명에서는 DLK1의 세포 외 수용성 도메인의 근육세포 분화 촉진 및 지방세포 분화 효과를 발견하였다.
본 명세서에서 DLK1의 세포 외 수용성 도메인은 수용성 DLK1과 혼용하여 표현할 수 있다.
바람직하게, 본 발명의 수용성 DLK1은 수용성 DLK1 활성을 갖는 200 내지 300개의 아미노산으로 이루어질 수 있으며, 보다 바람직하게는 서열번호 29로 기재되는 아미노산 서열로 이루어질 수 있으나, 수용성 DLK1 활성을 나타내는 아미노산 서열은 제한 없이 포함될 수 있다.
본 발명에서 상기 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인의 변이체(mutant)는 DLK1의 세포 외 수용성 도메인의 결실 돌연변이체(delete mutant)인 것을 특징으로 한다.
본 발명에서 용어, "DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인의 결실 돌연변이체(delete mutant)"는 상피세포 성장인자-유사 반복서열(EGF-like repeat) 또는 막근접(juxtamembrane) 서열을 포함하는 결실 돌연변이로서, 구체적으로 수용성 DLK1의 상피세포 성장인자-유사 반복서열(EGF-like repeat) 도메인을 순차적으로 결실시킨 결실 돌연변이를 의미한다.
바람직하게, 본 발명의 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인의 결실 돌연변이체(delete mutant)는 6개의 EGF-유사 반복서열 도메인 중 첫 번째와 두 번째 도메인을 결실시킨 EGF3-6, 첫 번째부터 세 번째 도메인을 결실시킨 EGF4-6, 첫 번째부터 네 번째 도메인을 결실시킨 EGF5-6, 첫 번째부터 다섯 번째 도메인을 결실시킨 EGF6, 및 6개의 도메인을 모두 결실시킨 JM (Juxtamembrane region)로 이루어진 군 중 어느 하나일 수 있으며, 보다 더 바람직하게는 서열번호 30 내지 서열번호 34로 기재된 아미노산 중 어느 하나의 서열로 이루어질 수 있으나, 이제 제한되지 않는다.
본 발명에서 상기 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인, DLK1의 세포 외 수용성 도메인의 단편, DLK1의 세포 외 수용성 도메인의 변이체(mutant) 또는 상기 변이체의 단편은 미오스타틴(myostatin) 또는 액티빈 수용체 타입 2B(ACVR2B)에 결합하여 미오스타틴(myostatin)의 작용을 억제함으로써 근육세포 분화 촉진 및/또는 지방세포 분화 억제에 관여한다.
구체적으로, DLK1과 ACVR2B 사이의 관계에서는 상피세포 성장인자-유사 반복서열(EGF-like repeat) 5, 6 또는 막근접(juxtamembrane) 서열이 중요하고, DLK1과 미오스타틴(myostatin) 사이의 관계에서는 막근접(juxtamembrane) 서열이 중요하며, 이를 본 발명의 실시예에서 밝혔다.
본 발명에서 용어, "액티빈"은 분자량이 약 25,000인 펩티드성 호르몬의 일종으로서, 인히빈 A의 β사슬의 호모2합체(βAβA)인 액티빈 A, 인히빈 B의 β사슬의 호모2합체(βBβB)인 액티빈 B, 이들의 헤테로2합체(βAβB)인 액티민 AB 등 3종류가 있다. 바람직하게, 상기 액티빈은 액티빈 A일 수 있다.
본 발명에서 용어, "액티빈 수용체 타입 2B(ACVR2B)"는 ACVR2B 유전자에 의해 암호화되어 있는 단백질로서 미오스타틴(myostatin)의 대표적인 수용체로 알려져 있다. 미오스타틴과 액티빈 수용체 타입 2B의 결합에 의한 신호전달은 미오스타틴의 근육세포 분화 억제를 촉진시키며, 지방세포 분화를 일으켜 각종 근육 관련 질환 및 대사질환에 관여하는 것으로 알려져 있다.
본 발명의 또 다른 한 양태로서, 본 발명은 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인, DLK1의 세포 외 수용성 도메인의 단편, DLK1의 세포 외 수용성 도메인의 변이체(mutant) 또는 상기 변이체의 단편을 유효성분으로 포함하는 미오스타틴(myostatin) 관련 질환의 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 본 발명은 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인 또는 이의 단편과 인간 항체 Fc 영역이 접합된 DLK1-Fc 융합 단백질을 유효성분으로 포함하는 미오스타틴(myostatin) 관련 질환의 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 본 발명의 또 다른 한 양태로서, 본 발명은 본 발명에 따른 약학적 조성물을 미오스타틴(myostatin) 관련 질환이 발병한 또는 발병 가능성이 있는 개체에게 투여하는 단계를 포함하는 질병의 치료방법을 제공한다.
본 발명에서 용어, "예방"이란 본 발명의 약학적 조성물의 투여에 의해 질병을 억제시키거나 발병을 지연시키는 모든 행위를 의미하고, 용어 "치료"란 본 발명의 약학적 조성물의 투여에 의해 질병에 의한 증세를 호전시키거나 이롭게 변경하는 모든 행위를 의미한다.
본 발명에서 용어, "개체"란 본 발명의 조성물을 투여하여 증상이 호전될 수 있는 질환을 가진 인간과 원숭이, 개, 염소, 돼지, 또는 쥐 등의 동물을 의미한다. 본 발명에 따른 조성물은 인간(치료, 억제 또는 예방)용일 뿐만 아니라 상업적으로 유용한 다른 동물들에게도 적용될 수 있다.
본 발명의 약학적 조성물은 미오스타틴(myostatin)의 과발현 또는 미오스타틴/액티빈 수용체 타입 2B의 신호전달에 의한 미오스타틴 관련 질병이면, 제한 없이 사용할 수 있다. 미오스타틴 관련 질병으로 다양한 형태의 근육 감소(muscle wasting) 질환, 대사 질환, 퇴행성 골 질환, 성기능 항진증(hypogonadism) 및 다양한 원인의 악액질(cachexia)을 포함할 수 있으며, 이에 한정되지 않는다.
본 발명의 상기 근육 감소(muscle wasting) 질환으로는 뒤셴근이영양증(Duchenne's muscular dystrophy), 진행성근이영양증(progressive muscular dystrophy), 베커형근이영양증(Becker's type muscular dystrophy), 안면견갑상완근이영양증(Dejerine-Landouzy muscular dystrophy, facioscapulohumeral muscular dystrophy), 사지연결근육퇴행위축(limb girdle muscular dystrophy, Erb's muscular dystrophy), 에머리-드레이푸스 근육퇴행위축(Emery Dreifuss muscular dystrophy), 경직성 척추 증후군(rigid spine syndrome), 근육-눈-뇌병(muscle-eye-brain disease), 근위축성 측삭경화증(루게릭병, amyotrophic lateral sclerosis), 선천성 근위축증(congenital muscular dystrophy), 영아 신경축삭근위축증(infantile neuroaxonal muscular dystrophy), 근육긴장퇴행위축(myotonic dystrophy, Steinert's disease), 비디스트로피근육긴장증(nondystrophic myotonia), 샤르코-마리-투스병(Charcot-Marie-Tooth disease), 만성 염증성 신경증(chronic inflammatory neuropathy), 말단근병증(distal myopathy), 및 기타 Emery Lancet 359:687-695 (2002) and Khurana et al, Nat. Rev. Drug Disc 2:379-386 (2003)에 개시된 다양한 질병들을 포함할 수 있으며, 이에 한정되지 않는다.
본 발명의 상기 대사 질환은 제2형 당뇨병(type 2 diabetes), 비인슐린의존성 당뇨(noninsulin-dependent diabetes mellitus), 과혈당증(hyperglycemia), 비만 및 당뇨성신증과 같은 당뇨합병증을 포함하며, 이에 한정되지 않는다.
만성 질병으로부터 일어나는 추가적인 근손실증(muscle wasting disorders)은 만성폐쇄성폐질환(chronic obstructive pulmonary disease, COPD) 및 낭포성 섬유증(cystic fibrosis)과 같은 폐질환 악액증(pulmonary cachexia), 심장질환 악액증(cardiac cachexia), 암으로 인한 악액증(cancer or tumor related cachexia), 류머티즘성 악액증(rheumatoid cachexia) 및 화학치료제(chemotherapeutic agents)로 인한 악액증을 포함하며, 이에 한정되지 않는다.
본 발명의 용어, "악액증(cachexis)"이란 상기 다양한 질병으로 인하여 근육 손실(wastinf muscle) 및 체질량(lean body mass) 손실을 촉진시키는 상태를 의미한다.
본 발명의 약학적 조성물은 미오스타틴 저해제 이외에도 기존 치료 활성 성분, 기타 보조제, 약제학적으로 허용 가능한 담체를 포함할 수 있다. 이러한 조성물에 포함될 수 있는 적합한 담체, 부형제 및 희석제의 예로는 락토오스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 비정질 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유 등을 들 수 있다. 상기 조성물은 약제화하는 경우, 통상의 충진제, 증량제, 결합제, 붕해제, 계면활성제, 항응집제, 윤활제, 습윤제, 향료, 유화제, 방부제 등을 추가로 포함할 수 있다.
본 발명의 약학적 조성물은 일반적인 의약품 제제의 형태로 사용될 수 있으며, 제제화 할 경우에는 약제학적으로 허용 가능한 희석제 또는 부형제 등을 사용할 수 있다. 본 발명의 조성물은 각각의 사용 목적에 맞게 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁제, 에멀젼, 시럽, 에어로졸 등의 경구 제형, 멸균 주사용액의 형태 등 다양한 형태로 제형화 하여 사용할 수 있으며, 경구투여하거나 정맥내, 복강내, 피하, 직장, 국소 투여 등을 포함한 다양한 경로를 통해 투여될 수 있다.
경구투여를 위한 고형 제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형 제제는 상기 조성물에 적어도 하나 이상의 부형제, 예를 들면 전분, 탄산칼슘, 수크로스, 락토오스, 젤라틴 등을 섞어 제형화 한다. 또한, 단순한 부형제 이외에 마그네슘 스테아레이트, 탈크와 같은 윤활제들도 사용된다.
경구용 액상 제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순 희석제인 물, 액체 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다.
