WO2013036973A2 - Methods and compositions for controlling assembly of viral proteins - Google Patents

Methods and compositions for controlling assembly of viral proteins Download PDF

Info

Publication number
WO2013036973A2
WO2013036973A2 PCT/US2012/054534 US2012054534W WO2013036973A2 WO 2013036973 A2 WO2013036973 A2 WO 2013036973A2 US 2012054534 W US2012054534 W US 2012054534W WO 2013036973 A2 WO2013036973 A2 WO 2013036973A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
core protein
modified
protein
viral
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2012/054534
Other languages
English (en)
French (fr)
Other versions
WO2013036973A3 (en
Inventor
Miguel De Los Rios
Stephanie De Los Rios
Jacek Ostrowski
Kenneth J. Oh
Ilan ZIPKIN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biomed Realty LP
Original Assignee
Biomed Realty LP
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Biomed Realty LP filed Critical Biomed Realty LP
Priority to AU2012305714A priority Critical patent/AU2012305714A1/en
Priority to CA2847888A priority patent/CA2847888A1/en
Priority to JP2014529962A priority patent/JP2014527072A/ja
Priority to EP12829920.3A priority patent/EP2747774A4/en
Publication of WO2013036973A2 publication Critical patent/WO2013036973A2/en
Publication of WO2013036973A3 publication Critical patent/WO2013036973A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/713Double-stranded nucleic acids or oligonucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/162Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/50Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
    • A61K9/51Nanocapsules; Nanoparticles
    • A61K9/5107Excipients; Inactive ingredients
    • A61K9/5176Compounds of unknown constitution, e.g. material from plants or animals
    • A61K9/5184Virus capsids or envelopes enclosing drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/107General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
    • C07K1/1072General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/107General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
    • C07K1/1072General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups
    • C07K1/1075General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups by covalent attachment of amino acids or peptide residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/107General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
    • C07K1/1072General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups
    • C07K1/1077General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups by covalent attachment of residues other than amino acids or peptide residues, e.g. sugars, polyols, fatty acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/107General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
    • C07K1/113General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides without change of the primary structure
    • C07K1/1133General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides without change of the primary structure by redox-reactions involving cystein/cystin side chains
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/107General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
    • C07K1/113General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides without change of the primary structure
    • C07K1/1136General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides without change of the primary structure by reversible modification of the secondary, tertiary or quarternary structure, e.g. using denaturating or stabilising agents
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2730/00Reverse transcribing DNA viruses
    • C12N2730/00011Details
    • C12N2730/10011Hepadnaviridae
    • C12N2730/10111Orthohepadnavirus, e.g. hepatitis B virus
    • C12N2730/10122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes

Definitions

  • This invention relates to manipulation of viral capsids and more particularly relates to therapeutic preparations using core protein modified viral capsids.
  • Viral protein-based therapeutic agents represent promising new drugs for the treatment of various diseases and disorders including cancer, infectious diseases, neurological disorders, inflammation and immune disorders, and cardiovascular disease. These drugs can result from the encapsulation of a therapeutic agent inside viral proteins, or from the genetic or biochemical attachment of therapeutic agents to viral proteins. However, generation of drugs derived from viral proteins requires controlled synthesis and efficient assembly of such proteins. Viral capsid particles, composed of many copies of a viral protein (or proteins), typically self-assemble when their subunit proteins are expressed in vivo or in vitro, or when purified biochemically. Because of this propensity to self-assemble, these particles are difficult to manipulate for purposes of drug delivery or ligand display.
  • phage display for screening of peptide or protein activity requires concomitant expression of the ligand(s) to be displayed on the phage particle surface in the same cell as the particle subunit itself, often as a fusion protein.
  • Challenges in generating drugs from viral capsid particles include controlling what therapeutic agent is associated with the particle, and in what manner and location it is associated.
  • the present invention has been developed in response to the present state of the art, and in particular, in response to the problems and needs in the art that have not yet been fully solved by currently available methods and compositions. Accordingly, the present invention has been developed to provide a method and composition for controlling the assembly of viral subunit proteins independently of the viral protein expression system that overcome many or all of the above-discussed shortcomings in the art.
  • the present disclosure is directed, at least in part, to methods and compositions for controlling self-assembly of viral core proteins to form a viral capsid (also referred to herein as a "nanocage").
  • a viral capsid also referred to herein as a "nanocage”
  • self-assembly of viral capsids can be controlled by introducing certain modifications into a viral core protein to maintain the viral core proteins in a manipulatable or oligomeric form (e.g., a non-caspid structure) and/or the exposing modified viral core protein maintained in a denaturing solution to certain conditions that trigger a self- assembly reaction.
  • the disclosed methods provide a method for assembling a modified viral core protein (e.g., a modified Hepatitis B Virus (HBV) core protein) into a viral capsid structure.
  • the method includes providing a modified HBV core protein in a solution comprising a denaturing agent and adding a reducing agent to the solution to form an assembled capsid structure.
  • the modified viral core protein may include at least one mutation or modification that can substantially prevent assembly of the viral core proteins until assembly is desired.
  • a modified HBV viral core protein may comprise a cysteine residue, e.g., a cysteine residue in the spike region of the HBV structural core, which is capable of forming a disulfide bond to maintain the protein in a locked, open state under denaturing conditions.
  • Assembly of the viral core proteins into a viral capsid may be triggered, for example, by contacting the viral core proteins with a reducing agent.
  • capsid self-assembly may be further controlled by reducing the concentration of a denaturant present in the assembly solution (e.g., diluting a first concentration of denaturant to a second concentration of denaturant).
  • the method may also include adding a negatively-charged polymer to the assembly solution.
  • the disclosed methods provide a method of controlling assembly of a modified viral core protein (e.g., a modified HBV core protein) into a capsid structure that do not require a cysteine modification to control assembly.
  • the method includes providing a modified HBV core protein in a solution comprising a denaturing agent and diluting the denaturing agent in the solution to form an assembled capsid. Reducing agents are not required in this method to initiate capsid formation because there are no constraining disulfide bonds present.
  • the method may also include adding a negatively-charged polymer to the assembly solution.
  • therapeutic agents may be encapsulated into the assembled capsid structure during the assembly process.
  • a therapeutic agent may be attached (e.g., covalently attached) to the HBV core proteins while the core proteins are in the locked, open state.
  • a therapeutic agent may be added to the assembly reaction and encapsulated into the assembled capsid by diffusion (e.g., the therapeutic agent is not bound to the HBV core protein, but based on concentration of agent in the solution is captured in the assembled capsid during assembly).
  • exemplary therapeutic agents include nucleic acid drugs (e.g., siRNAs, shRNAs, antisense nucleic acids, etc.), peptides, proteins, and small molecules.
  • Figure 1 is a schematic depicting modified HBV core protein dimers with a polylysine tail (e.g., a K9 tail) in a locked state;
  • a polylysine tail e.g., a K9 tail
  • FIG. 2 is a dynamic light scattering (DLS) plot showing the formation of modified HBV viral capsids in the presence of 10X beta-mercaptoethanol (BME);
  • Figure 3 is a DLS plot showing the formation of modified HBV viral capsids following the addition of BME;
  • Figure 4 is a DLS plot showing the formation of modified HBV viral capsids following the addition of BME;
  • Figure 5 is a DLS plots showing the formation of modified HBV viral capsids following the addition of BME and dilution of denaturant;
  • Figure 6 is a DLS plots showing the formation of modified HBV viral capsids following the addition of BME and dilution of denaturant;
  • Figure 7 is a DLS plots showing the formation of modified HBV viral capsids following the addition of BME and dilution of denaturant;
  • Figure 8 is a DLS plot showing the formation of modified HBV viral capsids following the dilution of denaturant in the presence of a negative polymer
  • Figure 9 is a DLS plot showing the formation of modified HBV viral capsids following the addition of BME in the absence of a negative polymer
  • Figure 10 is a DLS plot showing the rate of capsid formation at 4X BME, 10X BME, and
  • Figure 11 is a DLS plot showing the rate of viral capsid formation between a modified HBV core protein with a poly-lysine tail (e.g., a K9 tail) portion (lighter points) and a modified HBV core protein with C48A, C61A, and C107A mutations in a SEQ ID NO: 2 variant and a poly-lysine tail (e.g., a K9 tail) portion (darker points).
  • a poly-lysine tail e.g., a K9 tail
  • the present disclosure is directed, at least in part, to methods and compositions for controlling self-assembly of modified viral core proteins into a viral capsid structure.
  • the rate of viral core protein self-assembly may be controlled.
  • viral core protein self-assembly may be essentially delayed until a point at which self-assembly is desired.
  • the viral core protein may, in some cases, be conjugated or loaded with a therapeutic agent prior to assembly, for example, to control the amount of drug encapsulated in each capsid. It is contemplated herein that one or more regions of the viral core protein may be more easily conjugated or loaded with a therapeutic agent prior to nanocage formation as compared to after nanocage formation.
  • a viral core protein may be loaded, prior to assembly, with a nucleic acid therapeutic agent, e.g., to form a chimeric therapeutic.
  • a nucleic acid therapeutic agent e.g., to form a chimeric therapeutic.
  • nanocages of high purity e.g., low polydispersity and low fraction of non-assembled viral core protein
  • Self-assembly of the viral core proteins may be triggered, for example, by contacting the viral core proteins with a triggering agent (e.g., a reducing agent) and/or by reducing (e.g., diluting) the concentration of a denaturant present in the solution containing the viral core protein.
  • capsids contemplated herein may be referred to as “capsids,” “nanocages,” “cages,” “particles,” “therapeutic particles,” and “therapeutic chimeric particles.”
  • the methods and compositions contemplated herein provide control over viral core protein (e.g., Hepatitis B Virus core protein) self-assembly into a viral capsid.
  • viral core protein e.g., Hepatitis B Virus core protein
  • the disclosed methods for controlling self-assembly of modified viral core proteins into viral capsids include: (1) exposing a modified viral core protein to a reducing agent;
  • the methods some self- assembly do not rely on ionic strength of an assembly solution (e.g., by raising the ionic strength of the assembly solution, e.g., by adding NaCl to promote self-assembly of a viral capsid).
  • a viral core protein may be modified such that formation of an assembled capsid structure (e.g., nanocage formation) can be essentially inhibited until desired.
  • the modification may allow the viral core protein to oligomerize to form a multimer of viral core proteins.
  • two viral core proteins may form a dimer
  • three viral core proteins may form a trimer
  • four viral core proteins may form a tetramer.
  • the multimers may be homomultimeric or heteromultimeric.
  • oligomerization of the viral core protein can essentially prevent participation of the viral core protein in capsid formation (e.g., prevent the natural propensity of self-assembly of viral core proteins).
  • the modified viral core protein may be described as being in a locked state, which prevents capsid assembly.
  • a viral core protein may be modified to contain a moiety that can be used to couple a first viral core protein to a second viral core protein into an oligomeric form or locked state.
  • a first viral core protein may be modified to contain a cysteine residue that can form a disulfide bridge with a second viral core protein.
  • the modification may comprise a substitution mutation or an insertion mutation within the viral core protein to induce oligomeric formation.
  • the modification may occur at any suitable location in the core protein amino acid sequence.
  • the modification is located on the surface of the first viral core protein so that the modification can interact with a second viral core protein inducing oligomer formation.
  • any viral core protein that is capable, either alone or with another viral core protein, of self-assembling into a viral capsid is suitable for use in the disclosed methods.
  • Exemplary viral core proteins include hepatitis core proteins such as human and duck Hepatitis B Virus core protein, Hepatitis C Virus core protein, and may also include Human Papilloma Virus (HPV) type 6 LI and L2 protein and cowpea chlorotic mottle virus coat protein.
  • HPV Human Papilloma Virus
  • HBV core protein is Hepatitis B Virus (HBV) core protein (also referred to herein as "C-protein” or "CP”). It may be appreciated that different strains of HBV may have slight variations in the sequence of C-protein, and that any strain of HBV C-protein can be utilized. Exemplary sequences of HBV core protein include SEQ ID NO: 1 and 2, with amino acid sequence 1 to 183 corresponding to NCBI Protein Database accession numbers BAD86623 and AY741795, respectively:
  • SEQ ID NO: 1 and 2 The corresponding nucleic acid sequence for SEQ ID NO: 1 and 2 are shown below, respectively:
  • a viral core protein may exist as a monomer (e.g., the viral core protein may comprise a single amino acid chain) or as a dimer (e.g., the viral core protein may comprise two amino acid chains).