비경구투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수성용제, 현탁제로는 프로필렌글리콜, 폴리에틸렌글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 주사제의 기제로는 용해제, 등장화제, 현탁화제, 유화제, 안정화제 및 방부제와 같은 종래의 첨가제를 포함할 수 있다.
본 발명에 있어서 "투여"는 임의의 적절한 방법으로 환자에게 소정의 물질을 제공하는 것을 의미하며, 본 발명의 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 일반적인 모든 경로를 통하여 경구 또는 비경구 투여될 수 있다. 또한, 조성물은 활성물질이 표적 세포로 이동할 수 있는 임의의 장치에 의해 투여될 수 있다.
본 발명의 조성물은 약제학적으로 유효한 양으로 투여한다.
본 발명에 있어서 용어, "약제학적으로 유효한 양"은 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분한 양을 의미하며, 유효 용량 수준은 환자의 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여경로 및 배출 비율, 치료기간, 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 본 발명의 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있으며, 단일 또는 다중 투여될 수 있다. 상기한 요소들을 모두 고려하여 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 이는 당업자에 의해 용이하게 결정될 수 있다.
또한, 본 발명에 따른 화합물의 투여량은 체내 흡수도, 체중, 환자의 연령, 성별, 건강상태, 식이, 투여시간, 투여방법, 배설율, 질환의 중증도 등에 따라 변화될 수 있다. 그러나 바람직한 효과를 위해서, 본 발명의 화합물은 체중 1 ㎏ 당 1일 0.001 ~ 150 ㎎으로, 바람직하게는 0.01 ~ 100 ㎎으로 투여하는 것이 좋다. 투여는 하루에 한 번 투여할 수도 있고, 수 회 나누어 투여할 수도 있다. 상기 투여량은 어떠한 면으로든 본 발명의 범위를 한정하는 것은 아니다.
본 발명의 또 다른 한 양태로서, 본 발명은 DLK1-미오스타틴, DLK1-ACVR2B 또는 이의 가용성 단편에 특이적으로 결합하는 항체 또는 앱타머를 포함하는 미오스타틴 관련 질환의 진단 키트를 제공한다.
본 발명의 상기 진단 키트는 효소면역분석(ELISA) 키트 또는 샌드위치 ELISA 키트를 포함하나 이에 제한되지 않는다. 또한, 바람직하게, 상기 미오스타틴 관련 질환 진단용 키트는 분석 방법에 적합한 한 종류 또는 그 이상의 다른 구성성분 조성물, 용액 또는 장치를 더 포함하여 구성될 수 있다. 또한 바람직하게는, ELISA를 수행하기 위해 필요한 필수 요소를 포함하는 것을 특징으로 하는 진단 키트일 수 있다. ELISA 키트는 상기 단백질에 대한 특이적인 항체를 포함한다. 항체는 각 마커 단백질에 대한 특이성 및 친화성이 높고 다른 단백질에 대한 교차 반응성이 거의 없는 항체로, 단클론 항체, 다클론 항체 또는 재조합 항체이다. 또한 ELISA 키트는 대조군 단백질에 특이적인 항체를 포함할 수 있다. 그 외 ELISA 키트는 결합된 항체를 검출할 수 있는 시약, 예를 들면, 표지된 2차 항체, 발색단(chromophores), 효소(예: 항체와 컨주게이트됨) 및 그의 기질 또는 항체와 결합할 수 있는 다른 물질 등을 포함할 수 있다.
이하, 본 발명의 이해를 돕기 위하여 바람직한 실시예를 제시한다. 그러나 하기의 실시예는 본 발명을 보다 쉽게 이해하기 위하여 제공되는 것일 뿐, 하기 실시예에 의해 본 발명의 내용이 한정되는 것은 아니다.
실시예 1. 수용성 DLK1 및 DLK1-Fc 융합 단백질의 제조
본 명세서의 실시예에서 사용한 DLK1의 세포 외 영역 수용성 도메인(이하, 수용성 DLK1) 및 수용성 DLK1과 인간항체 Fc 영역이 접합된 DLK1-Fc 융합 단백질(이하, DLK1-Fc)은 대한민국등록특허 제10-0982170호에 개시된 방법에 따라 제조하였다.
실시예 2. ACVR2B-Fc 융합 단백질의 제조
본 명세서의 실시예에서 사용한 ACVR2B-Fc는 서열번호 1로 기재되는 ACVR2B의 세포외 도메인(extracellular domain)을 인간항체 Fc에 접합(fusion)시켰으며, 상기 실시예 1과 동일한 벡터, 동일한 발현 방법, 동일한 정제 방법을 사용하여 제조하였다.
실시예 3. DLK1의 수용성 부분에 특이적으로 결합하는 인간 항체(B09)의 제 작 및 검증
3-1. DLK1의 수용성 부분에 특이적으로 결합하는 인간 항체의 제작
<3-1-1> 라이브러리 파지의 제조
다양성을 가진 인간 유래 scFv 라이브러리 세포 2.7×1010를 2×YTCM [Tryptone (CONDA, 1612.00) 17 g, Yeast extract (CONDA, 1702.00) 10 g, NaCl (sigma, S7653-5 ㎏) 5 g, chloramphenicol (sigma, C0857) 34 ㎍/㎖)], 2% 글루코즈 (sigma, G5400) 및 5 mM MgCl2 (sigma, M2393)를 포함하는 배지 (3 ℓ)에서 37℃의 온도로 2 내지 3시간 동안 배양한 후 (OD600=0.5~0.7), 헬퍼 파지 (helper phage)를 감염시켜 2×YTCMK [2×YT CM, Kanamycin (sigma, K1876) 70 ㎍/㎖, 1 mM IPTG (ELPISBIO, IPTG025)] 배지에서 30℃의 온도로 16시간 동안 배양하였다. 배양한 세포를 원심분리 (4500 rpm, 15분, 4℃)한 후, 상등액에 4% PEG (Fluka, 81253) 6000과 3% NaCl (sigma, S7653)을 첨가하여 잘 녹인 다음 얼음에서 1시간 동안 반응하였다. 다시 원심분리 (8000 rpm, 20분, 4℃)한 후, 펠렛에 PBS를 첨가하여 녹인 다음 원심분리 (12000 rpm, 10 분, 4℃)하여 라이브러리 파지를 포함하는 상등액을 새 튜브에 넣어 4℃에서 보관하였다.
<3-1-2> 단일클론항체의 제조
(1) 패닝(Panning) 과정
상기 실시예 1에서 수득한 정제된 DLK1-Fc 30 ㎍을 Immunosorb 튜브 (Nunc 470319)에 4 ㎖의 코팅 완충용액 [coating buffer; Na2CO3 (sigma, S7795) 1.59 g, NaHCO3 (sigma, S8875) 2.93 g, NaN3 (sigma, S2002), 0.2 g]으로 4℃에서 16시간 정도 회전기(rotator)로 코팅한 후, 실온에서 2시간 동안 PBS에 녹여 탈지유 [(BD,232100)-4% in 1XPBS]를 사용하여 면역튜브(immunotube)에서 차단하였다. 제조한 라이브러리 파지 2 ㎖을 면역튜브에 첨가하여 실온에서 2시간 동안 반응시키고, PBST (0.05%)로 5회, PBS로 2회 세척하였다. 세척 후 특이적으로 결합한 scFv-파지들만 100 mM TEA (Sigma T-0886)로 용리하여, 용출된 파지들을 대장균 (XL1-Blue, stratagene, 200249)에 감염시켜 증폭하였다. 첫 번째 패닝에서 증폭된 파지를 PBST 세척 횟수만 늘려서 (2차: 13번, 3차: 23번) 동일한 방법으로 2차, 3차 패닝을 수행하였다.
그 결과, 패닝을 통한 항체의 역가 상승은 표 1에 나타난 바와 같았다.
표 1
Figure PCTKR2013000033-appb-T000001
(2) 파지 효소 면역 측정법(ELISA)에 의한 파지 항체 탐색
① 패닝 결과 확인
1차부터 3차까지 패닝하여 얼려두었던 세포 저장물(stock)을 5 ㎖의 2×YTCM, 2% 글루코즈, 5 mM MgCl2 배지에 OD600=0.1이 되게 넣어준 다음, 37℃에서 2 내지 3시간 동안 (OD600=0.5~0.7) 배양하였다. 이후, M1 헬퍼 파지를 감염시키고 2×YTCMK, 5 mM MgCl2, 1 mM IPTG 배지에서 30℃의 온도로 16시간 동안 배양하였다. 배양한 세포를 원심분리한 후 (4500 rpm, 15 분, 4℃) 상등액 (패닝된 poly scFv-파지)을 새 튜브로 옮겼다. 96-웰 면역 플레이트 (NUNC 439454)에 항원을 웰 당 100 ng씩 4℃에서 16시간 정도 코팅 완충용액으로 처리하여 코팅한 후, PBS에 녹인 탈지유 (4 %)를 사용하여 각 웰을 차단하였다. 각 웰 마다 PBS-tween20 (0.05%) 0.2 ㎖으로 씻어준 다음 패닝된 poly scFV-파지를 원액 및 5, 25, 125, 625, 3125배 희석한 용액을 각 웰에 100 ㎕씩 넣고 상온에서 2시간 동안 반응시켰다. 다시 각 웰마다 PBS-tween20 (0.05%) 0.2 ㎖을 사용하여 4번 세척한 후 이차 항체인 항-M13-HRP (Amersham 27-9421-01)를 1:2000으로 희석하여 실온에서 1시간 동안 반응하였다. PBS-tween20 (0.05%) 0.2 ㎖으로 세척한 후에 OPD 정제 (Sigmap 8787-TAB)를 PC 완충용액 [C6H8O7·H2O (sigma, C0706) 5.1 g, Na2HPO4 (sigma, S7907) 7.3 g]에 녹인 기질 용액을 만들어 웰당 100 ㎕씩 넣어 10분 동안 발색시킨 후 490 ㎚에서 흡광도를 분광광도계 (MolecularDevice, 미국)로 측정하였다.
그 결과, 도 1에 나타난 바와 같이, 항원에 대한 결합능이 각각 2차 다클론 scFv-파지 풀(pools)부터 증강하기 시작하여 3차에 결합능이 포화상태에 이르렀음을 확인할 수 있었다(도 1).
② 단일클론항체 선별
상기 결합능이 큰 다클론 파지 항체군에서 얻은 콜로니를 2×YTCM, 2% 글루코즈, 5 mM MgCl2 배지 1 ㎖이 포함된 96-deep 웰 플레이트 (바이오니아 90030)에서 37℃의 온도로 16시간 동안 배양하였다. 배양한 세포의 OD600 값이 0.1이 되도록 100~200 ㎕를 취해 1 ㎖의 2×YTCM, 2% 글루코즈, 5 mM MgCl2 배지에 희석한 다음, 96-deep 웰 플레이트에서 37℃의 온도로 OD600 값이 0.5~0.7 되도록 2 내지 3시간 동안 배양하였다. M1 헬퍼 파지를 MOI값이 1:20이 되도록 감염시킨 후, 2×YTCMK, 5 mM MgCl2, 1 mM IPTG 배지에서 30℃의 온도로 16시간 동안 배양하였다. 배양한 세포를 원심분리 (4500 rpm, 15 분, 4℃)한 후, 상등액을 취해 4% PEG 6000과 3% NaCl을 첨가하여 잘 녹인 후 얼음에서 1시간 동안 반응시켰다. 다시 원심분리 (8000 rpm, 20분, 4℃)한 후 펠렛에 PBS를 첨가하여 녹인 다음 원심분리 (12000 rpm, 10분, 4℃)하여 상등액을 취해 새 튜브에 옮겨 4℃에서 보관하였다. 이후, 96웰 면역 플레이트에 항원을 웰당 100 ng씩을 넣어 4℃에서 16시간 동안 코팅한 후 PBS에 녹인 탈지유 (4%)를 사용하여 각 웰을 차단하였다. 각 웰마다 PBS-tween20 (0.05%) 0.2 ㎖을 사용하여 세척한 다음 상기 방법으로 수득한 단일클론 scFv-파지 (each 100 scFv-phage)를 각 웰에 100 ㎕씩 넣고 상온에서 2시간 동안 반응시켰다. 다시 각 웰마다 PBS-tween20 (0.05%) 0.2 ㎖을 사용하여 4번 씻어준 후 2차 항체인 anti-M13-HRP를 1/2000로 희석하여 실온에서 1시간 동안 반응하였다. PBS-tween20 (0.05%) 0.2 ㎖로 세척한 후 발색하여 흡광도 490 ㎚에서 측정하였다. 그 결과, 하기 표 2에 나타난 바와 같이 항원에 대한 결합능이 2 이상인 27개의 단일파지클론들을 선별하였다.
[규칙 제91조에 의한 정정 11.03.2013]　
표 2
Figure WO-DOC-FIGURE-118
(3) 단일클론파지 분류 및 검사
① 핑거 프린팅에 의한 검증
1차 선별된 DLK1-Fc에 대한 27개 단일클론세포 1 ㎕와 Taq.DNA 폴리머라제 (젠닥스 5 U/㎕) 0.2 ㎕, 50 p/㎕의 정방향 프라이머 (서열번호 2 : 5'-CTAGATAACGAGGGCAAATCATG-3') 및 역방향 프라이머(서열번호 3 : 5'-CGTCACCAATGAAACCATC-3') 0.2 ㎕, 10X완충용액 3 ㎕, 10 mM dNTP mix 0.6 ㎕ 및 증류수 24.8 ㎕를 혼합하여 콜로니 PCR (iCycler iQ, BIO-RAD)을 수행하였다. PCR 프로그램의 조건은 하기 표 3에 나타내었다.
표 3
온도 시간 사이클(cycle)
95℃ 5 min
95℃ 30 sec 30 사이클
56℃ 30 sec
72℃ 1 min
72℃ 10 min
4℃
상기 콜로니 PCR 산물은 1% 아가로스 겔 (Seakem LE, CAMERES 50004)에서 확인하였고, BstNI (Roche11288075001, 10 U/㎕) 0.2 ㎕를 가하여 37℃에서 2 내지 3시간 동안 반응하였다. 반응 조건은 하기 표 4에 나타내었다. 상기 절단된 산물을 8% DNA 폴리아크릴 아미드 겔에서 확인하였다.
표 4
10X Buffer 3 ㎕
콜로니 PCR 산물 10 ㎕
BstNI (10 U/㎕) 0.2 ㎕
증류수 16.8 ㎕
그 결과, 도 2에 나타난 바와 같이, BstNI에 의해 잘려진 단일클론파지 항체들의 단편들에 대해 다양성이 확인되었고, 6종의 서로 다른 항체가 선별된 것을 유추하였다.
② 염기서열 분석에 의한 검증
수용성 DLK1에 대한 6 종류의 단일클론파지를 2×YTCM, 2% 글루코즈, 5 mM MgCl2 배지 (5 ㎖)에서 37℃의 온도로 16시간 동안 배양하였다. 배양한 단일클론으로부터 DNA 정제 키트 (Nuclogen 5112)를 이용하여 DNA를 수득한 후, 서열번호 2의 프라이머를 이용한 서열 분석을 의뢰하였다 (솔젠트, 한국). 그 결과, 표 5와 도 3에 나타난 바와 같이 선별된 항체의 VH와 VL의 CDR 영역을 확인하였으며, 각 항체의 중쇄(서열번호 35 ~ 서열번호 40) 및 경쇄(서열번호 41 ~ 서열번호 46) 서열을 서열목록으로 기재하였다.
[규칙 제91조에 의한 정정 11.03.2013]　
표 5
Figure WO-DOC-FIGURE-130
이들 항체와 생식세포 계열(germ line) 항체군의 유사성을 NCBI의 Ig BLAST 프로그램 (www.ncbi.nlm.nih.gov/igblast/)을 이용하여 조사한 결과 수용성 DLK1에 특이적인 파지 항체 6종을 얻었다. 이때, 중쇄의 경우 VH3-9와 VH3-23이 2종, VH3-11, VH1-3이 각각 1종씩 포함되어 있었다. 항체의 중쇄 및 경쇄의 CDR3에서 사용되고 있는 아미노산 서열을 분석하였으며, 서로 다른 서열을 갖는 것을 확인하였다 (도 3).
(4) 수용성 DLK1에 대한 인간항체의 특성 분석
① 전체 IgG 변환 분석
수용성 DLK1에 대한 단일클론파지 항체들을 파지에서 IgG 전체 벡터로 전환하기 위해 중쇄는 단일 클론 DNA 1 ㎕, 표 6의 중쇄 정방향 및 역방향 프라이머 10 pmole/㎕, 10X버퍼 5 ㎕, 10 mM dNTP mix 1 ㎕, pfu DNA 중합효소 (솔젠트, 2.5 U/㎕) 0.5 ㎕ 및 증류수를 혼합하여 콜로니 PCR (iCycler iQ, BIO-RAD)을 수행하였다. 경쇄도 표 6의 경쇄 정방향 및 역방향 프라이머를 사용하여 동일한 방법으로 콜로니 PCR을 수행하였다.
표 6
Figure PCTKR2013000033-appb-T000004
PCR에 의하여 수득한 중쇄 유전자를 DNA-겔 추출 키트 (Qiagen)로 정제한 후, pNATAB H 벡터(도 4) 1 ㎕ (10 ng), 중쇄 (100 ~ 200 ng) 15 ㎕, 10X버퍼 2 ㎕, 리가아제 (1 U/㎕) 1 ㎕ 및 증류수를 혼합하여 실온에서 1 내지 2시간 동안 방치하여 상기 벡터와 연결하였다. 상기 벡터를 형질전환용 세포 (XL1-blue)와 함께 얼음에 30분간 방치한 후, 42℃에서 90초간 열충격을 주어 형질도입하였다. 다시 얼음에 5분간 방치한 후, LB 배지 1 ㎖을 주입하고 1시간 동안 37℃에서 배양하였다. 이후, LB Amp 고체배지에 도말한 후, 37℃에서 16시간 동안 배양하였다. 단일 콜로니를 LB Amp 액체배지 5 ㎖에 접종하고 37℃에서 16시간 동안 배양하였다. 상기 배양액으로부터 DNA-prep. 키트 (Nuclogen)를 이용하여 DNA를 추출하였다. 또한, 경쇄는 pNATAB L 벡터(도 5)를 사용하여 상기와 같은 방법으로 DNA를 추출하였다.
상기 수득한 DNA에 대하여 CMV-proF 프라이머(서열번호 4 : AAA TGG GCG GTA GGC GTG)를 이용한 염기서열 분석을 의뢰하였다 (솔젠트). 그 결과, 전체 IgG로 전환한 DLK1-Fc에 대한 6개의 클론파지의 중쇄와 경쇄의 서열이 파지 항체의 서열과 일치됨을 확인하였다.
3-2. DLK1의 수용성 부분에 특이적으로 결합하는 인간 항체의 검증
상기 실시예 3-1에서 제작한 DLK1의 수용성 부분에 특이적으로 결합하는 인간 항체의 결합력을 확인하기 위하여, 6종의 인간 항체 중 대표적으로 B09 항체를 사용하여 DLK1을 발현하고 있는 293E 세포를 이용하여 유세포 분석기 이동 분석을 수행하여, 도 6에 나타내었다. 이때, R&D에서 구매한 DLK1 단클론 항체와 ACVR2B 항체의 결합력을 측정하였다.
그 결과, 도 6에 나타난 바와 같이, B09 항체가 DLK1의 수용성 부분에 특이적으로 결합하고 있음을 확인할 수 있었다. 또한, R&D에서 구매한 DLK1 단클론 항체와 ACVR2B 항체 역시 각각 DLK1 및 ACVR2B에 결합하고 있음을 확인할 수 있었다.
실시예 4. ACVR2의 수용성 부분에 특이적으로 결합하는 인간 항체(F08)의 제작 및 검증
4-1. ACVR2B의 수용성 부분에 특이적으로 결합하는 인간 항체의 제작
<4-1-1> 라이브러리 파지의 제조
다양성을 가진 인간 유래 scFv 라이브러리 세포 2.7×1010를 2×YTCM [Tryptone (CONDA, 1612.00) 17 g, Yeast extract (CONDA, 1702.00) 10 g, NaCl (sigma, S7653-5 ㎏) 5 g, chloramphenicol (sigma, C0857) 34 ㎍/㎖)], 2% 글루코즈 (sigma, G5400) 및 5 mM MgCl2(sigma, M2393)를 포함하는 배지 (3 ℓ)에서 37℃의 온도로 2 내지 3시간 동안 배양한 후 (OD600=0.5~0.7), 헬퍼 파지 (helper phage)를 감염시켜 2×YTCMK [2×YT CM, Kanamycin (sigma, K1876) 70 ㎍/㎖, 1 mM IPTG (ELPISBIO, IPTG025)] 배지에서 30℃의 온도로 16시간 동안 배양하였다. 배양한 세포를 원심분리 (4500 rpm, 15분, 4℃)한 후, 상등액에 4% PEG (Fluka, 81253) 6000과 3% NaCl (sigma, S7653)을 첨가하여 잘 녹인 다음 얼음에서 1시간 동안 반응하였다. 다시 원심분리 (8000 rpm, 20분, 4℃)한 후, 펠렛에 PBS를 첨가하여 녹인 다음 원심분리 (12000 rpm, 10분, 4℃)하여 라이브러리 파지를 포함하는 상등액을 새 튜브에 넣어 4℃에서 보관하였다.
<4-1-2> 단일클론항체의 제조
(1) 패닝(Panning) 과정
상기 실시예 2에서 제조된 ACVR2B-Fc 30 ㎍을 Immunosorb 튜브 (Nunc 470319)에 4 ㎖의 코팅 완충용액 [coating buffer; Na2CO3 (sigma, S7795) 1.59 g, NaHCO3 (sigma, S8875) 2.93 g, NaN3(sigma, S2002), 0.2 g]으로 4℃에서 16시간 정도 회전기(rotator)로 코팅한 후, 실온에서 2시간 동안 PBS에 녹여 탈지유 [(BD,232100)-4% in 1XPBS]를 사용하여 면역튜브(immunotube)에서 차단하였다. 제조한 라이브러리 파지 2 ㎖을 면역튜브에 첨가하여 실온에서 2시간 동안 반응시키고, PBST (0.05%)로 5회, PBS로 2회 세척하였다. 세척 후 특이적으로 결합한 scFv-파지들만 100 mM TEA (Sigma T-0886)로 용리하여, 용출된 파지들을 대장균 (XL1-Blue, stratagene, 200249)에 감염시켜 증폭하였다. 첫 번째 패닝에서 증폭된 파지를 PBST 세척 횟수만 늘려서 (2차: 13번, 3차: 23번) 동일한 방법으로 2차, 3차 패닝을 수행하였다.
그 결과, 패닝을 통한 항체의 역가 상승은 표 7에 나타난 바와 같았다.
표 7
Figure PCTKR2013000033-appb-T000005
(2) 파지 효소 면역 측정법(ELISA)에 의한 파지 항체 탐색
① 패닝 결과 확인
1차부터 3차까지 패닝하여 얼려두었던 세포 저장물(stock)을 5 ㎖의 2×YTCM, 2% 글루코즈, 5 mM MgCl2배지에 OD600=0.1이 되게 넣어준 다음, 37℃에서 2 내지 3시간 동안 (OD600=0.5~0.7) 배양하였다. 이후, M1 헬퍼 파지를 감염시키고 2×YTCMK, 5 mM MgCl2, 1 mM IPTG 배지에서 30℃의 온도로 16시간 동안 배양하였다. 배양한 세포를 원심분리한 후 (4500 rpm, 15 분, 4℃) 상등액 (패닝된 poly scFv-파지)을 새 튜브로 옮겼다. 96-웰 면역 플레이트 (NUNC 439454)에 항원을 웰 당 100 ng씩 4℃에서 16시간 정도 코팅 완충용액으로 처리하여 코팅한 후, PBS에 녹인 탈지유 (4%)를 사용하여 각 웰을 차단하였다. 각 웰 마다 PBS-tween20 (0.05%) 0.2 ㎖으로 씻어준 다음 패닝된 poly scFV-파지를 원액 및 5, 25, 125, 625, 3125배 희석한 용액을 각 웰에 100 ㎕씩 넣고 상온에서 2시간 동안 반응시켰다. 다시 각 웰마다 PBS-tween20 (0.05%) 0.2 ㎖을 사용하여 4번 세척한 후 이차 항체인 항-M13-HRP (Amersham 27-9421-01)를 1:2000으로 희석하여 실온에서 1시간 동안 반응하였다. PBS-tween20 (0.05%) 0.2 ㎖으로 세척한 후에 OPD 정제 (Sigmap 8787-TAB)를 PC 완충용액 [C6H8O7ㅇH2O (sigma,C0706) 5.1 g, Na2HPO4 (sigma, S7907) 7.3 g]에 녹인 기질 용액을 만들어 웰당 100 ㎕씩 넣어 10분 동안 발색시킨 후 490 ㎚에서 흡광도를 분광광도계 (MolecularDevice, 미국)로 측정하였다.