  • a dimer may be a homodimer or a heterodimer.
  • the viral core protein is a HBV core protein
  • HBV core proteins naturally form dimers in solution.
  • the HBV core protein may be modified to generate HBV core protein dimer-dimer complexes, as shown in
  • HBV core protein dimer-dimer complexes may be formed by modifying the spike region of the HBV core protein sequence.
  • the spike region of the HBV core protein comprises from about amino acids 74 to 84 of SEQ ID NO: 1 or SEQ ID NO: 2.
  • the spike region of a HBV core protein is modified to comprise a cysteine residue.
  • the spike region of an HBV core protein may be modified to comprise a cysteine residue at amino acid position 77, 79 or 80 of SEQ ID NO: 1 or SEQ ID NO: 2.
  • a cysteine residue into the spike region e.g., a E77C mutation
  • a cysteine residue into the spike region locks the HBV core protein dimer into a conformation that is not competent for self-assembly into nanocages due to the formation of a disulfide bond.
  • the protein dimer Upon reduction of this disulfide bond, the protein dimer is conformationally free to associate with other core protein dimers and self-assemble into nanocages.
  • the method for controlling assembly of HBV core proteins into viral capsids comprises exposing a modified viral core protein to a reducing agent without diluting the denaturant (e.g., the denaturant present in the buffer used to store the modified HBV core protein).
  • the self-assembly method includes without limitation: providing a modified HBV core protein in a solution comprising a denaturing agent and adding a reducing agent to the solution to form an assembled capsid structure.
  • Exemplary modified HBV core proteins comprise a cysteine in the spike region as described herein.
  • a core protein modified to contain a cysteine residue within the spike region e.g., at amino acid position 77 of SEQ ID NO: 1 or SEQ ID NO: 2 and a poly-lysine tail
  • a reducing agent e.g., 2-6 M urea
  • the method for controlling assembly of HBV core proteins into viral capsids includes exposing a modified viral core protein to a reducing agent and diluting the denaturant present in the assembly solution.
  • the self-assembly method includes without limitation: (1) providing a modified HBV core protein in a solution comprising a denaturing agent; (2) adding a reducing agent to the solution; and (3) diluting the denaturant in the solution from a first concentration of denaturant to a second concentration of denaturant, thereby to form an assembled capsid structure.
  • the denaturant may be diluted prior to addition of the reducing agent. In other embodiments, the denaturant may be diluted after the addition of the reducing agent.
  • Modified HBV core proteins that self-assemble to form viral capsids following the addition of a reducing agent and dilution of the denaturant include without limitation modified core proteins that comprise one or more stabilizing and/or destabilizing mutations as described below.
  • exemplary modified HBV core proteins comprise a cysteine in the spike region and one or more stabilizing and/or destabilizing mutations in core protein as described below.
  • the method for controlling assembly of HBV core proteins into viral capsids includes diluting the denaturant without adding a reducing agent.
  • the self- assembly method includes without limitation: providing a modified HBV core protein in a solution comprising a denaturing agent and diluting the denaturant in the solution to form an assembled capsid structure.
  • Modified HBV core proteins that self-assemble following dilution of the denaturant may in some instances not contain cysteine residues that form disulfide bonds.
  • modified HBV cores are sufficient to prevent nanocage formation in the presence of a denaturant and subsequent dilution of the denaturant (e.g., dilution by about 25%, 50%, 75%, or 80% of the starting concentration of denaturant) can trigger nanocage formation.
  • dilution by about 25%, 50%, 75%, or 80% of the starting concentration of denaturant e.g., dilution by about 25%, 50%, 75%, or 80% of the starting concentration of denaturant
  • Exemplary non-limiting modified HBV core proteins are described below.
  • a viral core protein may be essentially inhibited from self-assembly by subjecting the viral core protein to conditions that destabilize self-assembly and/or stabilize the non- assembled form or locked form of the viral core protein.
  • a denaturant may be used to prevent self-assembly of the viral core protein.
  • the HBV core protein may be maintained in a storage buffer that contains a denaturant (e.g., 2- 6 M urea) prior to initiation of capsid assembly.
  • any denaturant and concentration of denaturant may be used that is suitable for essentially preventing self-assembly of the viral core protein.
  • one or more chaotropic agents, detergents, lyotropic agents, organic denaturants, and/or detergents may be used as the denaturant.
  • Non-limiting examples of chaotropic agents include urea, thiocyanate salts (e.g., guanidinium thiocyanate (GITC)), trichloroacetate salts, guanidine hydrochloride (GuHCl), nitrate salts, and perchlorate salts (e.g., lithium perchlorate).
  • thiocyanate salts e.g., guanidinium thiocyanate (GITC)
  • trichloroacetate salts e.g., guanidine hydrochloride (GuHCl)
  • nitrate salts e.g., lithium perchlorate
  • Non-limiting examples of lyotropic agents include sulfate salts, phosphate salts, and acetate salts.
  • Non-limiting examples of organic denaturants include acetonitrile, methanol, ethanol, and trifluoroethanol (TFE).
  • Non-limiting examples of detergents include anionic, cationic, nonionic, or zwitterionic, detergents.
  • Anionic detergents may include, for example, deoxycholic acid, cholic acid, and sodium dodecyl sulfate (SDS).
  • Cationic detergents may include, for example, cetyltrimethylammonium bromide (CTAB).
  • Cationic detergents may include, for example, cetyltrimethylammonium bromide (CTAB).
  • Nonionic detergents may include, for example, digitonin, triton, and tween.
  • Zwitterionic detergents may include, for example, CHAPS.
  • a denaturant may be used in combination with a modification to a viral core protein to essentially prevent self-assembly, e.g., when a viral core protein can form a particularly stable nanocage.
  • an oxidizing environment may be used to stabilize the disulfide bridge.
  • oxygen gas dissolved in solution may be sufficient to maintain an oxidizing environment.
  • any suitable oxidant may be added that maintains an oxidizing environment yet does not damage the viral core protein.
  • a non-limiting example of an oxidant is iodine.
  • Self-assembly of the viral core proteins may be triggered at a desired point in time.
  • a reducing agent may be used to trigger self-assembly.
  • a disulfide bond may be broken using a thiol such as beta-mercaptoethanol (BME), tris(2- carboxyethyl)phosphine (TCEP), glutathione (GSH), dithiothreitol (DTT), 2mercaptoyethylamine (BMA), and/or free cysteine.
  • BME beta-mercaptoethanol
  • TCEP tris(2- carboxyethyl)phosphine
  • GSH glutathione
  • DTT dithiothreitol
  • BMA 2mercaptoyethylamine
  • the reducing agent may be added in an excess molar ratio relative to the viral core protein.
  • the range of reducing agent may be from about 0.1 molar equivalent to about 100 molar equivalents. For instance, in some cases, at least about 1 molar equivalent, at least about 4 molar equivalents, at least about 10 molar equivalents, at least about 20 molar equivalents, at least about 30 molar equivalents, or at least about 40 molar equivalents of the reducing agent relative to the viral core protein may be added.
  • the concentration of the reducing agent may be from about 0.1 molar equivalent to about 100 molar equivalents, from about 1 molar equivalent to about 100 molar equivalents, from about 1 molar equivalent to about 50 molar equivalents, from about 10 molar equivalent to about 100 molar equivalents, from about 10 molar equivalent to about 50 molar equivalents, or from about 10 molar equivalents to about 20 molar equivalents.
  • reducing the concentration of the denaturant may be used to trigger self-assembly of the viral core protein.
  • the concentration of denaturant may be reduced by about at least 10%, at least 20%, least 25%, at least 50%, at least 75%, at least 80%, or at least 90%. In certain embodiments the concentration of denaturant may be reduced in the range of from about 10% to about 90%.
  • the denaturant may be diluted from a first concentration to a second concentration to promote capsid formation during the assembly reaction. Dilution to the second concentration may include one or more dilution steps (e.g., one, two, three, four, five or more dilution steps). For example, prior to reducing the concentration of the denaturant (e.g., diluting the denaturant), the denaturant may have a concentration between about 2 M and about 8 M, between about 2 M and about 6 M, between about 2 M and about 4 M, between about 4 M and about 6 M, and between about 4 M and about 8 M, or any integer disposed within said ranges.
  • the denaturant may have a concentration between about 0.25 M and about 4 M, between about 0.25 M and about 2 M, between about 0.25 M and about 1 M, between about 0.5 M and about 4 M, between about 1 M and about 4M, and in some cases less than about 0.25 M, or any integer disposed within said ranges.
  • the denaturing agent may be diluted prior to addition of the reducing agent. In other embodiments, the denaturing agent may be diluted after the addition of the reducing agent.
  • the methods of regulating assembly of a viral capsid structure may further comprise adding a negatively-charged (e.g., anionic) polymer to the assembly solution.
  • a negatively-charged polymer is an RNA or DNA therapeutic agent (e.g., a siRNA) that may be encapsulated in the capsid.
  • the negatively charged polymer may include phosphonic acid, sulfonic acid, acrylic acid, maleic acid, sulfates and/or phosphates.
  • Negatively-charged polymers may also include, but are not limited to poly(vinylphosphonic acid), poly(vinylsulfonic acid, sodium salt), poly(4-styrenesulfonic acid) ammonium salt, poly(4-styrenesulfonic acid) lithium salt, poly(4-styrenesulfonic acid), poly(4styrenesulfonic acid-co-maleic acid) sodium salt, polyanetholesulfonic acid sodium salt, polyepoxysuccinic acid, poly(2-acrylamido-2-methyl-l-propanesulfonic acid), poly(2acrylamido-2-methyl-l-propanesulfonic acid-co-acrylonitrile) acrylonitrile, poly(Nisopropylacrylamide) - carboxylic acid terminated, poly(N-isopropylacrylamide-co- methacrylic acid), poly (N-isopropylacrylamide-co-methacry lie acid-co-oc
  • AAMMA acrylic acid- co-methyl methacrylate polymers
  • PMAA poly(methyl acrylic acid)
  • PEAA poly (ethyl acrylic acid)
  • PEAA poly(propyl acrylic acid)
  • PBAA poly(butyl acrylic acid) and heparin.
  • the negatively-charged polymer may be at least one of acrylic acid polymer, acrylic acid-co-methyl methacrylate polymers (AAMMA), poly(methyl acrylic acid) (PMAA), poly (ethyl acrylic acid) (PEAA), poly (propyl acrylic acid) (PPAA), and poly (butyl acrylic acid) (PBAA).
  • AAMMA acrylic acid-co-methyl methacrylate polymers
  • PMAA poly(methyl acrylic acid)
  • PEAA poly (ethyl acrylic acid)
  • PEAA poly (propyl acrylic acid)
  • PPAA poly (butyl acrylic acid)
  • cationic polymers may be added to the assembly solution.
  • Cationic polymers may be amine-based such as poly(ethyleneimine) (e.g., PEI bases) or another poly-cationic amino acid.
  • PEI based polymers may be branched and consist of primary, secondary, and tertiary amine groups with ratios of 25%, 50%, and 25%, respectively.
  • Exemplary cationic polymers include, but are not limited to, poly(acrylamide- codiallyldimethylammonium chloride), poly(allylamine hydrochloride), poly(diallyldimethylammonium chloride) , poly (dimethylamine-co-epichlorohydrin- coethylenediamine), poly(ethyleneimine) branched or linear, poly[bis(2-chloroethyl) ether- altl,3-bis[3-(dimethylamino)propyl]urea], poly(arginine), poly(lysine), and poly(histidine).
  • the pH of the assembly solution may be between about 7.0 to about 9.5.
  • the pH of a solution may be between about 7.0 to about 9.0, between about 7.0 to about 8.5, between about 7.4 to about 8.0 and between about 7.4 to about 7.6.
  • the pH of an assembly solution may be adjusted during the assembly reaction (e.g., the pH may be at a first pH at the beginning of an assembly reaction (e.g., pH 9.5) and may be adjusted during the course of the assembly reaction to a second pH (e.g., pH 7.4)).
  • the pH of the assembly solution may be at about pH 7.0 or lower, e.g., capsid assembly may be conducted at a pH of 6.8 or lower, 6.5 or lower, 6.3 or lower, or 6.0 or lower. In certain embodiments, the pH of the assembly solution may be from about 5.0 to about 7.0. It is contemplated herein that certain mutations may be introduced into the HBV core (e.g., a F18H or A137H mutation) to destabilize a capsid at the dimer-dimer interface at low pH, e.g., a pH below the pKa of histidine, e.g., 6.0.