② 단일클론항체 선별
상기 결합능이 큰 다클론 파지 항체군에서 얻은 콜로니를 2×YTCM, 2% 글루코즈, 5 mM MgCl2 배지 1 ㎖이 포함된 96-deep 웰 플레이트 (바이오니아 90030)에서 37℃의 온도로 16시간 동안 배양하였다. 배양한 세포의 OD600 값이 0.1이 되도록 100~200 ㎕를 취해 1 ㎖의 2×YTCM, 2% 글루코즈, 5 mM MgCl2배지에 희석한 다음, 96-deep 웰 플레이트에서 37℃의 온도로 OD600 값이 0.5~0.7 되도록 2 내지 3시간 동안 배양하였다. M1 헬퍼 파지를 MOI값이 1:20이 되도록 감염시킨 후, 2×YTCMK, 5 mM MgCl2, 1 mM IPTG 배지에서 30℃의 온도로 16시간 동안 배양하였다. 배양한 세포를 원심분리 (4500 rpm, 15 분, 4℃)한 후, 상등액을 취해 4% PEG 6000과 3% NaCl을 첨가하여 잘 녹인 후 얼음에서 1시간 동안 반응시켰다. 다시 원심분리 (8000 rpm, 20분, 4℃)한 후 펠렛에 PBS를 첨가하여 녹인 다음 원심분리 (12000 rpm, 10분, 4℃)하여 상등액을 취해 새 튜브에 옮겨 4℃에서 보관하였다. 이후, 96웰 면역 플레이트에 항원을 웰당 100 ng씩을 넣어 4℃에서 16시간 동안 코팅한 후 PBS에 녹인 탈지유 (4%)를 사용하여 각 웰을 차단하였다. 각 웰마다 PBS-tween20 (0.05%) 0.2 ㎖을 사용하여 세척한 다음 상기 방법으로 수득한 단일클론 scFv-파지 (each 100 scFv-phage)를 각 웰에 100 ㎕씩 넣고 상온에서 2시간 동안 반응시켰다. 다시 각 웰마다 PBS-tween20 (0.05%) 0.2 ㎖을 사용하여 4번 씻어준 후 2차 항체인 anti-M13-HRP를 1/2000로 희석하여 실온에서 1시간 동안 반응하였다. PBS-tween20 (0.05%) 0.2 ㎖로 세척한 후 발색하여 흡광도 490 ㎚에서 측정하였다. 그 결과, 하기 표 8에 나타난 바와 같이 항원에 대한 결합능이 2 이상인 36개의 단일파지클론들을 선별하였다.
[규칙 제91조에 의한 정정 11.03.2013]　
표 8
Figure WO-DOC-FIGURE-162
(3) 단일클론파지 분류 및 검사
① 핑거 프린팅에 의한 검증
1차 선별된 ACVR2B-Fc에 대한 36개 단일클론세포 1 ㎕와 Taq.DNA 폴리머라제 (젠닥스 5 U/㎕) 0.2 ㎕, 50 p/㎕의 정방향 프라이머 (서열번호 2 : 5'-CTAGATAACGAGGGCAAATCATG-3') 및 역방향 프라이머(서열번호 3 : 5'-CGTCACCAATGAAACCATC-3') 0.2 ㎕, 10X완충용액 3 ㎕, 10 mM dNTP mix 0.6 ㎕ 및 증류수 24.8 ㎕를 혼합하여 콜로니 PCR (iCycler iQ, BIO-RAD)을 수행하였다. PCR 프로그램의 조건은 하기 표 9에 나타내었다.
표 9
온도 시간 사이클(cycle)
95℃ 5 min
95℃ 30 sec 30 사이클
56℃ 30 sec
72℃ 1 min
72℃ 10 min
4℃
상기 콜로니 PCR 산물은 1% 아가로스 겔 (Seakem LE, CAMERES 50004)에서 확인하였고, BstNI (Roche 11288075001, 10 U/㎕) 0.2 ㎕를 가하여 37℃에서 2 내지 3시간 동안 반응하였다. 반응 조건은 하기 표 10에 나타내었다. 상기 절단된 산물을 8% DNA 폴리아크릴 아미드 겔에서 확인하였다.
표 10
10X Buffer 3 ㎕
콜로니 PCR 산물 10 ㎕
BstNI (10 U/㎕) 0.2 ㎕
증류수 16.8 ㎕
그 결과, 도 7에 나타난 바와 같이, BstNI에 의해 잘려진 단일클론파지 항체들의 단편들에 대해 다양성이 확인되었고, 13종의 서로 다른 항체가 선별된 것을 유추하였다.
② 염기서열 분석에 의한 검증
수용성 ACVR2B에 대한 13종류의 단일클론파지를 2×YTCM, 2% 글루코즈, 5 mM MgCl2 배지 (5 ㎖)에서 37℃의 온도로 16시간 동안 배양하였다. 배양한 단일클론으로부터 DNA 정제 키트 (Nuclogen 5112)를 이용하여 DNA를 수득한 후, 서열 분석을 의뢰하였다 (솔젠트, 한국). 그 결과, 아래 표 11에 나타난 바와 같이 선별된 항체의 VH와 VL의 CDR 영역을 확인하였으며, 각 항체의 중쇄(서열번호 47 ~ 서열번호 57) 및 경쇄(서열번호 58 ~ 서열번호 68) 서열을 서열목록으로 기재하였다.
[규칙 제91조에 의한 정정 11.03.2013]　
표 11
Figure WO-DOC-FIGURE-175
이들 항체와 생식세포 계열(germ line) 항체군의 유사성을 NCBI의 Ig BLAST 프로그램 (www.ncbi.nlm.nih.gov/igblast/)을 이용하여 조사한 결과 수용성 ACVR2B에 특이적인 파지 항체 11종을 얻었다. 이때, 중쇄의 경우 VH3-9가 2종, VH3-49가 3종, VH3-7, VH5-51, VH3-11, VH3-64, VH1-46, VH3-72가 각각 1종씩 포함되어 있었다. 항체의 중쇄 및 경쇄의 CDR3에서 사용되고 있는 아미노산 서열을 분석하였으며, 서로 다른 서열을 갖는 것을 확인하였다 (도 8 및 도 9).
(4) 수용성 ACVR2B에 대한 인간항체의 특성 분석
① 전체 IgG 변환 분석
수용성 ACVR2B에 대한 단일클론파지 항체들을 파지에서 IgG 전체 벡터로 전환하기 위해 중쇄는 단일 클론 DNA 1 ㎕, 아래 표의 중쇄 정방향 및 역방향 프라이머 10 pmole/㎕, 10X버퍼 5 ㎕, 10 mM dNTP mix 1 ㎕, pfu DNA 중합효소 (솔젠트, 2.5 U/㎕) 0.5 ㎕ 및 증류수를 혼합하여 콜로니 PCR (iCycler iQ, BIO-RAD)을 수행하였다. 경쇄도 아래 표 12의 경쇄 정방향 및 역방향 프라이머를 사용하여 동일한 방법으로 콜로니 PCR을 수행하였다.
표 12
Figure PCTKR2013000033-appb-T000008
PCR에 의하여 수득한 중쇄 유전자를 DNA-겔 추출 키트 (Qiagen)로 정제한 후, pNATAB H 벡터(도 4) 1 ㎕ (10 ng), 중쇄 (100~200 ng) 15 ㎕, 10X버퍼 2 ㎕, 리가아제 (1 U/㎕) 1 ㎕ 및 증류수를 혼합하여 실온에서 1 내지 2시간 동안 방치하여 상기 벡터와 연결하였다. 상기 벡터를 형질전환용 세포 (XL1-blue)와 함께 얼음에 30분간 방치한 후, 42℃에서 90초간 열충격을 주어 형질도입하였다. 다시 얼음에 5분간 방치한 후, LB 배지 1 ㎖을 주입하고 1시간 동안 37℃에서 배양하였다. 이후, LB Amp 고체배지에 도말한 후, 37℃에서 16시간 동안 배양하였다. 단일 콜로니를 LB Amp 액체배지 5 ㎖에 접종하고 37℃에서 16시간 동안 배양하였다. 상기 배양액으로부터 DNA-prep. 키트 (Nuclogen)를 이용하여 DNA를 추출하였다. 또한, 경쇄는 pNATAB L 벡터(도 5)를 사용하여 상기와 같은 방법으로 DNA를 추출하였다.
상기 수득한 DNA에 대하여 CMV-proF 프라이머(서열번호 4 : AAA TGG GCG GTA GGC GTG)를 이용한 염기서열 분석을 의뢰하였다 (솔젠트). 그 결과, 전체 IgG로 전환한 ACVR2B-Fc에 대한 11개의 클론파지의 중쇄와 경쇄의 서열이 파지 항체의 서열과 일치됨을 확인하였다 (도 8, 도 9).
실시예 5. DLK1의 근아세포 C2C12 분화 효과 확인
인간 혈액 내에 체계적으로 순환하면서 발생, 분화 단계에서 지질생성(adipogenesis)의 억제에 관계하는 것으로 알려진 DLK1 단백질의 세포 외 도메인을 상기 실시예 1과 같이 Fc 융합 단백질 형태로 발현, 정제시킨 후, 근아세포에 처리함으로써 수용성 DLK1이 근아세포 분화에 미치는 영향을 알아보고자 하였다.
구체적으로, 근아세포(myoblast) C2C12가 90% 정도 수준일 때, 분화 배지(differentiation media, DM)로 2% horse serum(HS)을 교환해 주고, 6개의 실험군으로 나눈 후, ACVR2B-Fc (0.5 μM), DLK1-Fc (0.5 μM) 및/또는 미오스타틴(myostatin) (8 μg/ml)을 각각의 실험군에 다음과 같이 처리하고, 72시간 동안 현미경으로 분화 진행을 관찰하였다. 본 실시예에서 미오스타틴은 R&D Systems에서 구매하여 사용하였다.
1) DM
2) DM + ACVR2B-Fc (0.5 μM)
3) DM + DLK1-Fc (0.5 μM)
4) DM + myostatin (8 μg/ml)
5) DM + myostatin (8 μg/ml) + ACVR2B-Fc (0.5 μM)
6) DM + myostatin (8 μg/ml) + DLK1-Fc (0.5 μM)
그 결과, 도 10에 나타난 바와 같이 근아세포 C2C12 세포주에 미오스타틴 8 μg/ml을 처리하면 근육분화가 억제되는데, 이에 ACVR2B-Fc 또는 DLK1-Fc를 처리하면 미오스타틴의 근육분화 저해 효과를 막음으로써 근육세포 분화가 잘 일어나는 것을 알 수 있었다.
실시예 6. DLK1과 ACVR2B의 결합 확인
DLK1과 미오스타틴(myostatin)의 수용체인 ACVR2B의 결합 여부를 확인하기 위하여, 면역침강분석을 실시하였다. 이를 위하여, 근아세포인 C2C12 세포주를 수확한 후, RIPA buffer (50 mM TrisHCl pH7.4, 150 mM NaCl, 2 mM EDTA, 및 1% NP-40)를 이용하여 세포 용해물(cell lysate)을 만들고, 정상 염소 혈청(normal goat serum; Vector Lab. Inc.)과 단백질 A 수지(protein A resin; GE, Sweden)를 이용하여 4℃에서 3시간 동안 전세척(preclearing)을 실시하였다. 다음으로, 단백질 A 수지(protein A resin)만 첨가하여 4℃에서 3시간 동안 반응시켜 남아 있는 항체를 제거한 후, 상기 실시예 3에서 제조한 인간 ACVR2B 항체 F08과 상기 실시예 4에서 제조한 DLK1 항체 B09을 이용하여 4℃에서 하룻밤 동안(O/N) 면역침강을 실시하였다.
본 실시예에 사용된 상기 인간항체 F08은 ACVR2B에 Kd=4.05 pM로 매우 높은 결합능을 가지는 항체이며, 인간항체 B09는 DLK1의 첫 번째와 두 번째 EGF-유사 반복서열(EGF-like repeat)에 결합하여 ACVR2B와 DLK1의 결합을 비약적으로 상승시키는 항체이다.