  • HBV core e.g., a F18H or A137H mutation
  • capsid assembly may be controlled by modifying the pH of the assembly solution (e.g., pH may be lower to about 7.0 or lower to prevent capsid assembly and raised to about 7.0 or higher to promote capsid assembly).
  • assembly of the viral core proteins to form nanocages occurs at a managed rate.
  • the number of molar equivalents of triggering agent (e.g., a reducing agent) and/or the dilution rate of a denaturant may be adjusted to achieve a desired rate of self-assembly.
  • at least about 95% of the viral core proteins may be self- assembled in less than about 3 hours, in less than about 2 hours, in less than about 1 hour, in less than about 30 minutes, in less than about 15 minutes, or in less than about 10 minutes.
  • nanocages e.g., viral capsids
  • DLS dynamic light scattering
  • the assembled viral core proteins i.e., the nanocages
  • the average particle radius of the nanocages may be between about 10 nm and about 100 nm, between about 10 nm and about 50 nm, between about 15 nm and about 50 nm, between about 15 nm and about 40 nm, between about 15 nm and about 30 nm and between about 15 nm and about 20 nm.
  • the viral capsids formed by self-assembly of the viral core proteins may sometimes be purified.
  • the assembled viral capsids are purified by size exclusion chromatography, centrifugation, and/or filtering.
  • the methods contemplated herein may allow nanocages (e.g., viral capsids) to be prepared with high purity even in the absence of purification steps.
  • nanocages e.g., viral capsids
  • particles with a polydispersity of less than about 20%, less than about 15%, or less than about 10% can be prepared.
  • particles with a polydispersity of between about 5% and about 20%, between about 10% and about 20% and between about 5% and about 15% can be prepared.
  • the assembled viral capsid particles disclosed herein are substantially non-replicating and do not substantially incorporate attenuated wild-type virus.
  • the viral core proteins may be designed to be substantially non-immunogenic and/or may be designed so that once the particle starts to disintegrate, it is degraded quickly so as to limit any potential immune response.
  • the assembled viral capsids contemplated herein may be substantially spherical and/or may be icosahedral in form.
  • the modified HBV core protein may comprise the first 149 amino acids of SEQ ID NO: 1 or SEQ ID NO: 2 as described herein.
  • the modified HBV core protein may comprise the first 138 amino acids of SEQ ID NO: 1 or SEQ ID NO: 2 as described herein.
  • any cleavable chemical species capable of coupling a first viral core protein to a second core protein may be used to prevent nanocage formation.
  • a first viral core protein may contain an aldehyde group and a second viral core protein may contain a hydrazine group.
  • the aldehyde group and the hydrazine group may react to form a hydrazone group that couples the first viral core protein to the second viral core protein.
  • a hydrazone group may be cleaved by contacting the viral core proteins with a solution having a pH of less than about 7, or in some embodiments less than about 6.
  • Additional cleavable chemical species that may be used to modify a viral core protein to maintain it in the locked state and regulate capsid assembly include without limitation the use of photocleavable linkers; chelating linkers; ssDNA linkers; dsDNA linkers; peptide linkers; autocleavable linkers; and saccharide linker.
  • photocleavable linkers such as bismaleimide may be used to lock to viral proteins in an open state to prevent assembly.
  • the photocleavable linker may be cleaved by the application of light to trigger cage formation.
  • Chelating linkers e.g., a maleimide linkage on a first viral protein and a chelating moiety on a second viral protein, may be used to create a metal and linker complex to lock the two viral proteins in an open state to prevent assembly. Cage formation may be regulated by removing the metal.
  • DNA linkers such as (ss) single-stranded or (ds) double-stranded DNA linker may also be used.
  • a cleavable linker such as bis-maleimide may include either a ssDNA or dsDNA between the two maleimide moieties.
  • the ssDNA or dsDNA linker may be cleaved with an endonuclease that triggers nanocage formation.
  • DsDNA linkers can also be broken by the addition of heat to the melting point of the dsDNA. Similarily, peptide linkers between two maleimide moieties may be used and subsequently cleaved by the addition of an endoprotease. Saccharide linkers may also be used between two maleimide moieties and subsequently cleaved by the addition of NaI04 to trigger cage formation.
  • the wild-type HBV core protein is typically 183 amino acids (referred to herein as “core protein 183" or “CP183").
  • the amino-terminal 149 amino acids form a globular-fold or structural core.
  • a structural core portion of an HBV core protein based on amino acids 1-149 of SEQ ID NO: 1 or SEQ ID NO: 2 referred to herein as “structural core portion,” “core protein 149” or “CP149"
  • structural core portions of SEQ ID NO: 1 and SEQ ID NO: 2 are shown below:
  • CP149 based on SEQ ID NO: 1 has the following amino acid sequence:
  • CP149 based on SEQ ID NO: 2 has the following amino acid sequence:
  • portion when used in reference to a core protein refers to a fragment of that protein.
  • core protein or "CP” followed by a number refer to an amino-terminal portion of a HBV core protein.
  • CP183 refers to HBV core protein with 183 amino acids (e.g., a wild-type HBV core protein)
  • CP149 refers to a HBV core protein with the amino-terminal 149 amino acids (e.g., a structural core portion of an HBV core protein).
  • a structural core portion may include the first amino-terminal 138 amino acids of an HBV core protein.
  • a contemplated modified structural portion of a viral core protein may include amino acids 1-138 of SEQ ID NO: 1 or SEQ ID NO: 2 (referred to herein as “core protein 138" or "CP138"), that may include one or more modifications as described herein.
  • core protein 138 or SEQ ID NO: 2
  • the CP138 sequences corresponding to SEQ ID NO:l and SEQ ID NO: 2 are shown below.
  • CP138 based on SEQ ID NO: 1 has the following amino acid sequence:
  • CP138 based on SEQ ID NO: 2 has the following amino acid sequence:
  • the carboxyl-terminal 34 amino acids are typically referred to as the "tail portion" of the HBV core protein.
  • a tail portion of the HBV core protein may be a wild-type tail portion (e.g., including the HBV core protein carboxyl-terminal 34 amino acids or a fragment thereof) or a synthetic tail portion (e.g., non-HBV core protein sequence, e.g., a lysine tail, arginine tail) or a combination thereof, as described below.
  • a modified HBV core protein may include a histidine tag.
  • the modified HBV core protein is truncated at the carboxyl- terminus to remove all or part of the 34 amino acid tail portion.
  • the C terminal tail portion which comprises from about amino acid residue 150 to about amino acid residue 183 of SEQ ID NO: 1 or SEQ ID NO: 2, may be truncated from the modified HBV core protein.
  • the C-terminal tail portion comprises four arginine-rich repeats. It is contemplated herein that one, two, three or four of the arginine rich repeats may be truncated from the carboxyl-terminus of the modified HBV core protein.
  • Exemplary truncation mutants include a mutation at CP170, wherein one arginine-rich repeat is truncated from the carboxy-terminus of the HBV core protein, as shown below (the remaining three arginine- rich repeats are underlined):
  • the structural core portion or CP149 may be generated when all four-arginine rich repeats are truncated from the carboxy-terminus.
  • HBV C-protein variant SEQ ID NO: 2 For simplicity, the embodiments described herein exemplify truncations and/or modifications of the HBV C-protein variant SEQ ID NO: 2. It is appreciated that the same truncations and/or modifications can be engineered within HBV C-protein variant SEQ ID NO: 1.
  • structural core portion of an HBV core protein may be modified to comprise a cysteine residue, for example, in the spike region of the HBV core protein, to control assembly of the capsid structure.
  • the spike region comprises from about amino acid residue 74 to about amino acid residue 84 of SEQ ID NO: 1 or SEQ ID NO: 2.
  • the spike region of an HBV core protein may be modified to comprise a cysteine residue at any amino acid position from about amino acid residue 74 to about amino acid residue 84 of SEQ ID NO: 1 or SEQ ID NO: 2, e.g., the HBV core protein may be modified to comprise a cysteine residue at amino acid position 77, 79 or 80 of SEQ ID NO: 1 or SEQ ID NO: 2.
  • Exemplary structural core protein sequences comprising a cysteine residue in the spike region of SEQ ID NO:2 include CP 149 with a glutamic acid to cysteine mutation at amino acid position 77 (underlined), which has the following amino acid sequence:
  • CP149 with a aspartic acid to cysteine mutation at amino acid position 78 (underlined) has the following amino acid sequence:
  • CP 149 with an alanine to cysteine mutation at amino acid position 80 has the following amino acid sequence:
  • the wild-type HBV core sequence may be modified in the spike region to comprise a cysteine residue, e.g., to control assembly. It is also contemplated herein that the HBV core protein may be mutated to include a cysteine residue outside of the spike region in any location sufficient to form disulfide bonds with another HBV core protein to generate a locked HBV core protein dimer-dimer complex as illustrated in FIG. 1A-B.
  • a structural core portion of an HBV core protein may be also modified, for example, to (a) strengthen and further promote assembly of the viral core protein, e.g., HBV core protein monomers into a capsid (referred to herein as "stabilizing mutations"); (b) to destabilize the capsid structure; (c) enhance and promote the coating of one or more capsids with a layer comprising a lipid or lipid/cholesterol; (d) facilitate the attachment of other moieties, e.g., chemical modifiers and/or targeting agents; and/or (e) facilitate the disassembly of the entire capsid in the bloodstream following administration.
  • stabilizing mutations e.g., HBV core protein monomers into a capsid
  • a modified structural core protein can be, in some embodiments, represented by SEQ ID NO: 15, where X, independently for each occurrence, represents an amino acid. It is understood that a contemplated viral core protein may include a structural portion represented by, e.g., SEQ ID NO: 15 and may additionally include a modified or unmodified tail portion, e.g., a modified C-terminal tail portion such as those described below.
  • a HBV capsid may be formed from protein dimers.
  • intermolecular interactions between dimers may stabilize the assembly and may be formed by disulfide bonds, salt bridges, and hydrophobic interactions between proteins.
  • a structural core portion may include a mutation in interacting amino acid side chains to either stabilize and/or destabilize the interactions and therefore, the capsid or particle assembly.
  • such mutations may affect the long-term stability of a capsid or particle formed from viral core proteins that include such viral structural portions.
  • stabilizing and/or destabilizing mutations can be introduced, e.g., singly and/or in combination.
  • stabilizing mutations may be introduced at amino acid positions 121 and/or 141 of a structural core portion of a HBV core protein (e.g., S121C and/or S141C of SEQ ID NO: 2) to form a disulfide bond, which may stabilize inter-dimer associations between viral protein core proteins.
  • a stabilizing mutation may be introduced at amino acid position 14 of a structural core portion of a HBV core protein (e.g., E1411 of SEQ ID NO: 2).
  • Stabilizing sequences based on CP162 of the HBV core protein variant SEQ ID NO: 2 include the following without limitation:
  • Exemplary stabilizing mutation sequences shown above include a cysteine residue at amino acid position 77. It is contemplated herein that the amino acid 77 may be a glutamic acid. It is also contemplated herein that amino acid 77 may be a glutamic acid and that a cysteine residue may be introduced at another amino acid position within the spike region (e.g., from about amino acid 74 to about amino acid 84 of the spike region).
  • destabilizing mutations may be introduced into the structural core portion of a HBV core protein.
  • Exemplary destabilizing mutations may be introduced at amino acid positions 18, 23, 33, 36, 37, 118, 122, 137, 132 and/or 139 of a structural core portion of a HBV core protein (e.g., F1811, F2311, T33H, A36H, L37H, Y118H, F12211, Y 132F, Y132A, Y132V, A13711, and/or I139A of SEQ ID NO: 2).
  • Exemplary destabilizing sequences based on CP162 of the HBV core protein variant SEQ ID NO: 2 include the following:
  • Exemplary destabilizing mutation sequences shown above also include a cysteine residue at amino acid position 77. It is contemplated herein that the amino acid 77 may be a glutamic acid. It is also contemplated herein that amino acid 77 may be a glutamic acid and that a cysteine residue may be introduced at another amino acid position within the spike region (e.g., from about amino acid 74 to about amino acid 84 of the spike region).
  • both stabilizing and destabilizing mutations may be introduced into the structural core portion of a HBV core protein.
  • Exemplary structural core protein sequences with both stabilizing and destabilizing mutations based on CP 162 of the HBV core protein variant SEQ ID NO: 2 include the following:
  • Exemplary stabilizing and destabilizing mutation sequences shown above also include a cysteine residue at amino acid position 77. It is contemplated herein that the amino acid 77 may be a glutamic acid. It is also contemplated herein that amino acid 77 may be a glutamic acid and that a cysteine residue may be introduced at another amino acid position within the spike region (e.g., from about amino acid 74 to about amino acid 84 of the spike region).
  • the native cysteine residues at positions 48, 61, and/or 107 may also be mutated, (for example to an alanine), without substantially affecting the ability of the core protein to form a capsid or particle.
  • Exemplary sequences based on a CP149 structural core portion of a HBV core protein variant based on SEQ ID NO: 2 include the following:
  • MDIDPYKEFGATVELLSFLPSDFFPSV DLLDTASALYREALESPEHCSPHHTAL QAILCWGELMT LATWVGN LCDPASRDLVVNYVNTNMGLKIRQLLWFHISALTFGRETVLEYLVSFGVWIRTPPAY RPPN APILS TLPETT V V (SEQ ID NO: 37);
  • MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHASPHHTALRQAILAWGELM TLATWVGN LCDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA YRPPNAPILSTLPETTVVD (SEQ ID NO: 38);
  • Modifications of the structural core portion of a viral core protein can include the introduction of, e.g., a pair of cysteines into a spike area of a formed dimer or the interface between dimers.
  • a first cysteine e.g., amino acid 23
  • a second cysteine amino acid 132 in this case
  • the second position may also participate in a disulfide bond, allowing the dimer to participate in four disulfide bridges and a total of 180 stabilizing covalent interactions.
  • At least four different types of disulfide bonds may be created:
  • exemplary modified viral core proteins that include a modified structural core portion, include the following:
  • HBV C-protein variant of SEQ ID NO: 2 comprising mutation 1: phenylalanine 23 to cysteine; tyrosine 132 to cysteine:
  • HBV C-protein SEQ ID NO: 1 comprising mutation 1: phenylalanine 23 to cysteine; tyrosine 132 to cysteine:
  • MDIDPYKEFGASVELLSFLPSDCFPSI DLLDTASALYREALESPEHCSPHHTAL QAILCWGELMN LATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAC RPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC (SEQ ID NO: 43);
  • HBV C-protein variant SEQ ID NO: 2 comprising mutation 2: aspartic acid 29 to cysteine; arginine 127 to cysteine:
  • HBV C-protein SEQ ID NO: 1 comprising mutation 2: aspartic acid 29 to cysteine; arginine 127 to cysteine:
  • HBV C-protein variant SEQ ID NO: 2 comprising mutation 3: threonine 33 to cysteine; valine 124 to cysteine:
  • HBV C-protein SEQ ID NO: 1 comprising mutation 3: threonine 33 to cysteine; valine 124 to cysteine:
  • HBV C-protein variant SEQ ID NO: 2 comprising mutation 4: leucine 37 to cysteine; valine 120 to cysteine:
  • HBV C-protein SEQ ID NO: 1 comprising mutation 4: leucine 37 to cysteine; valine 120 to cysteine:
  • amino acid 77 may be a glutamic acid and a cysteine residue may be introduced into another location within the spike region, e.g., a cysteine residue may be substituted at about amino acid position 74 to about amino acid position 84, e.g., at amino acid position 78 or 80.
  • a structural core portion of the viral core protein may be modified to include a conjugation site that allows the attachment of a moiety, e.g., a chemical linker moiety such as a lipid linker moiety (e.g., a maleimide intermediate).
  • a chemical linker moiety such as a lipid linker moiety (e.g., a maleimide intermediate).
  • cysteine or lysine may be placed in the structural core in such a way so that when formed in a capsid or particle these modifications may protrude away from the capsid surface, e.g., toward a plasma membrane.
  • such modifications may permit the addition of one or more lipid linker moieties which can serve to promote or facilitate a lipid layer.
  • the assembled viral capsids may comprise a partial or substantially complete coating disposed on the particle that includes one or more lipids.
  • at least one lipid molecule may covalently bound through a chemical linker moiety, e.g., a lipid linker moiety, to a viral core protein, e.g., to a structural core portion of a disclosed viral core protein.
  • the lipid may be attached via bond or chemical linker moiety, to an engineered location on the structural core portion of the viral core protein, for example at amino acid position 77, 78 or 80 of a hepatitis B structural core portion, as described above.
  • three positions on a structural core portion of a viral core protein may be used for the introduction of one or more cysteines and/or lysines, e.g., amino acid residue 77, glutamic acid to cysteine or lysine; amino acid residue 78, aspartic acid to cysteine or lysine; and/or amino acid residue 80, alanine to cysteine or lysine on a HBV core protein (e.g., SEQ ID NO: 2).
  • cysteine modifications may be further functionalized.
  • Cysteine mutations may also be introduced at other locations in the C-protein.
  • Exemplary modified structural core portions CP149 of a HBV core protein variant SEQ ID NO:2 include:
  • MDIDPYKEFGATVELLSFLPSDFFPSV DLLDTASALYREALESPEHCSPHHTAL QAILCWGELMT LATWVGN LCDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAY RPPN APILS TLPETT V V (SEQ ID NO: 12);
  • MDIDPYKEFGATVELLSFLPSDFFPSV DLLDTASALYREALESPEHCSPHHTAL QAILCWGELMT LATWVGNNLEDPCSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLE YLVSFGVWIRTPPAYRPPNAPILSTLPETTVV (SEQ ID NO: 14);
  • Contemplated lipid linker moieties may include those discussed herein.
  • Exemplary lipid linker moieties may be formed from contacting e.g., a succinimidyl derivative such as succinimidyl-4-(p-maleimidophenyl)butyrate (SMPB) or m-maleimidobenzoyl- Nhydroxysuccinimide ester with a modified structural core portion of the viral core protein.
  • SMPB succinimidyl-4-(p-maleimidophenyl)butyrate
  • m-maleimidobenzoyl- Nhydroxysuccinimide ester with a modified structural core portion of the viral core protein.
  • a chemical linker may bind another moiety to a particle formed from viral core proteins that include a modified structure core portion, e.g., that include one or more cysteine residues.
  • exemplary chemical linkers include moieties such as those formed by contacting a cysteine residue with a maleimide-containing compound such as phosphatidylethanolamine-maleimide (PE-maleimide or PEmal).
  • Phospholipids for example, may be directly linked through a chemical linker to a modified structural core portion, e.g., to link a lipid molecule and/or a targeting agent.
  • An assembled capsid may have a layer or coating comprising one or more lipids, e.g., a neutral lipid, an anionic lipid, and/or a cationic lipid.
  • a neutral lipid and/or an amphipathic lipid for example, a phospholipid such as phophatidyl serine, may be covalently bonded to a lipid linker moiety.
  • Such covalently bound lipid molecules may guide the placement of a coating, e.g., that may include one more neutral lipids, and/or may include an anionic lipid that is surface neutral, such as POPG.
  • Exemplary phospholipids suitable for use include, but are not limited to, hydrogenated soy phosphatidylcholine (HSPC), egg phosphatidylcholine (EPC), phosphatidyl ethanolamine (PE), phosphatidyl glycerol (PG), phosphatidyl inositol (PI), monosialogangolioside, spingomyelin (SPM), distearoylphosphatidylcholine (DSPC), dimyristoylphosphatidylcholine (DMPC), or dimyristoylphosphatidylglycerol (DMPG).
  • HSPC hydrogenated soy phosphatidylcholine
  • EPC egg phosphatidylcholine
  • PE phosphatidyl ethanolamine
  • PG phosphatidyl glycerol
  • PI phosphatidyl inositol
  • SPM distearoylphosphatidylcholine
  • DMPC dimy
  • an assembled capsid contemplated herein may be coated with one or more lipids including one, two, or more of lipids such as palmitoyloleoylphosphatidylglycerol (POPG), hydrogenated soy phosphatidylcholine (HSPC).
  • Contemplated lipids include PEG- phospholipids, including poly(ethylene glycol)-derivatized distearoylphosphatidylethanolamine (PEG-DSPE) and/or poly (ethylene glycol)-derivatized ceramides (PEG-CER).
  • capsids may include a coating comprising one or more lipids and cholesterol, for example, and may include various amounts of cholesterol, HSPC or POPG.
  • the lipid coating may include about 5% to about 40% cholesterol, about 10% to about 80% HSPC and/or about 5% to about 80% POPG, or any specific percentage within said ranges.
  • a coating may comprise, for example, (a) about 20% cholesterol and about 80% HSPC; (b) about 50% cholesterol and about 50% HSPC; (c) about 20% cholesterol and about 20 % HSPC and about 60% POPG; (d) about 50% cholesterol and about 50% POPG; (e) 20% cholesterol and 80% POPG; or (f) about 10% cholesterol and about 15% HSPC and about 65% POPG.
  • a coating may include about 20% cholesterol, about 20% HSPC and about 60% POPG.
  • a coating composition may have a coating to particle mass value of about 10% to about 60%, about 10% to about 50%, about 15 to about 40%, about 20% to about 35% of the total protein (w/w), or any specific percentage with the recited ranges.
  • a lipid coating composition may coat a particle at a mass value of about 30% to about 100% (w/w).
  • suitable ratios of protein:lipid for the coating process may range from approximately 1:1 protein:lipid (w:w) to approximately 1:30 protein:lipid (w:w). Protein:lipid rations may sometimes be from 0.1:1 to 1:100 or any intermediate ratio within such ranges.
  • lipid refers to a group of organic compounds that include, but are not limited to, esters of fatty acids and are characterized by being insoluble in water, but soluble in many organic solvents. They are usually divided into at least three classes: (1) “simple lipids,” which include fats and oils as well as waxes; (2) “compound lipids,” which include phospholipids and glycolipids; and (3) “derived lipids” such as steroids.
  • neutral lipid refers to any of a number of lipid species that exist either in an uncharged or neutral zwitterionic form at a selected pH.
  • lipids include, for example, diacylphosphatidylcholine, diacylphosphatidylethanolamine, ceramide, sphingomyelin, cephalin, cholesterol, cerebrosides, and diacylglycerols.
  • amphipathic lipid refers, in part, to any suitable material wherein the hydrophobic portion of the lipid material orients into a hydrophobic phase, while the hydrophilic portion orients toward the aqueous phase.
  • Hydrophilic characteristics derive from the presence of polar or charged groups such as carbohydrates, phosphate, carboxylic, sulfate, amino, sulfhydryl, nitro, hydroxyl, and other like groups. Hydrophobicity can be conferred by the inclusion of apolar groups that include, but are not limited to, long chain saturated and unsaturated aliphatic hydrocarbon groups and such groups substituted by one or more aromatic, cycloaliphatic or heterocyclic group(s).
  • amphipathic compounds include, but are not limited to, phospholipids, aminolipids and sphingolipids.
  • phospholipids include, but are not limited to, phosphatidylcholine such as egg phosphatidylcholine or hydrogenated soy phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, phosphatidic acid, pahnitoyloleoyl phosphatidylcholine, lysophosphatidylcholine, lysophosphatidylethanolamine, dipalmitoylphosphatidylcholine, dioleoylphosphatidylcholine, distearoylphosphatidylcholine, phosphatidyl glycerol, monosialoganlgolioside, spingomyelin, dimyristoylphosphatidylcholine, and dilinoleoy
  • amphipathic lipids Other compounds lacking in phosphorus, such as sphingolipid, glycosphingolipid families, diacylglycerols, and (3-acyloxyacids, are also within the group designated as amphipathic lipids. Additionally, the amphipathic lipid described above can be mixed with other lipids including triglycerides and sterols.
  • anionic lipid refers to any lipid that is negatively charged at physiological pH. These lipids include, but are not limited to, phosphatidylglycerols, cardiolipins, diacylphosphatidylserines, diacylphosphatidic acids, N-dodecanoyl phosphatidylethanolamines, N-succinyl phosphatidylethanolamines, Nglutarylphosphatidylethanolamines, lysylphosphatidylglycerols, palmitoyloleyolphosphatidylglycerol (POPG), and other anionic modifying groups joined to neutral lipids.