면역침강 된 펠릿을 RIPA buffer로 3번 씻어 주고, 80 μl의 RIPA buffer를 첨가하여 현탁(resuspension) 시킨 후, 20 μl의 5X 샘플 버퍼(sample buffer)를 넣고 95℃에서 5분 간 반응 시켰다. 그 다음, 원심분리를 통하여 상층액만 취하여 웨스턴 블랏 실험을 실시하였다. 25 μl의 샘플을 각각 로딩(loading)하고, 면역침강에 사용된 세포 용해물의 5%를 로딩하여 대조군으로 사용하였다. 다음으로, 이를 니트로셀룰로오스 막(NC membrane, Bio-Rad)에 이동시킨(transfer) 후 5% 탈지유(skim milk)/TBST tween20 0.05%에 30분 동안 블로킹(blocking)을 실시하고, DLK1 (R&D mAb1144), ACVR2B (R&D AF339), Myostatin (Millipore), α-tubulin (Santa Cruz) 항체를 이용하여 4℃에서 하룻밤 동안(O/N) 반응시켜 주었다. 이때, α-tubulin은 음성대조군으로 사용하였다. 그 후, TBST tween20 0.05%에서 10분간 3번 세척한 후, 각각에 맞는 2차 항체-HRP (secondary antibody-HRP; mouse, goat, rabbit-IgG-HRP)를 1 : 1000으로 1시간 동안 반응 시키고, 다시 한 번 TBST tween20 0.05%로 10분간 3번 세척하였다. 발색은 ECL solution (Intron)을 이용하여 1분간 필름 (Agfa)에 노출하여 분석하였으며, 그 결과를 도 11에 나타내었다.
도 11에 나타난 바와 같이, 면역침강 된 펠릿을 이용하여 웨스턴 블랏 실험을 실시한 결과, ACV2B에 의해 침강된 샘플에서 DLK1과 미오스타틴이 결합하는 것을 알 수 있으며, DLK1에 의해 침강된 샘플에서 ACVR2B와 미오스타틴이 결합하여 밴드가 나타나는 것을 알 수 있었다. 따라서, 지금까지 세포 내 수용체가 밝혀져 있지 않은 DLK1의 새로운 수용체로서 미오스타틴의 수용체인 ACVR2B가 가능함을 알 수 있었다.
실시예 7. Myostatin과 DLK1의 결합능 분석을 위한 ELISA 실험
1 μg/ml의 C-말단 활성 미오스타틴 (R&D systems)을 면역플레이트에 4℃로 하룻밤 동안(O/N) 코팅하고, PBST tween 0.05%로 3번 세척한 후, 4% 탈지유(skim milk) PBST tween 0.05%로 상온에서 30분간 블로킹(blocking)을 실시하였다. 다음으로, PBST tween 0.05%로 세척한 후, 각각의 웰에 결합시키고자 하는 DLK1-Fc 단백질을 1 μM 농도부터 단계 희석하여, 상온에서 2시간 동안 반응시켜 주었다. 다음으로, PBST tween 0.05%로 3번 세척한 후 1 : 500의 Fc-HRP (Pierce)를 상온에서 1시간 동안 반응 시킨 후, PBST tween 0.05%로 3번 세척한 후 TMB (Sigma)로 암조건에서 10분간 반응 시켰다. 마지막으로, 2.5 M H2SO4로 반응을 종결 시킨 후, 420 nm에서 흡광도를 측정하여 분석하였으며, 그 결과를 도 12에 나타내었다.
도 12에서 알 수 있는바와 같이, DLK1-Fc의 농도에 따라 미오스타틴의 결합이 증가하는 것을 알 수 있었으며, 음성 대조군으로 사용된 Fc의 경우 미오스타틴과 결합하지 않는 것으로 보아, 미오스타틴이 Fc와 관계 없이 DLK1에 특이적으로 결합한다는 것을 알 수 있었다.
실시예 8. Myostatin과 ACVR2B, DLK1의 결합능 비교 실험
상기 실시예 7에서와 같은 방법으로, 1 μg/ml의 C-말단 활성 미오스타틴 (R&D systems)을 면역플레이트에 4℃로 하룻밤 동안(O/N) 코팅하고, ACVR2B-Fc와 DLK1-Fc를 100 nM 농도에서부터 단계 희석하여, 상온에서 2시간 동안 반응시킴으로써 결합력을 분석하였으며, 그 결과를 도 13에 나타내었다. 도 13에서 알 수 있듯이, 미오스타틴에 대해 DLK1이 ACVR2B보다 더 높은 결합력을 보인다는 것을 알 수 있었다.
또한, 상기 실험을 바탕으로 GraphPad Reism 4 프로그램을 이용하여 one site binding (hyperbola) 분석을 함으로써 KD 값을 결정하였으며, 그 결과를 도 14에 나타내었다. 도 14에서 알 수 있듯이, 미오스타틴에 대한 KD 값은 ACVR2B의 경우 256.2 nM±4.897이었으며, DLK1의 경우 22.77 nM±3.665를 나타내어, 미오스타틴에 대한 DLK1의 결합력이 ACVR2B보다 약 11배 이상 높은 것을 알 수 있었다.
상기 결과로부터, 종래 미오스타틴과 ACVR2B의 결합으로 근육형성 억제를 일으키는 기작에 대한 저해제로서, 수용성 ACVR2B-Fc 보다 DLK1의 효과가 더 뛰어나다는 것을 기대할 수 있었다.
실시예 9. 경쟁 ELISA 분석
수용성 DLK1이 미오스타틴(myostatin)과 경쟁적으로 ACVR2B 수용체에 결합하는지 알아보기 위하여 경쟁 효소 면역 측정법을 수행하였다. 1 μg/ml의 C-말단 활성 미오스타틴 (R&D systems)을 면역플레이트에 4℃로 하룻밤 동안(O/N) 코팅하고, ACVR2B-Fc와 FLAG-DLK1을 같이 반응시켜 주어 측정하였다. 이때, ACVR2B는 1 nM 농도로 고정하고 FLAG-DLK1을 1 nM에서 1 μM 까지의 농도로 처리하여 준 후 경쟁 결합 정도를 측정하였다.
대조군으로는 미오스타틴과 결합하지 않는 ACVR1A-Fc를 사용하였으며, 1 μM의 FLAG-DLK1만 결합시킨 대조군은 2차 항체를 Fc-HRP를 사용하였기 때문에 결합하여도 신호를 측정 할 수 없게 하여 순수하게 미오스타틴이 ACVR2B에 결합이 DLK1에 의해 억제 되는 것만 확인하기 위해 사용한 대조군이다.
경쟁 표소 면역 측정 결과를 도 15에 나타내었으며, 도 15에서 알 수 있는 바와 같이, 미오스타틴이 ACVR2B-Fc에 잘 결합하였다. 이때 FLAG이 태그된 DLK1을 농도를 높이면서 같이 반응시켜 주면 미오스타틴이 ACVR2B에 결합하는 것을 막을 수 있다는 것을 알 수 있다.
실시예 10. DLK1-Fc Deletion mutant 제작
DLK1과 ACVR2B의 결합 부위를 알아보기 위하여, DLK1의 상피세포 성장인자-유사 반복서열 결실 돌연변이(EGF-like repeat deletion mutant)를 제작하였다. 구체적으로, pYK602-DLK1-Fc 구조(construct) (도 16)를 주형(template)으로 이용하여 상피세포-유사 반복 서열(EGF-like repeat) 도메인을 순차적으로 제거함으로써 각각의 결실 돌연변이(deletion mutant)를 제작하였으며, 제작된 결실 돌연변이의 구조는 도 17에, 아미노산 서열은 서열번호 28 내지 서열번호 34 (표 14)에 나타내었다. 본 실시예에서 결실 돌연변이 제작을 위한 PCR에 사용한 프라이머(primer) 세트는 하기 표 13과 같다.
표 13
서열이름 DNA 서열(sequence) 서열번호
Reverse primer D-R gctagcggccgacgcggccaagccctcggtgaggagagg 서열번호 22
forward primer 3M-Fc aaaaaaggccgtgggggccgatgttcgggcctgctcctc 서열번호 23
forward primer 4M-Fc aaaaaaggccgtgggggccaaggacgggccctgtgtgatc 서열번호 24
forward primer 5M-Fc aaaaaaggccgtgggggccgtggccaacagctgcacccc 서열번호 25
forward primer 6M-Fc aaaaaaggccgtgggggccccggtgaccaactgcgccag 서열번호 26
forward primer JM-Fc aaaaaaggccgtgggggccaagaagcgcgcgctgagccc 서열번호 27
표 14
서열이름 DNA/아미노산 서열(sequence) 서열번호
수용성 DLK1 유전자 서열 atgaccgcgaccgaagccctcctgcgcgtcctcttgctcctgctggctttcggccacagcacctatggggctgaatgcttcccggcctgcaacccccaaaatggattctgcgaggatgacaatgtttgcaggtgccagcctggctggcagggtcccctttgtgaccagtgcgtgacctctcccggctgccttcacggactctgtggagaacccgggcagtgcatttgcaccgacggctgggacggggagctctgtgatagagatgttcgggcctgctcctcggccccctgtgccaacaacgggacctgcgtgagcctggacgatggcctctatgaatgctcctgtgcccccgggtactcgggaaaggactgccagaaaaaggacgggccctgtgtgatcaacggctccccctgccagcacggaggcacctgcgtggatgatgagggccgggcctcccatgcctcctgcctgtgcccccctggcttctcaggcaatttctgcgagatcgtggccaacagctgcacccccaacccatgcgagaacgacggcgtctgcactgacattgggggcgacttccgctgccggtgcccagccggcttcatcgacaagacctgcagccgcccggtgaccaactgcgccagcagcccgtgccagaacgggggcacctgcctgcagcacacccaggtgagctacgagtgtctgtgcaagcccgagttcacaggtctcacctgtgtcaagaagcgcgcgctgagcccccagcaggtcacccgtctgcccagcggctatgggctggcctaccgcctgacccctggggtgcacgagctgccggtgcagcagccggagcaccgcatcctgaaggtgtccatgaaagagctcaacaagaaaacccctctcctcaccgagggc 서열번호 28
수용성 DLK1 아미노산 서열 MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEG 서열번호 29
EGF3-6 아미노산 서열 DVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEG 서열번호 30
EGF4-6 아미노산 서열 KDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEG 서열번호 31
EGF5-6 아미노산 서열 VANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEG 서열번호 32
EGF6 아미노산 서열 PVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEG 서열번호 33
Juxtamembrane region (JM)아미노산 서열 KKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEG 서열번호 34