  • phosphatidylglycerols cardiolipins
  • diacylphosphatidylserines diacylphosphatidic acids
  • N-dodecanoyl phosphatidylethanolamines N-succinyl phosphatidylethanolamines
  • cationic lipid refers to any of a number of lipid species that carry a net positive charge at a selected pH, such as physiological pH (e.g., pH of about 7.0).
  • cationic lipids include, but are not limited to, N,N-dioleyl-N,N-dimethylammonium chloride (DODAC), dioctadecyldimethylammonium (DODMA), distearyldimethylammonium (DSDMA), N-(l-(2,3-dioleyloxy)propyl)-N,N,N-trimethylammonium chloride (DOTMA), N,N-distearyl- ⁇ , ⁇ -dimethylammonium bromide (DDAB), N-(l-(2,3-dioleoyloxy)propyl)N,N,N- trimethylammonium chloride (DOTAP), 3-(N-(N',N'- dimethylaminoethane) - carbam
  • a viral structural core that may, for example, facilitate disassembly of a capsid or particle formed disclosed viral core proteins after, for example, administering in vivo.
  • mutations are contemplated that may introduce blood protease recognition sequences, e.g., protease recognition sites at hinge and loop regions. Such sequences can be inserted, for example, into the spike region of the HBV C- protein (e.g., replacing amino acids 79 and 80 with these 12 amino acid insertion loops.
  • a viral core protein may include up to about 40, or about 46 such insertion residues and may still, in some embodiments, be capable of forming a particle or capsid.
  • Exemplary blood protease recognition sequences include for example, thrombin (GPGAPGLVP GS; SEQ ID NO: 52) and factor Xa (GPASGPGIEGRA; SEQ ID NO: 53).
  • thrombin GPGAPGLVP GS
  • factor Xa GPASGPGIEGRA
  • contemplated HBV C-proteins from SEQ ID NO: 2 variant that comprise such a blood protease recognition sequence can be represented by:
  • CP 162 comprising a E77C mutation and a thrombin recognition site introduced between amino acids 78 and 79:
  • CP 162 comprising a E77C mutation and a factor Xa recognition site introduced between amino acids 78 and 79:
  • the C- terminal tail of a hepatitis B core protein can be engineered to, for example, provide appropriate properties for binding a nucleic acid and/or protein to the modified viral core protein.
  • a therapeutic chimeric is provided that includes a viral core protein with a modified tail portion and a nucleic acid associated with, e.g., bound to the modified tail portion.
  • the 34 amino C-terminal tail of the wild type HBV-C protein is presumed to hang inside the fully formed viral capsid and bind, e.g., a viral nucleic acid, and is shown below:
  • This wild type tail can be modified, truncated, and/or mutated to provide a modified tail portion, that, together with a structural core portion, provides a viral core protein for use in the assembling a modified HBV viral capsid.
  • a modified tail portion may include a modification that includes one or more poly-lysines.
  • the modified tail portion may include about 4 to about 30 lysines, or about 5 to about 20 lysines, e.g., about 7, 8, 9, or 10 lysines.
  • the modified tail portion may include one or more lysine domains.
  • each poly-lysine domain may comprise about one to about thirty lysine residues.
  • the poly-lysine domain may comprise about 5 lysine residues to about 20 lysine residues.
  • the poly-lysine domains can be separated by about 1 to about 20 amino acid residues.
  • each poly-lysine domain may comprise about 4 lysine residues to about 20 lysine residues (or any specific amino acid length disposed with the range).
  • at least four or at least five consecutive lysine residues are included in a modified C-terminal tail.
  • Poly-lysines and poly-lysine domains and/or a poly-histidine tag may form part of a modified C-terminal tails separately or in combination.
  • a poly-histidine tag may, in some embodiments, facilitate purification of the proteins.
  • Exemplary C-terminal tail portions include those having, e.g., 5 lysines (K5), 7 lysines (K7), 9 lysines (K9), 10 lysines (K10), 11 lysines (Kll), 13 lysines (K13), 20 lysines (K20).
  • C-terminal tail portions include those with a poly-lysine region with nine lysines alternating with a poly-alanine region with nine alanines (KA9), a poly-lysine region with nine lysines alternating with a poly-glycine region with nine glycines (KG9) and a poly-lysine region with nine lysines interrupted by a sequence of at least four amino acids between the fourth and fifth lysines (K4-5).
  • an about four amino acid stretch between the fourth and fifth lysines of the K4-5 tail may be amino acids Ser-Gln-Ser-Pro (SEQ ID NO: 57).
  • a modified tail portion may be represented by:
  • i is an integer from 4 to 21
  • j is an integer from 0 to 10.
  • i may be 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20
  • j may be 0, 1, 2, 3, 4, 5 or more.
  • a modified tail portion may be formed from alternating lysines.
  • a modified tail portion can be represented by:
  • p is an integer from 5 to 12, andj is an integer from 0 to 10.
  • Exemplary CP 149 structural core portions of a HBV core protein with a modified tail portions include:
  • HHH (SEQ IDNO: 66);
  • Exemplary CP 149 structural core portions of a HBV core protein with a capsid assembly mutations (e.g., stabilizing and destabilizing mutations) and/or mutations for chemical attachment sites and a modified tail portion include:
  • poly-lysine tail for each of the foregoing embodiments could be of varying length (e.g., K5, K7, K10, Kll, K13 or K20) or with alternating lysine sequences (e.g., KG and KA), may include a different linker, and may or may not have a histidine tag.
  • a modified tail portion includes one or more poly- arginines.
  • the modified tail portion may include about 4 to about 30 arginines, or about 5 to about 20 arginines, e.g., about 7, 8, 9, or 10 arginines.
  • the modified tail portion may include one or more arginine domains.
  • the poly-arginine domains can be separated by about 1 to about 20 amino acid residues.
  • each poly-arginine domain may comprise about one to about thirty arginine residues.
  • the poly-arginine domain can comprise about 4 arginine residues to about 20 arginine residues (or any specific amino acid length disposed with the range).
  • a modified C-terminal tail includes at least four or at least five consecutive arginine residues.
  • a modified C terminal tail may have mixtures of arginines and lysines, e.g., one or more arginine domains and one or more lysine domains.
  • Poly-arginine domains and/or a poly-histidine tag can be added to the C-terminal tails separately or in combination.
  • a poly-histidine tag may, in some embodiments, facilitate purification of the proteins.
  • Exemplary C-terminal tail portions may include 5 arginines (R5), 7 arginines (R7), 9 arginines (R9), 11 arginines (Rll), 13 arginines (R13), and 20 arginines (R20).
  • modified tail portions that include poly-arginine domains may be represented by:
  • q is an integer from 4 to 21 or more, and j is an integer from 0 to 10.
  • each of the foregoing embodiments describing modified HBV core proteins including truncation mutations, assembly mutations (e.g., stabilizing and/or destabilizing mutations), capsid attachment mutations, disassembly mutations, either singly or in combination can be modified with a poly-lysine tail or a polyarginine tail as described herein.
  • a linker segment may be optionally present between, e.g., a modified structural core portion and a modified tail portion, for example, between the amino acid residue 149 and another modified tail portion domain.
  • the linker segment is about 3 amino acids to about 15 amino acids in length (or any specific amino acid length disposed with the range) and can link, e.g., a modified tail portion including a poly-lysine domain and/or a poly-arginine domain to, e.g., amino acid 149 of the HBV core protein, for example, to provide flexibility to the C-terminal tail.
  • a poly-lysine domain may be followed by a polyhistidine tag and/or followed by an Xhol restriction site.
  • a polyhistidine tag can include at least six histidine residues added to the C-terminal tail.
  • such linker segments may be represented by:
  • r, s and t are each independently, integers from 1 to 6 or more.
  • the modified HBV core protein may include a C-terminal cysteine residue.
  • This cysteine may be included on the C-terminus of a natural or synthetic tail portion and therefore be encapsulated in the assembled cage.
  • the C-terminal cysteine residue may be used for conjugation to a therapeutic agent or for stabilizing a mutation in a tail portion.
  • An exemplary modified HBV core protein including a C-terminal cysteine residue based on a CP162 truncation mutant (based on a SEQ ID NO:2 variant) with E77C and F1811 mutations is as follows:
  • nucleic acid and amino acid sequences of the specific modified viral core proteins e.g., about 75% to about 99% identical, about 80% to about 95% identical, about 85% to about 90% identical, or about 95% to about 99% identical, or any specific percent identity disposed within these ranges, to disclosed viral core proteins is capable of forming a capsid and within the scope of the present invention.
  • the disclosed viral core proteins can be expressed and purified using common molecular biology and biochemistry techniques.
  • recombinant expression vectors can be used which can be engineered to carry a viral core protein gene into a host cell to provide for expression of the viral core protein.
  • Such vectors for example, can be introduced into a host cell by transfection means including, but not limited to, heat shock, calcium phosphate, DEAE- dextran, electroporation or liposome-mediated transfer.
  • Recombinant expression vectors include, but are not limited to, E.
  • coli based expression vectors such as BL21 (DE3) pLysS, COS cell-based expression vectors such as CDM8 or pDC201, or CHO cell -based expression vectors such as pED vectors.
  • a C-protein gene coding region can be linked to one of any number of promoters in an expression vector that can be activated in the chosen cell line.
  • a cassette (capsid gene and promoter) is carried by a vector that contains a selectable marker such that cells receiving the vector can be identified.
  • promoters to express the capsid proteins within a cell line can be drawn from those that are functionally active within the host cell.
  • Such promoters can include, but are not limited to, a T7 promoter, a CMV promoter, a SV40 early promoter, a herpes TK promoter, and others known in recombinant DNA technology.
  • Inducible promoters can be used, and include promoters such as metallothionine promoter (MT), mouse mammary tumor virus promoter (MMTV), and others known to those skilled in the art.
  • Exemplary selectable markers and their attendant selection agents can be drawn, for example, from the group including, but not limited to, ampicillin, kanamycin, aminoglycoside phosphotransferase/G418, hygromycin-B phosphotransferase/hygromycin-B, and amplifiable selection markers such as dihydrofolate reductase/methotrexate and others known to skilled practitioners.
  • a variety of eukaryotic, prokaryotic, insect, plant and yeast expression vector systems e.g., vectors which contain the necessary elements for directing the replication, transcription, and translation of viral core protein coding sequences
  • vectors which contain the necessary elements for directing the replication, transcription, and translation of viral core protein coding sequences can be utilized by those skilled in the art to express viral core protein coding sequences.
  • microorganisms such as bacteria transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing the capsid protein coding sequences; yeast transformed with recombinant yeast expression vectors containing the capsid protein coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing the capsid protein coding sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing the capsid protein coding sequences.
  • microorganisms such as bacteria transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing the capsid protein coding sequences; yeast transformed with recombinant yeast expression vectors containing the capsid protein
  • a therapeutic agent e.g., a drug
  • the drug may be bound to the modified viral core protein by Coulombic forces or covalent bonding. Encapsulation of the drug may occur, in some instances, by conjugating the drug to a region of the viral core protein prior to self-assembly (i.e., when the viral core protein is in an open, locked state prior to assembly) and then triggering self-assembly such that the resultant viral capsid contains the drug.
  • the drug may be bound to the amino acid tail portion of a modified HBV core protein.
  • the drug bound to the amino acid tail portion may be encapsulated following addition of the reducing agent.
  • a drug may be bound to an anionic or cationic polymer added to the assembly solution.
  • Drugs bound to an anionic or cationic polymer maybe encapsulated into the assembled viral capsid based on association of an anionic or cationic polymer with a modified core protein or a modified tail portion.
  • a solution of a drug and non- assembled viral core protein may be combined and self-assembly of the capsid triggered such that some of the drug is encapsulated and some of the drug is not encapsulated by the resultant viral capsids, i.e., the drug may be encapsulated in the capsid structure by diffusion after addition of the triggering agent (e.g., reducing agent).
  • the triggering agent e.g., reducing agent
  • the drug may be added to the solution prior to the addition of a reducing agent.
  • nucleic acid drugs include inhibitory nucleic acids such as a single- stranded or double-stranded RNA, siRNA (small interfering RNA), shRNA (short hairpin RNA), or antisense RNA, or a portion thereof, or an analog or mimetic thereof, that when administered to a mammal results in a decrease (e.g., by 10%, 25%, 50%, 75%, 90%, 95%, or 100%) in the expression of a target.
  • an inhibitory nucleic acid comprises or corresponds to at least a portion of a target nucleic acid or gene, or an ortholog thereof, or comprises at least a portion of the complementary strand of a target nucleic acid or gene.