PCR 반응 혼합물(mixture)은 10X buffer 10 μl, dNTP mix 10 μl, pfu (Stratagene) 1 unit, Forward primer 5 μl, Reverse primer 5 μl, 주형(template) pYK602-DLK1-Fc, 멸균된 3차 증류수 68 μl를 이용하여 만들었으며, PCR 조건은 94℃에서 30초 간 변성(denature) 시킨 후, 94℃에서 30초, 68℃에서 1분 간 30 사이클(cycle)을 수행하고, 72℃에서 5분 간 추가 반응을 시켜 반응을 종결하였다. PCR 산물(product)은 PCR clean up kit (Qiagen)를 이용하여 세척한 후, 50℃에서 2시간 동안 SfiI (NEB) 제한효소로 처리하여 절단 하였다. 절단된 DNA 단편은 gel elution kit (Qiagen)를 이용하여 순수 정제하였다. 준비된 인서트(insert)와 벡터(vector)를 이용하여 라이게이션(ligation) 반응을 수행하였으며, 라이게이션 반응의 조성물은 10X ligase buffer 1 μl, pYK602-Fc vector/SfiI 1 μl, insert PCR product/SfiI 3 μl, ligase 1 μl (Roche), 멸균된 3차 증류수 4 μl로 이루어져 있다. 라이게이션 조성물은 4℃에서 하룻밤 동안(O/N) 반응시켜 결합시키고, DH5α 컴피턴트 세포(competent cell)에 형질전환(transformation) 하였다. 다음으로, 형질전환 시킨 세포를 LB/암피실린(ampicillin) 플레이트에 도말(spreading)하고, 37℃ 배양기(incubator)에 두었다. 다음날 생성된 콜로니를 5 ml의 LB/암피실린(ampicillin) 배지에 채집하여, 18시간 동안 배양하고, plasmid mini-prep. kit (NucleoGen)를 이용하여 플라스미드를 분리한 후, 분리된 플라스미드를 염기서열분석(sequencing) 하였다.
실시예 11. DLK1-Fc 및 결실 돌연변이체의 발현
클로닝된 DLK1-Fc 및 결실 돌연변이체(deletion mutant)를 발현시키기 위하여, 293E 세포를 사용하였다. 구체적으로, 100 mm 플레이트의 70% 정도 세포 수준에서 DNA 10 μg, PEI (#23966, Polysciences, USA) 20 μg을 혼합하여 상온에서 20분 간 반응시켜 혼합체를 만든 후 세포에 처리해 주었다. 16 ~ 10시간 후에 혈청이 없는 DMEM 배지로 갈아 준 후, 이틀에 한번 씩 배지를 회수하고 새로운 배지로 갈아 주었다. 원심분리를 통하여 배지에 남아 있을지 모를 세포들을 확실히 제거한 후, 0.22 μm 필터(#PR02890 Millipore, USA)를 이용하여 걸렀다. 이후 프로테인 A 컬럼을 이용하여 정제를 수행하였다. 이는 10 ml의 컬럼에 500 μl의 프로테인 A 비드 (#17-1279-03 GE, Sweden)를 충진하고 PBS로 세척한 후, DLK1-Fc가 발현된 배지를 흘려주었다. 이 과정은 페리-스타트 펌프를 사용하였으며, 1분에 0.5 ml씩 흘러들어 가게 세팅하였다. 배지가 모두 컬럼을 통과 한 후, PBS로 세척하고, 0.1 M glycine-HCl pH3.5 (#G7126, Sigma, USA)로 정제된 DLK1-Fc 단백질을 회수하였다. 회수된 단백질은 1M Tris pH 9.0 (#T-1503, Sigma, USA)을 이용하여 pH를 중화시킨 후, PBS를 이용하여 투석을 실시하였다. 정제된 단백질은 BCA 분석을 통하여 정량을 수행하였고, SDS-PAGE를 수행하여 정제 여부를 확인하였으며(도 18), 이를 통하여 정제된 DLK1-Fc 및 DLK1 결실 돌연변이체(deletion mutant) 단백질을 얻었다.
실시예 12. SPR (Surface Plasmon Resonance Spectroscopy) 분석
상기 실시예 11에서 제조 및 정제된 DLK1-Fc 및 DLK1 결실 돌연변이체(deletion mutant) 단백질의 ACVR2B에 대한 결합 부위를 확인하기 위하여 SPR 분석을 실시하였으며, 실험은 ProteOn XPR36 instrument (Bio-Rad)를 이용하여 수행하였다. 먼저 sensor chip (GLC)을 0.1 M EDC 및 0.025 M sulfo-NHS (Bio-Rad)를 60초간 반응시켜 활성화시켰다. ACVR2B-Fc를 10 mM 아세트산나트륨(sodium acetate) (pH 5.0)에 섞어 칩에 30 μl/min 속도로 240초 간 흘려줌으로써 코팅하였다. 비교예(reference)로 사용하기 위하여 하나의 채널은 Fc를 10 mM 아세트산나트륨 (pH 4.5)에 섞어 같은 방법으로 코팅하여 주었다. 코팅된 칩은 1 M 에탄올아민-염산(ethanolamine-HCl) (pH 8.5)를 200초 간 흘려주어 코팅 작업을 종결지었다. 결합 단백질을 테스트하기 위하여, 칩을 90도 회전시켜 준 후, DPBST (PBS with 0.005% Tween 20)로 30분 간 흘려주어 안정화 시켰다. 그리고 반응시키고자 하는 DLK1-Fc 또는 각각의 정제된 결실 돌연변이체 단백질을 30 μl/min의 속도로 120초 간 흘려주어 결합상수(association constant)를 결정하고 240초 간 DPBST (PBS with 0.005% Tween 20)를 흘려주어 해리상수(dissociation constant)를 결정하였다.
그 결과를 하기 표 15 및 도 19에 나타내었으며, 각각의 시료와 ACVR2B의 결합능을 측정한 결과, EGF5-6-Fc부터 결합이 되는 것으로부터, DLK1의 다섯 번째 EGF-유사 반복 서열 부위에 결합 (Kd=1.3 nM)하고, 첫 번째와 두 번째 반복 서열 부위를 결실시켰을 때 DLK1과 ACVR2B의 결합능이 상승하는 것을 알 수 있었다.
표 15
Figure PCTKR2013000033-appb-T000009
실시예 13. DLK1 결실 돌연변이를 이용한 결합 부위 측정 실험
DLK1 결실 돌연변이를 이용하여 DLK1과 미오스타틴의 결합부위를 결정하였다. 1 μg/ml의 C-말단 활성 미오스타틴 (R&D systems)을 면역플레이트에 4℃로 하룻밤 동안(O/N) 코팅하고, 10 nM의 각각의 DLK1-Fc 또는 DLK1 결실 돌연변이를 상온에서 2시간 동안 결합시켰다. 미오스타틴에 결합하지 않는 Fc와 ACVR2A-Fc는 음성 대조군으로 사용하였다. PBST로 3번 씻어 준 후 anti-human Fc HRP (1:1000, Pierce)를 상온에서 1시간 동안 반응 시켰으며 TMB solution (Sigma)를 이용하여 발색시키고 2.5M H2SO4용액을 이용하여 반응을 종결 시킨 후 흡광도 450에서 미오스타틴과 DLK1-Fc 및 DLK1 결실 돌연변이의 결합력을 측정하였으며, 그 결과를 도 20에 나타내었다.
도 20에 나타난 바와 같이, DLK1의 JM 부위부터 미오스타틴과 결합하는 것을 알 수 있으며, DLK1의 EGF-유사 반복서열 첫 번째와 두 번째 도메인은 오히려 미오스타틴과의 결합을 저해하는 것을 알 수 있었다.
실시예 14. DLK1이 Smad 시그널링에 미치는 효과 확인
미오스타틴은 ACVR2B에 결합하여 Smad 시그널링을 활성화시킴으로써 pSmad2/3의 발현 수준을 올리고 MyoD 발현 수준을 감소시켜 근육분화를 억제하는 기작이 잘 알려져 있다. 이에 미오스타틴에 DLK1을 처리함으로써 Smad 시그널링을 저해시킬 수 있는지 CAGA 리포터 분석을 통하여 확인하였다.
세포에 Smab 결합 요소(Smad binding element, SBE)를 가지는 pTAL-SBE-SEAP (CAGA)를 LipofectamineTM 2000 (Invitrogen)을 이용하여 형질전환(transfection)하였다. 다음날 96-웰 플레이트(96-well plate)로 세포를 옮긴 후, 그 다음날 FBS가 없는 배지에서 16시간 동안 배양 하였다 (serum starvation). 미오스타틴으로 활성화시키기 전 DLK1을 10 μg/ml부터 단계 희석하여 처리하였으며, ACVR2B와 DLK1의 결합을 증가시켜 주는 B09 항체, DLK1 antibody mAb1144 (R&D), ACVR2B의 항체인 AF339 및 F08로 2시간 동안 전처리 한 후, 1 nM의 미오스타틴을 처리하여 활성화 시켰다. 36시간 후 배양액으로부터 Applied Biosystems의 SEAP assay kit를 사용하여 리포터 분석을 실시하였으며, 그 결과를 도 21에 나타내었다.
도 21에 나타난 바와 같이, 항체의 음성대조군인 인간 IgG를 처리한 군을 보면, DLK1의 처리 농도가 증가할수록 미오스타틴에 의한 Smad 시그널링이 감소하는 것을 알 수 있다. B09 항체를 같이 처리한 군은 DLK1과 ACVR2B의 결합을 촉진시킴으로써 DLK1만 처리한 군보다 더 높은 저해 효과를 보이는 것을 알 수 있다. 한편, ACVR2B 항체들 (Ab AF339, F08)도 ACVR2B에 매우 높은 결합능을 보여 미오스타틴에 의한 Smad 시그널링을 효과적으로 저해하였으나 DLK1에 의한 효과는 다소 감소하는 것을 확인할 수 있었다.
실시예 15. DLK1에 의한 Smad7 증가 확인
세포를 60 mm 접시에 24시간 동안 배양하여, 접시 표면의 70% 정도가 채워지게 준비하였다. 혈청이 포함되는 않는 배지로 갈아 주고 16시간 동안 배양하였다. 세포를 수확하기 전 2시간 동안 DLK1-Fc를 10 μg/ml로 처리하여 반응시키고, 세포를 차가운 DPBS (Welgene)를 이용하여 2번 세척한 후 RIPA buffer를 이용하여 세포 용해물(cell lysate)을 제조하였다. 제조된 세포 용해물은 BCA assay kit (Thermo.) 정량을 통하여 농도를 결정하여 SDS-PAGE에 30 μg씩 로딩하였다. NC membrane (Bio-Rad)에 이동시킨 후 5% 탈지유(skim milk)/TBST tween20 0.05%에 30분 동안 블로킹을 실시하고, Smad7 (Cell signaling), β-actin (Sigma) 항체를 이용하여 4℃에서 하룻밤 동안(O/N) 반응시켰다. 다음으로, TBST tween20 0.05%에서 10분간 3번 세척한 후 각각에 맞는 2차 항체-HRP(secondary antibody-HRP) (rabbit, mouse-IgG-HRP)를 1 : 1000으로 1시간 동안 반응 시킨 후, 다시 한 번 TBST tween20 0.05%로 10분간 3번 세척하였다. 발색은 ECL solution (Intron)을 이용하여 1분간 필름 (Agfa)에 노출하여 분석하였으며, 그 결과를 도 22에 나타내었다.
도 22에서 알 수 있는 바와 같이, DLK1이 Smad 시그널링을 저해하는 Smad7을 증가시키는 것을 알 수 있었다. 이를 통하여 DLK1이 단순히 pSmad2/3을 감소시켜 Smad 시그널링을 저해할 뿐만 아니라, Smad7을 통한 Smad 시그널링까지 저해하는 매우 효율적인 저해제임을 알 수 있다.
전술한 본 발명의 설명은 예시를 위한 것이며, 본 발명이 속하는 기술분야의 통상의 지식을 가진 자는 본 발명의 기술적 사상이나 필수적인 특징을 변경하지 않고서 다른 구체적인 형태로 쉽게 변형이 가능하다는 것을 이해할 수 있을 것이다. 그러므로 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적이 아닌 것으로 이해해야만 한다.
본 발명의 DLK1 세포 외 수용성 도메인을 유효성분으로 포함하는 조성물은 미오스타틴(myostatin)의 작용 기작을 저해함으로써, 당뇨병 등과 같은 대사성질환이나 근육왜소증과 같은 근육 감소 질환 등의 예방 또는 치료제로 개발이 가능하다. 또한, DLK1 세포 외 수용성 도메인의 단편, 변이체, 또는 이들과 인간 항체 Fc 영역이 결합된 융합 단백질 등 다양한 형태로 변형하여 예방 또는 치료제로 개발할 수 있다.