  • An inhibitory nucleic acid typically has substantial or complete identity or homology (e.g., 60%, 70%, 80%, 85%, 90%, 95%, 99% or 100%) to the target nucleic acid.
  • target refers to a nucleic acid or variants thereof required for expression of a polypeptide that is the site or potential site of therapeutic intervention by a therapeutic agent; or a nonpeptide entity including a microorganism, virus, bacterium, or single cell parasite (wherein the entire genome of a virus may be regarded as a target); and/or a naturally occurring interfering RNA or microRNA or precursor thereof.
  • target may refer to the sequence of nucleotides corresponding to the portion of a gene's coding mRNA.
  • Non-limiting examples of drugs that may be encapsulated in the nanocage include bioactive agents such as cardiovascular drugs, respiratory drugs, sympathomimetic drugs, cholinomimetic drugs, adrenergic or adrenergic neuron blocking drugs, analgesics/antipyretics, anesthetics, antiasthmatics, antibiotics, antidepressants, antidiabetics, antifungals, antihypertensives, anti-inflammatories, antineoplastics, antianxiety agents, immunosuppressive agents, immunomodulatory agents, antimigraine agents, sedatives/hypnotics, antianginal agents, antipsychotics, antimanic agents, antiarrhythmics, antiarthritic agents, antigout agents, anticoagulants, thrombolytic agents, antifibrinolytic agents, hemorheologic agents, antiplatelet agents, anticonvulsants, antiparkinson agents, antihistamines/antipruritics, agents useful for calcium regulation, antibacterials,
  • Non-limiting examples of chemotherapeutic agents include cyclophosphamide, doxorubicin, vincristine, prednisone, busulfan, cisplatin, methotrexate, daunorubicin, melphalan, cladribine, vinblastine, auristatin, bleomycin, calicheamycin, and chlorambucil.
  • Non-limiting examples of enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha- sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • diphtheria A chain nonbinding active fragments of diphtheria toxin
  • exotoxin A chain from Pseudomonas aeruginosa
  • ricin A chain abrin A chain
  • an assembled viral capsid may be formulated into a therapeutic composition using methods well-known in the art.
  • This technology can be applied for delivery of drugs that can be sequestered inside the viral capsid.
  • DNA and RNA can be sequestered inside the capsid and then released at the desired time either free or associated with the appropriate nuclear localization molecules.
  • Applications include cancer therapy, controlled drug release in pain control, marker delivery and anti-inflammatory delivery as well as in vitro gene delivery to cell cultures, and signal or drug delivery to in vitro engineered tissues.
  • Viral capsids may be formulated for delivery including with a pharmaceutically acceptable carrier, or compound.
  • a pharmaceutically acceptable carrier includes solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Supplementary active compounds can also be incorporated into the compositions.
  • a pharmaceutical composition is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (topical), transmucosal, nasal, optical, and rectal administration.
  • Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
  • the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • Oral compositions generally include an inert diluent or an edible carrier.
  • the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules, e.g., gelatin capsules.
  • Oral compositions can also be prepared using a fluid carrier for use as a mouthwash.
  • Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition.
  • the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
  • a binder such as microcrystalline cellulose, gum tragacanth or gelatin
  • an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch
  • a lubricant such as magnesium stearate or Sterotes
  • a glidant such as colloidal silicon dioxide
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor EL.TM. (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
  • the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, other fluids configured to preserve the integrity of the viral capsid, and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, and sodium chloride sometimes are included in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • the compounds are delivered in the form of an aerosol spray from pressured container or dispenser that contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
  • a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
  • Systemic administration can also be by transmucosal or transdermal means, including nasal and optical.
  • penetrants appropriate to the barrier to be permeated are used in the formulation.
  • penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
  • Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
  • the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art. Delivery vehicles can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
  • oral or parenteral compositions are formulated in a dosage unit form for ease of administration and uniformity of dosage.
  • Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • Toxicity and therapeutic efficacy of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD.sub.50 (the dose lethal to 50% of the population) and the ED. sub.50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD.sub.50/ED.sub.50.
  • Molecules which exhibit high therapeutic indices often are utilized. While molecules that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
  • the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
  • the dosage of such molecules often lies within a range of circulating concentrations that include the ED. sub.50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
  • the therapeutically effective dose can be estimated initially from cell culture assays.
  • a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC.sub.50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture.
  • Such information can be used to more accurately determine useful doses in humans.
  • Levels in plasma may be measured, for example, by high performance liquid chromatography.
  • Another example of effective dose determination for an individual is the ability to directly assay levels of "free" and "bound" compound in the serum of the test subject.
  • Such assays may utilize antibody mimics and/or biosensors.
  • Antibody conjugates can be used for modifying a given biological response, the drug moiety delivered via the viral capsid is not to be construed as limited to classical chemical therapeutic agents.
  • the drug moiety may be a protein or polypeptide possessing a desired biological activity.
  • proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a polypeptide such as tumor necrosis factor, .alpha.-interferon, .beta.
  • an antibody can be conjugated to a second antibody to form an antibody heteroconjugate .
  • exemplary doses include milligram or microgram amounts of the compound per kilogram of subject or sample weight, for example, about 1 microgram per kilogram to about 500 milligrams per kilogram, about 100 micrograms per kilogram to about 5 milligrams per kilogram, or about 1 microgram per kilogram to about 50 micrograms per kilogram. It is understood that appropriate doses of a small molecule depend upon the potency of the small molecule with respect to the expression or activity to be modulated, particularly when one delivers the molecule directly to the cell cytosol.
  • a physician, veterinarian, or researcher may, for example, prescribe a relatively low dose at first, subsequently increasing the dose until an appropriate response is obtained.
  • the specific dose level for any particular animal subject will depend upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, gender, and diet of the subject, the time of administration, the route of administration, the rate of excretion, any drug combination, and the degree of expression or activity to be modulated.
  • Nucleic acid molecules can be inserted into viral capsids and used in gene therapy methods for treatment, including without limitation, cancer.
  • Gene therapy capsids can be delivered to a subject by, for example, intravenous injection and local administration.
  • Pharmaceutical preparations of gene therapy capsids can include a gene therapy capsid in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded.
  • compositions can be included in a container, pack, or dispenser together with instructions for administration.
  • Pharmaceutical compositions of active ingredients can be administered by any of the paths described herein for therapeutic and prophylactic methods for treatment. With regard to both prophylactic and therapeutic methods of treatment, such treatments may be specifically tailored or modified, based on knowledge obtained from pharmacogenomic analyses described herein.
  • treatment is defined as the application or administration of a therapeutic agent to a patient, or application or administration of a therapeutic agent to an isolated tissue or cell line from a patient, who has a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
  • a therapeutic agent includes, but is not limited to, small molecules, peptides, antibodies, ribozymes, oligonucleotides, and analgesics.
  • Inhibitory molecules can include, but are not limited to peptides, phosphopeptides, small organic or inorganic molecules, or antibodies (including, for example, polyclonal, monoclonal, humanized, anti-idiotypic, chimeric or single chain antibodies, and FAb, F(ab')2 and FAb expression library fragments, scFV molecules, and epitope-binding fragments thereof).
  • antisense and ribozyme molecules that inhibit expression of the target gene can also be used to reduce the level of target gene expression, thus effectively reducing the level of target gene activity.
  • triple helix molecules can be utilized in reducing the level of target gene activity.
  • antisense, ribozyme, and/or triple helix molecules to reduce or inhibit mutant gene expression can also reduce or inhibit the transcription (triple helix) and/or translation (antisense, ribozyme) of mRNA produced by normal target gene alleles, such that the concentration of normal target gene product present can be lower than is necessary for a normal phenotype.
  • nucleic acid molecules that encode and express target gene polypeptides exhibiting normal target gene activity can be introduced into cells via the viral capsid gene therapy method herein.
  • nucleic acid molecules may be utilized in treating or preventing a disease characterized by aberrant gene expression is through the use of aptamer molecules specific for the defective polypeptide.
  • Aptamers are nucleic acid molecules having a tertiary structure that permits them to specifically bind to polypeptide ligands. Since nucleic acid molecules may in many cases be more conveniently introduced into target cells than therapeutic polypeptide molecules may be, aptamers offer a method by which abnormal polypeptide activity may be specifically decreased without the introduction of drugs or other molecules which may have pluripotent effects.
  • Antibodies can be generated that are both specific for target gene product and that reduce target gene product activity. Such antibodies may, therefore, by administered in instances whereby negative modulatory techniques are appropriate for the treatment of cancer and related disorders.
  • viral capsids can be used to deliver the antibody or a fragment of the Fab region that binds to the target antigen into cells. Where fragments of the antibody are used, the smallest inhibitory fragment that binds to the target antigen often is utilized. For example, peptides having an amino acid sequence corresponding to the Fv region of the antibody can be used.
  • single chain neutralizing antibodies that bind to intracellular target antigens can also be administered. Such single chain antibodies can be administered, for example, by expressing nucleotide sequences encoding single-chain antibodies within the target cell population.
  • E77C His-tagged HBV core protein was cloned into the Ndel/Xhol restriction sites of vector pET21b (Novagen). This plasmid was transformed into E. coli BL21 (DE3) PlysS cells (Stratagene) for protein expression.
  • the nucleic acid and corresponding amino acid sequences of the E77C His-tagged Core protein are depicted below:
  • DNA fragments containing the genes for K5, K7, K9, K10, Kll, K13, K20, KA9, KG9 and K4-5 core protein mutants described previously were synthesized via PCR using the Cassettel template and the primer sequences described in Table 1.
  • Each PCR reaction was composed of 12.5 ⁇ of 5X GC polymerase buffer (Finnzyme), 1.25 ⁇ of a 10 mM dNTP mixture, 1.5 ⁇ of 5 ⁇ forward primer, 1.5 ⁇ of 5 ⁇ reverse primer, 0.6 ⁇ of Stratagene mini-prepped template, 0.8 ⁇ of 2 unit/ ⁇ Phusion Hot Start polymerase (Finnzyme), and 44.25 ⁇ of water.
  • the PCR reaction consisted of a one-time incubation at 98°C for 1 minute, followed by incubation at 98°C for 25 seconds, incubation at 70°C for 30 seconds, and incubation at 72°C for 1 minute and 10 seconds. These last three steps were repeated 24 times followed by a final incubation at 72°C for 7 minutes.
  • the Cassette 1 template consists of the following nucleic acid sequence inserted into the Ndel/Xhol restriction sites of vector pET22b: ATGGATATCGATCCGTATAAAGAATTTGGCGCCACCGTGGAACTGCTGAGCTTTCTGCCGAGC GATTTCTTTCCGAGCGTGCGTGATCTGCTGGATACCGCGAGCGCGCTGTATCGCGAAGCGCTG GAAAGCCCGGAACATTGTAGCCCGCACCATACCGCCCTGCGTCAGGCGATTCTGTGCTGGGGT GAACTGATGACCCTGGCGACCTGGGTTGGCAACAACCTGTGCGATCCGGCGAGCCGCGATCT GGTTGTGAACTATGTGAATACCAACATGGGCCTGAAAATTCGTCTGCTGCTGTGGTTTCATAT CAGCTGCCTGACCTTTGGCCGCGAAACCGTGCTGGAATATCTGGTTTCATAT CAGCTGCCTGACCTTTGGCCGCGAAACCGTGCTGGAATATCTGGTTTCATAT CAGCTGCCTGACCTTTGGCCGCGAAACCGTGCTGGA
  • GTGAGCGG (SEQ ID NO: 90) GACGACGCGGGCTCGGGGT (SEQ ID NO: 90)
  • the PCR products and a pET22b vector were both digested with restriction enzymes Ndel and Xhol at 37°C for 2 hours.
  • the digested products were run on an agarose gel and the bands were excised and purified via gel extraction (Stratagene).
  • Ligation reactions were composed of 5 ⁇ of digested and purified PCR product, 1 ⁇ of digested and purified pET22b vector, 1 ⁇ of T4 DNA ligase buffer (NEB), 1 ⁇ of T4 DNA ligase (NEB), and 2 ⁇ of water and were incubated at room temperature for 12 hours.
  • the ligation reactions were transformed into XLI Blue E. coli cells (Stratagene) and the resulting colonies were grown in IX LB broth.
  • the plasmids were purified via miniprep (Stratagene).