Claims (20)

  1. DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인, DLK1의 세포 외 수용성 도메인의 단편, DLK1의 세포 외 수용성 도메인의 변이체(mutant) 또는 상기 변이체의 단편을 유효성분으로 포함하는, 미오스타틴(myostatin) 활성 저해용 조성물.
  2. 제 1항에 있어서,
    상기 DLK1의 세포 외 수용성 도메인은 서열번호 29로 기재된 아미노산 서열을 갖는 것을 특징으로 하는, 미오스타틴(myostatin) 활성 저해용 조성물.
  3. 제 1항에 있어서,
    상기 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인의 변이체(mutant)는 DLK1의 세포 외 수용성 도메인의 결실 돌연변이체(delete mutant)인 것을 특징으로 하는, 미오스타틴(myostatin) 활성 저해용 조성물.
  4. 제 3항에 있어서,
    상기 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인의 결실 돌연변이체(delete mutant)는 상피세포 성장인자-유사 반복서열(EGF-like repeat) 또는 막근접(juxtamembrane) 서열을 포함하는 결실 돌연변이인 것을 특징으로 하는, 미오스타틴(myostatin) 활성 저해용 조성물.
  5. 제 3항 또는 제4항에 있어서,
    상기 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인의 결실 돌연변이체(delete mutant)는 서열번호 30 내지 서열번호 34으로 기재된 아미노산 서열 중 어느 하나인 것을 특징으로 하는, 미오스타틴(myostatin) 활성 저해용 조성물.
  6. 제 1항에 있어서,
    상기 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인, DLK1의 세포 외 수용성 도메인의 단편, DLK1의 세포 외 수용성 도메인의 변이체(mutant) 또는 상기 변이체의 단편은 미오스타틴(myostatin) 또는 액티빈 수용체 타입 2B(ACVR2B)에 결합하여 미오스타틴(myostatin)의 작용을 억제하는 것을 특징으로 하는, 미오스타틴(myostatin) 활성 저해용 조성물.
  7. DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인 또는 이의 단편과 인간 항체 Fc 영역이 접합된 DLK1-Fc 융합 단백질을 유효성분으로 포함하는, 미오스타틴(myostatin) 활성 저해용 조성물.
  8. DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인, DLK1의 세포 외 수용성 도메인의 단편, DLK1의 세포 외 수용성 도메인의 변이체(mutant) 또는 상기 변이체의 단편을 유효성분으로 포함하는, 미오스타틴(myostatin) 관련 질환의 예방 또는 치료용 약학적 조성물.
  9. 제 8항에 있어서,
    상기 DLK1의 세포 외 수용성 도메인은 서열번호 29로 기재된 아미노산 서열을 갖는 것을 특징으로 하는, 약학적 조성물.
  10. 제 8항에 있어서,
    상기 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인의 변이체(mutant)는 DLK1의 세포 외 수용성 도메인의 결실 돌연변이체(delete mutant)인 것을 특징으로 하는, 약학적 조성물.
  11. 제 10항에 있어서,
    상기 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인의 결실 돌연변이체(delete mutant)는 상피세포 성장인자-유사 반복서열(EGF-like repeat) 또는 막근접(juxtamembrane) 서열을 포함하는 결실 돌연변이인 것을 특징으로 하는, 약학적 조성물.
  12. 제 10항 또는 제 11항에 있어서,
    상기 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인의 결실 돌연변이체(delete mutant)는 상피세포 성장인자-유사 반복서열(EGF-like repeat) 또는 막근접(juxtamembrane) 서열을 포함하는 결실 돌연변이인 것을 특징으로 하는, 약학적 조성물.
  13. 제 8항에 있어서,
    상기 DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인, DLK1의 세포 외 수용성 도메인의 단편, DLK1의 세포 외 수용성 도메인의 변이체(mutant) 또는 상기 변이체의 단편은 미오스타틴(myostatin) 또는 액티빈 수용체 타입 2B(ACVR2B)에 결합하여 미오스타틴(myostatin)의 작용을 억제하는 것을 특징으로 하는, 약학적 조성물.
  14. DLK1(delta-like 1 homolog)의 세포 외 수용성 도메인 또는 이의 단편과 인간 항체 Fc 영역이 접합된 DLK1-Fc 융합 단백질을 유효성분으로 포함하는, 미오스타틴(myostatin) 관련 질환의 예방 또는 치료용 약학적 조성물.
  15. 제 8항 또는 제 14항에 있어서,
    상기 미오스타틴(myostatin) 관련 질환은 근육 감소(muscle wasting) 질환, 대사 질환, 퇴행성 골 질환, 성기능 항진증(hypogonadism) 및 악액질(cachexia)으로 구성되는 군으로부터 선택되는 하나 이상인 것을 특징으로 하는, 약학적 조성물.
  16. 제 15항에 있어서,
    상기 근육 감소(muscle wasting) 질환은 근이영양증(muscular dystrophy), 경직성 척추 증후군(rigid spine syndrome), 근육-눈-뇌병(muscle-eye-brain disease), 근위축성 측삭경화증(루게릭병, amyotrophic lateral sclerosis), 샤르코-마리-투스병(Charcot-Marie-Tooth disease), 만성 염증성 신경증(chronic inflammatory neuropathy) 및 말단근병증(distal myopathy)으로 구성된 군으로부터 선택되는 하나 이상인 것을 특징으로 하는, 약학적 조성물.
  17. 제 15항에 있어서,
    상기 대사 질환은 제2형 당뇨병(type 2 diabetes), 비인슐린의존성 당뇨(noninsulin-dependent diabetes mellitus), 과혈당증(hyperglycemia), 비만 및 당뇨합병증으로 구성된 군으로부터 선택되는 하나 이상인 것을 특징으로 하는, 약학적 조성물.
  18. 제 15항에 있어서,
    상기 퇴행성 골 질환은 골다공증인 것을 특징으로 하는, 약학적 조성물.
  19. DLK1-미오스타틴, DLK1-ACVR2B 또는 이의 가용성 단편에 특이적으로 결합하는 항체 또는 앱타머를 포함하는, 미오스타틴 관련 질환의 진단 키트.
  20. 제 19항에 있어서,
    상기 진단 키트는 효소면역분석(ELISA) 키트 또는 샌드위치 ELISA 키트인 것을 특징으로 하는, 미오스타틴 관련 질환의 진단 키트.
PCT/KR2013/000033 2012-01-05 2013-01-03 Ｄｌｋ１ 세포 외 수용성 도메인을 유효성분으로 포함하는 미오스타틴 저해제 WO2013103248A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US14/370,341 US9388223B2 (en) 2012-01-05 2013-01-03 Myostatin inhibitor comprising extracellular water-soluble domains of DLK1 as active ingredient