  • the purified plasmids were sequenced (see below) and transformed into E. coli BL21 (DE3) PlysS cells (Stratagene) for protein expression. This strategy can be used for proteins containing from 0 to 30 lysine residues.
  • DNA fragments containing point mutations of the K9 construct were synthesized via PCR using the K9 template (or in the case of double or triple mutants, the appropriate single or double mutant K9 template) and the primer sequences described in Table 2.
  • Each PCR reaction consisted of 5 ⁇ of 10X Pfu Turbo polymerase buffer (Stratagene), 1 ⁇ of a 10 mM dNTP mixture, 1.5 ⁇ of 5 ⁇ forward primer, 1.5 ⁇ of 5 ⁇ reverse primer, 1 ⁇ of Stratagene mini- prepped template, 1 ⁇ of 2.5 unit/ ⁇ Pfu Turbo polymerase (Stratagene), and 39 ⁇ of water.
  • the PCR reaction consisted of a one-time incubation at 98 °C for 1 minute, followed by incubation at 98°C for 30 seconds, incubation at 64-72°C (depending on primer Tm) for 1 minute, and incubation at 72°C for 6 minutes. These last three steps were repeated 20 times.
  • the K9 template consists of the following nucleic acid sequence inserted into the Ndel/Xhol restriction sites of vector pET22b:
  • the PCR products were digested with the restriction enzyme Dpnl at 37°C for 1.5 hours to eliminate any un- mutated template.
  • the digested products were run on a 1% agarose gel and the bands were excised and purified via gel extraction (Stratagene).
  • the PCR products were then transformed into E. coli BL21 (DE3) PlysS cells (Stratagene) and the resulting colonies were grown in IX LB broth and the plasmid purified via mini-prep (Stratagene). The purified plasmids were then sequenced to confirm the change in nucleic acid sequence. This strategy can be applied to single amino acid changes or the deletion or insertion of multiple amino acid residues such as the removal of a poly-histidine tag (primers shown in Table 3). Table 3
  • Protocol 1 Various wild type and modified core proteins described herein were expressed and purified according to Protocol 1 or Protocol 2 as follows:
  • Protocol 1 A pET-lla vector containing the full-length HBV C-protein gene was transformed into E. coli DE3 cells and grown at 37°C in LB media that was fortified with 2-4% glucose, trace elements and 200 ⁇ g/mL of carbenicillin. Protein expression was induced by the addition of 2mM IPTG (isopropyl-beta-D-thiogalactopyranoside). Cells were harvested by pelleting after three hours of induction. SDS-PAGE was used to assess expression of Cprotein.
  • IPTG isopropyl-beta-D-thiogalactopyranoside
  • Core protein was purified from E. coli by resuspending in a solution of 50 mM Tris-HCI, pH 7.4, ImM EDTA, 5 mM DTT, ImM AEBSF, O.lmg/mL DNasel and 0.1 mg/mL RNase. Cells were then lysed by passage through a French pressure cell. The suspension was centrifuged at 26,000xG for one hour. The pellet was discarded and solid sucrose was added to the supernatant to a final concentration of 0.15 M and centrifuged at 100,000xG for one hour. The pellet was discarded and solid (NH4)2S04 was then added to reach a final concentration of 40% saturation.
  • the mixture was stirred for one hour and then centrifuged for one hour at 26,000xG.
  • the pellet was resuspended in a solution of 100 mM Tris-HCI at pH 7.5, 100 mM NaCl, 50 mM sucrose and 2 mM DTT (Buffer A) and loaded onto a Sepharose CL-4B (Phannacia Biotech, Piscataway, NJ) column (5 cm diameter X 95 cm) equilibrated with Buffer A.
  • the column was eluted at 2mL/minute.
  • HBV viral capsids were separated from large aggregates and from soluble proteins of lower molecular weight. The fractions were pooled according to chromatographic profile and SDS-PAGE analysis.
  • the solution was concentrated by ultrafiltration using Diaflo YM 100 ultrafitration membrane (Amicon, Beverly, MA) to about 10 mg/mL. Concentrated C-protein was dialyzed against 50 mM Tris-HCI, pH 7.5 and 0.15 M sucrose. The solution was then adjusted to pH 9.5 by adding 10N NaOH and urea to reach a final concentration of 3.5 M.
  • the solution was then filtered using a Millex-HA 0.45 ⁇ pore size filter unit (Millipore, Bedford, MA) and applied to a column (6.0 cm diameter X 60 cm) of Superdex 75 (Pharmacia Biotech, Piscataway, NJ) equilibrated with a solution consisting of 100 mM sodium bicarbonate, pH 9.5, and 2 mM DTT.
  • the column was eluted at 5 mL/minute.
  • the fractions containing dimeric protein as assessed by SDS-PAGE were pooled.
  • Protocol 2 All protein constructs containing a C-terminal 6-histidine tag were purified as follows.
  • the pET vector containing the gene for K9 protein was kept in BL21 (DE3) PlysS cells for expression.
  • the starter culture was inoculated from a colony on a IX Luria Broth (1XLB) agar plate or from a 10% glycerol stock, stored at -80°C.
  • the 1XLB was autoclaved in a 2 L flask and cooled. 100 mg of ampicillin (Amp) was added to the 1XLB.
  • a starter culture was inoculated and allowed to grow at 37°C for up to 24 hours with shaking at 200 rpm.
  • resuspension buffer 5 M urea, 50 mM NaHC03 (pH 9.5), 10 mM imidazole
  • the cells were suspended by continuous pipetting and poured into a 400 mL beaker. More resuspension buffer was added until there is - 100 mL total cell resuspension in the beaker.
  • the beaker containing resuspended cells were placed in an ice bath and sonicated for 5 minutes using a Branson probe sonifier (pulse mode at approximately 40% duty cycling and power setting of 5).
  • the cell mixture was sonicated in several intervals and allowed to rest on ice if it appeared that the sample was heated to higher than room temperature.
  • the cell lysate was diluted 2 fold to 200 mL total, and 200 ⁇ L ⁇ of 100 mg/mL DNase was added to the suspension. This suspension was stirred on ice for 10 minutes. The sonication step was repeated for 5 more minutes while on ice. The lysate was transferred to six 50 mL plastic centrifuge tubes, and centrifuged at 32,000xg for 45 minutes. Supernatant was discarded.
  • a 50 mL Ni2+-NTA agarose (Qiagen) column was washed and equilibrated in the resuspension buffer. 12 L of cells was lysed for each run of the column. The centrifuged lysate from 12 L of cells was combined and diluted to 500 mL with resuspension buffer. The centrifuged cell lysate was loaded onto the column, and the protein solution was allowed to sink to the top of the nickel matrix. 50 mL of resuspension buffer was passed through the column.
  • An optional salt wash can be performed by washing the column with 250 mL of NaCl wash buffer (5 M urea, 50 mM NaHC03 (pH 9.5), 20 mM imidazole, 250 mM NaCl).
  • This salt wash reduces the A260/A280 ratio of the final purified protein by a value of 0.1 A.U.
  • the column was washed with 250 mL of wash buffer (5 M Urea, 50 mM NaHC03 (pH 9.5), 20 mM imidazole). Subsequently, 200 mL of elution buffer (5 M Urea, 2 mM NaHC03 (pH 9.5), 250 mM imidazole) was passed through the column. Fractions were collected at every 5 mL, and of these, which 5 to 8 fractions contained protein.
  • the presence and/or concentration of protein was detected by measuring the absorbance of the fractions.
  • SDS polyacrylamide gel electrophoresis (SDS PAGE) analysis was performed on the proteins to determine purity. Fractions containing protein were pooled, and transferred to dialysis tubing. Dialysis was performed in 4 L of storage buffer (5 M Urea, 1 mM EDTA, 2 mM NaHC03 (pH 9.5)) for at least 4 hours at 4°C. The protein was then concentrated in an Amicon stirred cell concentrator (Millipore) to a final protein concentration of up to 75 mg/ml. A 12 L cell growth yielded approximately 500 mg of pure protein. Pure dialyzed protein was stored at - 80°C for 6-8 months.
  • modified HBV core proteins were self-assembled into capsid structures following addition of a reducing agent to a solution containing the modified HBV core protein and a denaturing agent with no dilution step to reduce the amount of denaturing agent in the solution.
  • modified HBV core proteins were self-assembled into capsid structures following addition of a reducing agent to a solution containing the modified HBV core protein and a denaturing agent with a dilution step to reduce the concentration of denaturing agent.
  • modified HBV core proteins were self- assembled into capsid structures following dilution of the denaturing agent in a solution containing the modified HBV core protein without the addition of a reducing agent.
  • HBV core protein mutants that are capable of forming strong cages in the presence of reducing agent are assembled into capsids using protocol 1 whereas mutants that form weaker cages, e.g., because there is mutation at the dimer-dimer interface, are assembled into capsids using protocols 2 and 3.
  • Protocol 1 Methods of Self- Assembly of Viral Capsids by Exposure to Reducing Agents
  • Modified HBV core protein stored in a protein storage buffer between 4M and 6M urea was thawed for 30 minutes at room temperature.
  • SiRNA stored at -20 degrees C was also thawed for 30 minutes.
  • 32 mg of modified HBV core protein was measured and siRNA was added to the protein at a ratio of 0.1 siRNA per core protein monomer and allowed to bind for 60 minutes.
  • Ten molar equivalents of 13-mercaptoethanol was added to the siRNA-protein solution and allowed to reduce for fifteen minutes and form capsid structures. An additional ten molar equivalents of 13-mercaptoethanol was added to the solution and allowed to equilibrate for at least twelve hours.
  • the solution containing assembled capsid structures was filtered with a 0.2 micron polyethersulfone syringe filter (Nalgene 25 mm disc).
  • Assembled capsid structures were purified on an Akta Purification System using a stationary phase Sepharose CL-6B (16 x 300mm) column with a mobile phase of DSB2 buffer (1M urea, 25 mM glycine, 20 mM NaCl, 1 mM EDTA, pH 9.5).
  • DSB2 buffer (1M urea, 25 mM glycine, 20 mM NaCl, 1 mM EDTA, pH 9.5).
  • Fractions were collected and pooled using elutions between 20-32 mL. Pooled fractions were filtered with a 0.2 micron polyethersulfone syringe filter (Nalgene 25 mm disc).
  • Protocol 1 was used to assemble capsid structures with modified HBV core proteins including: modified HBV core protein (CP183) with an E77C mutation; CP149 proteins (based on a SEQ ID NO: 2 variant) with an E77C mutation and a poly-lysine tail including a K5 (SEQ ID NO: 60), K7 (SEQ ID NO: 61), K9 (SEQ ID NO: 62), K10 (SEQ ID NO: 63), Kll (SEQ ID NO: 64), K13 (SEQ ID NO: 65), K20 (SEQ ID NO: 66), K4-5 (SEQ ID NO: 67), KA9 (SEQ ID NO: 68) or KG9 (SEQ ID NO: 69) tail; CP149 protein (based on a SEQ ID NO: 2 variant) with mutations at E77C, S121C and S141C with a K9 tail portion (SEQ ID NO: 77); CP149 protein (based on a SEQ ID NO: 2 variant) with mutations at E77C
  • CP162 protein (based on SEQ ID NO: 2 variant) with mutations at E77C and F12211: MDIDPYKEFG ATVELLSFLP SDFFPSVRDL LDTASALYRE ALESPEHCSP HHTALRQAIL CWGELMTLAT WVGNNLCDPA SRDLVVNYVN TNMGLKIRQL LWFHISCLTF GRETVLEYLV SHGVWIRTPP AYRPPNAPIL STLPETTVVR RRGRSPRRRT PSLEHHHHHH (SEQ ID NO: 139); and
  • CP162 protein (based on SEQ ID NO: 2 variant) with mutations at E77C and E1411: MDIDPYKEFG ATVHLLSFLP SDFFPSVRDL LDTASALYRE ALESPEHCSP HHTALRQAIL CWGELMTLAT WVGNNLCDPA SRDLVVNYVN TNMGLKIRQL LWFHISCLTF GRETVLEYLV SFGVWIRTPP AYRPPNAPIL STLPETTVVR RRGRSPRRRT PSLEHHHHHH (SEQ ID NO: 140). Protocol 2: Methods of Self- Assembly of Viral Capsids by Exposure to Reducing Agents and Dilution of Denaturants
  • Modified HBV core protein stored in a protein storage buffer between 4M and 6M urea was thawed for 30 minutes at room temperature.