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2012-0001460 2012-01-05
KR1020120001460A KR101995751B1 (ko) 2012-01-05 2012-01-05 Ｄｌｋ１ 세포 외 수용성 도메인을 유효성분으로 포함하는 미오스타틴 저해제

Publications (1)

Publication Number Publication Date
WO2013103248A1 true WO2013103248A1 (ko) 2013-07-11

Family

ID=48745280

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2013/000033 WO2013103248A1 (ko) 2012-01-05 2013-01-03 Ｄｌｋ１ 세포 외 수용성 도메인을 유효성분으로 포함하는 미오스타틴 저해제

Country Status (3)

Country Link
US (1) US9388223B2 (ko)
KR (1) KR101995751B1 (ko)
WO (1) WO2013103248A1 (ko)

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101826792B1 (ko) * 2015-10-29 2018-02-09 주식회사 와이바이오로직스 Dlk1의 세포 외 수용성 도메인을 유효성분으로 포함하는 지방간 또는 인슐린 저항성 증후군 예방 및 치료용 조성물
WO2017218581A1 (en) * 2016-06-13 2017-12-21 Massachusetts Institute Of Technology Microfluidic device for three dimensional and compartmentalized coculture of neuronal and muscle cells, with functional force readout
AU2017357944A1 (en) 2016-11-10 2019-06-20 Keros Therapeutics, Inc. Activin receptor type IIa variants and methods of use thereof
US11306141B2 (en) 2017-09-08 2022-04-19 Y-Biologics Inc. Antibody against human DLK1 and use thereof
KR20200085832A (ko) 2017-11-09 2020-07-15 케로스 테라퓨틱스, 인크. 액티빈 수용체 유형 iia 변이체 및 그의 사용 방법
WO2019139351A1 (en) * 2018-01-09 2019-07-18 Korea Research Institute Of Bioscience And Biotechnology Pharmaceutical composition for preventing or treating muscular disease or cachexia comprising, as active ingredient, mirna located in dlk1 -dio3 cluster or variant thereof
EP3737406A4 (en) * 2018-01-12 2021-11-03 Keros Therapeutics, Inc. ACTIVIN RECEPTOR TYPE IIB VARIANTS AND THEIR METHODS OF USE

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR100982170B1 (ko) * 2010-03-16 2010-09-15 한국생명공학연구원 ＤＬＫ１―Ｆｃ 융합 단백질을 유효성분으로 함유하는 암 전이 억제용 조성물
US7837993B2 (en) * 2004-03-19 2010-11-23 The Board Of Trustees Of The Leland Stanford Junior University Methods and compositions for regeneration of aged skeletal muscle tissues

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7837993B2 (en) * 2004-03-19 2010-11-23 The Board Of Trustees Of The Leland Stanford Junior University Methods and compositions for regeneration of aged skeletal muscle tissues
KR100982170B1 (ko) * 2010-03-16 2010-09-15 한국생명공학연구원 ＤＬＫ１―Ｆｃ 융합 단백질을 유효성분으로 함유하는 암 전이 억제용 조성물

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
DATABASE NCBI GENBANK 15 July 2006 (2006-07-15), accession no. AH07741.1 *
DATABASE NCBI GENBANK ACCESSION 6 September 2006 (2006-09-06), accession no. BC26875.1 *
LEE ET AL.: "Regulation of muscle growth by multiple ligands signaling through activin type II receptors", PNAS, vol. 102, no. 50, 13 December 2005 (2005-12-13), pages 18117 - 18122, XP002428860 *

Also Published As

Publication number Publication date
US20150030595A1 (en) 2015-01-29
KR101995751B1 (ko) 2019-07-03
US9388223B2 (en) 2016-07-12
KR20130080586A (ko) 2013-07-15

Similar Documents

Publication Publication Date Title
WO2013103248A1 (ko) Ｄｌｋ１ 세포 외 수용성 도메인을 유효성분으로 포함하는 미오스타틴 저해제
WO2020111913A1 (en) Anti-4-1bb antibody and use thereof
WO2018124642A2 (ko) 치수줄기세포의 상아 모전구세포로의 분화용 조성물 및 상아모전구세포 표면에 특이적으로 결합하는 IgG 또는 IgM 타입 단일 클론 항체
WO2015005632A1 (ko) Dll4와 vegf에 특이적으로 결합하는 신규 이중표적 단백질 및 이의 용도
WO2013169077A1 (ko) 악액질 예방 또는 치료용 조성물
WO2019039891A1 (ko) 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도
WO2012165925A2 (ko) Hgf 활성을 가지는 c-met에 대한 인간항체 및 이의 용도
WO2020231199A1 (ko) 신규 변형 면역글로불린 fc 융합단백질 및 그의 용도
WO2017222337A1 (ko) Fviii 및 vwf 인자를 포함하는 키메라 단백질 및 그 용도
WO2012138102A2 (ko) Ｄｌｋ１ 특이적 인간 항체 및 이를 포함하는 약학적 조성물
WO2022085905A1 (ko) SARS-CoV-2 스파이크 단백질에 특이적으로 결합하는 항체 및 이의 용도
WO2022103245A1 (ko) Sars-cov-2에 대한 단일 도메인 항체 및 이의 용도
WO2019182417A1 (ko) 황열 바이러스 유래 ns1 단백질, 이에 특이적으로 결합하는 단일클론항체 및 이의 용도
EP1756156B1 (en) Selective vpac2 receptor peptide agonists
WO2010126279A2 (ko) 사이토케라틴１７-특이적인 인간항체
CN107177002B (zh) 一种能与人β-Klotho受体特异性结合的抗体及其用途
WO2020050626A1 (ko) O-글리코실화 가능한 폴리펩타이드 영역을 포함하는 융합 폴리펩타이드
Gafvelin et al. Processing of prosecretin: isolation of a secretin precursor from porcine intestine.
WO2018004294A2 (ko) 인간 성장호르몬 변이 단백질 또는 이의 트랜스페린 융합 단백질을 유효성분으로 포함하는 약학적 조성물
WO2020117017A1 (ko) 항 c-met 아고니스트 항체 및 이의 용도
WO2013022262A2 (ko) 인간 리지스틴 수용체 및 그 용도
WO2020204305A1 (ko) 항-메소텔린 항체, 항-cd3 항체 또는 항-egfr 항체를 포함하는 융합 단백질 및 이를 포함하는 이중 특이적 또는 삼중 특이적 항체 및 이의 용도
WO2023282654A1 (ko) Il-23에 의해 매개되는 질환의 중증도 예측용 조성물
WO2021182928A1 (ko) 신규 이중 특이성 단백질 및 그의 용도
WO2023121254A1 (ko) 인터류킨-2 융합단백질, 이의 제조방법 및 이를 포함하는 약학 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13733562

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 14370341

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 13733562

Country of ref document: EP

Kind code of ref document: A1