  • SiRNA stored at -20 degrees C was also thawed for 30 minutes.
  • 32 mg of modified HBV core protein was measured and siRNA was added to the protein at a ratio of 0.1 siRNA per protein monomer and allowed to bind for 60 minutes.
  • Ten molar equivalents of 13-mercaptoethanol was added to the siRNA-protein solution and allowed to reduce for fifteen minutes and form capsid structures.
  • DSB2 buffer (1M urea, 25 mM glycine, 20 mM NaCl, 1 mM EDTA, pH 9.5) was then added to the solution and allowed to equilibrate for fifteen minutes.
  • IX TAE buffer 40 mM TRIS acetate, 1 mM EDTA, pH 8.8 was added to the solution followed by a fifteen minute equilibration.
  • 0.5X PBS pH 9.5 was added to the solution followed by a fifteen minute equilibration.
  • the final concentration of urea was 1.25 M.
  • An additional ten molar equivalents of 13- mercaptoethanol was added to the solution and allowed to equilibrate for at least twelve hours.
  • the solution containing assembled capsid structures was filtered with a 0.2 micron polyethersulfone syringe filter (Nalgene 25 mm disc).
  • Assembled capsid structures were purified on an Akta Purification System using a stationary phase Sepharose CL-6B (16 x 300mm) column with a mobile phase of DSB2 buffer. Fractions were collected and pooled using elutions between 20-32 mL. Pooled fractions were filtered with a 0.2 micron polyethersulfone syringe filter (Nalgene 25 mm disc). Some assembled capsid structures were then subject to surface functionalization.
  • Protocol 2 was used to assemble capsid structures with modified HBV core proteins including: CP149 protein (based on a SEQ ID NO:2 variant) with mutations at E77C and F18H with a K9 tail portion (SEQ ID NO: 70); CP149 protein (based on a SEQ ID NO:2 variant) with mutations at E77C and Y132F with a K9 tail portion (SEQ ID NO: 137); CP149 protein (based on a SEQ ID NO:2 variant) with mutations at E77C and Y132I with a K9 tail portion (SEQ ID NO: 136); CP149 protein (based on a SEQ ID NO:2 variant) with mutations at E77C and Y132V with a K9 tail portion (SEQ ID NO: 72); CP149 protein (based on a SEQ ID NO:2 variant) with mutations at E77C, F18H, S 121C and S 141C with a K9 tail portion (SEQ ID NO: 79).
  • Protocol 2 was also used to assemble the following HBV core proteins:
  • CP162 protein (based on a SEQ ID NO: 2 variant) with E77C and F18H mutations
  • CP162 protein (based on a SEQ ID NO: 2 variant) with E77C and Yl 18H mutations MDIDPYKEFG ATVELLSFLP SDFFPSVRDL LDTASALYRE ALESPEHCSP HHTALRQAIL
  • CP162 protein (based on a SEQ ID NO: 2 variant) with E77C and L3711 mutations
  • CP162 protein (based on a SEQ ID NO: 2 variant) with E77C, C171 and F1811 mutations
  • CP162 protein (based on a SEQ ID NO: 2 variant) with E77C, C171 and A137H mutations
  • Protocol 3 Methods of Self- Assembly of Viral Capsids by Dilution of Denaturants Modified HBV core protein stored in a protein storage buffer between 4M and 6M urea was thawed for 30 minutes at room temperature. SiRNA stored at -20 degrees C was also thawed for 30 minutes. 32 mg of modified HBV core protein was measured and siRNA was added to the protein at a ratio of 0.1 siRNA per protein monomer and allowed to bind for 60 minutes. One ml of DSB2 buffer (1M urea, 25 mM glycine, 20 mM NaCl, 1 mM EDTA, pH 9.5) was added to the siRNA-protein solution and allowed to equilibrate for fifteen minutes and form capsid structures.
  • DSB2 buffer (1M urea, 25 mM glycine, 20 mM NaCl, 1 mM EDTA, pH 9.5
  • the solution containing assembled capsid structures was filtered with a 0.2 micron polyethersulfone syringe filter (Nalgene 25 mm disc).
  • Assembled capsid structures were purified on an Akta Purification System using a stationary phase Sepharose CL-6B (16 x 300mm) column with a mobile phase of DSB2 buffer. Fractions were collected and pooled using elutions between 20-32 mL. Pooled fractions were filtered with a 0.2 micron polyethersulfone syringe filter (Nalgene 25 mm disc). Some assembled capsid structures were then subject to surface functionalization.
  • Protocol 3 was used to assemble capsid structures with modified HBV core proteins including: CP149 protein (based on a SEQ ID NO: 2 variant) with a E77K mutation and a K9 tail (SEQ ID NO: 81).
  • This example measures the radius of viral capsid structures assembled using protocols 1- 3 described in Example 3 by Dynamic Light Scattering (DLS).
  • DLS Dynamic Light Scattering
  • FIG. 2 shows a dynamic light scattering (DLS) plot of particle radius as a function of time following addition of 10 molar equivalents of BME to the protein (modified HBV core protein CP149 with a E77C mutation and a K9 tail (SEQ ID NO: 62)) and inhibitory dsRNA solution as described in Protocol 1 in Example 3.
  • the data show that cage formation is dependent on the presence of BME, as indicated by the change in particle size.
  • FIG. 3 shows a DLS plot of particle radius (nm) (right vertical axis, darker data points) and signal intensity (CPS) (left vertical axis, lighter data points) as a function of time following the addition of BME to the protein (modified HBV core protein CP 162 with a E77C mutation (SEQ ID NO: 138)) and inhibitory dsRNA (20 siRN A/cage) solution as described in Protocol 1 in Example 3. Capsid assembly was observed between 100-150 minutes as indicated by a shift in particle radius to approximately 15-20 nm.
  • CPS signal intensity
  • FIG. 4 shows a DLS plot of particle radius (nm) (right vertical axis, darker data points) and signal intensity (CPS) (left vertical axis, lighter data points) as a function of time following the addition of 10 Molar equivalents of BME to the protein (modified HBV core protein CP149 with E77C, C48A, C61A, and C107A mutations (SEQ ID NO: 75)) and inhibitory dsRNA solution as described in Protocol 1 in Example 3.
  • the inhibitory dsRNA (0.1 equivalents) was added to the solution, which had a urea concentration of 2.5 M.
  • B Capsid assembly was observed between 3000-4000 seconds following the addition of BME as indicated by the shift in particle radius to approximately 20 nm.
  • C Lowering the urea concentration to 1.25 M with 0.5X PBS at pH 9.5 promoted the additional formation of capsids, but was not required to form capsids.
  • FIG. 5 shows a DLS plot of particle radius (nm) (right vertical axis, darker data points) and signal intensity (CPS) (left vertical axis, lighter data points) as a function of time following the addition of 10 Molar equivalents of BME to the protein (modified HBV core protein CP149 with E77C and F1811 mutations with a K9 tail (SEQ ID NO: 70)) and inhibitory dsRNA solution as described in Protocol 2 in Example 3.
  • the inhibitory dsRNA (0.1 equivalents) was added to the solution, which had a urea concentration of 2.5 M.
  • B 10 Molar equivalents of BME were added.
  • Capsid assembly was observed second following the dilution of urea to 1.25 M with 0.5X PBS pH 9.5 as indicated by the shift in particle radius to approximately 15-20 nm.
  • FIG. 6 shows a DLS plot of particle radius (nm) (right vertical axis, darker data points) and signal intensity (CPS) (left vertical axis, lighter data points) as a function of time following the addition of 10 Molar equivalents of BME to the protein (modified HBV core protein CP149 with E77C and Y132F mutations with a K9 tail (SEQ ID NO: 137)) and inhibitory dsRNA solution as described in Protocol 2 in Example 3.
  • the inhibitory dsRNA (0.1 equivalents) was added to the solution, which had a urea concentration of 2.5 M.
  • B 10 Molar equivalents of BME were added.
  • Capsid assembly was observed following the dilution of urea to 1.25 M with 0.5X PBS pH 9.5 as indicated by the shift in particle radius to approximately 15-20 nm.
  • FIG. 7 shows a DLS plot of particle radius (nm) (right vertical axis, darker data points) and signal intensity (CPS) (left vertical axis, lighter data points) as a function of time following the addition of 10 Molar equivalents of BME to the protein (modified HBV core protein CP162 with E77C and Y132F mutations (SEQ ID NO: 142)) and inhibitory dsRNA solution as described in Protocol 2 in Example 3.
  • the inhibitory dsRNA (0.1 equivalents) was added and the solution diluted to a urea concentration of 2.5 M (step 2).
  • 10 Molar equivalents of BME was added (step 3). Capsid assembly was observed second following the dilution of urea to 1.25 M with 0.5X PBS pH 9.5 as indicated by the shift in particle radius to approximately 15-20 nm (steps 4-6).
  • FIG. 8 shows a DLS plot of particle radius (nm) (right vertical axis, darker data points) and signal intensity (CPS) (left vertical axis, lighter data points) as a function of time following addition of each cage-forming reaction component to the protein solution being monitored.
  • CPS signal intensity
  • reaction components were sequentially added to the cuvette and both size and intensity were measured between each addition: 3.75 ⁇ L ⁇ heparin (lOOmg/mL stock) (B); 100 ⁇ L ⁇ DSB2 buffer (1M urea, 25 mM glycine, 20 mM NaCl, 1 mM EDTA, pH 9.5) (C); ⁇ 0.5X PBS, pH 9.5 (D) and 100 ⁇ L ⁇ IX PBS, pH 7.4 (E). Particle radius measurements were consistent with the formation of HBV capsids. Well-formed cages were first detected after the addition of the first PBS containing system. These data suggest formation of these E77K/K9 nanocages is dependent upon the dilution of urea.
  • FIG. 9 shows a DLS plot of particle radius (right vertical axis, darker data points) and signal intensity (left vertical axis, lighter data points) as a function of time following addition of each cage-forming reaction component to the protein solution in the absence of a negatively charged polymer.
  • Modified HBV core protein, CP149 with a E77C mutation was used in this experiment:
  • modified HBV core protein CP149 with a E77C mutation (38.4 mg/mL stock), stored at -80 deg C in protein storage buffer which contains 6M urea, was thawed for 30 minutes and 100 ⁇ placed in a cuvvette.
  • reaction components were sequentially added to the cuvette and both size and intensity were measured between each addition: dH20 (to replace the volume of polymer) (B); 10 M equivalents of BME (C); 100 ⁇ DSB2 buffer (1M urea, 25 mM glycine, 20 mM NaCl, 1 mM EDTA, pH 9.5) (D); ⁇ 0.5X PBS, pH 9.5 (E); and ⁇ 0.5X PBS, pH 7.4 (100 ⁇ was added 5 times after an equilibration step following each addition) (F-J). Particle radius measurements were consistent with the formation of HBV capsids. Well- formed cages were first detected after the addition of the third addition of PBS to the assembly reaction (see step H). These data suggest CP 149 form cage in the absence of a negatively charge polymer.
  • Table 4 shows the data obtained for a modified HBV core during the assembly process (e.g., CP149 with a E77C mutation and a K9 tail, which was subsequently lipid coated after cage formation).
  • This example measures the rate of capsid formation under various reducing conditions.
  • the rate of capsid formation can be controlled based on the amount of reducing agent added to the modified HBV protein solution.
  • Modified HBV protein dimers are maintained in an open or locked state in the presence of a denaturing solution.
  • increasing concentrations of 13-mercaptoethanol (BME) were added to the siRNAprotein solution (i.e., 4X, 10X, and 40X BME).
  • BME 13-mercaptoethanol
  • the rate of capsid formation was measured using dynamic light scattering where the radius of the capsid was measured over time. The data show that the rate of cage formation is dependent upon the concentration of BME in the solution.
  • 4X BME assembled capsids formed at a t ⁇ of 42.9 minutes; at 10X BME, at a ⁇ /2 of 2.5 minutes; and at 40X BME, ⁇ 2 of 1.6 minutes.
  • Table 5 Table 5
  • modified HBV core proteins e.g., CP149 with E77C, C48A, C61A, and C107A mutations with a K9 tail (SEQ ID NO: 75) formed capsids faster than modified HBV core proteins with a E77C mutation and a K9 tail (SEQ ID NO: 62). Both modified HBV core proteins were based on a SEQ ID NO: 2 variant.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Virology (AREA)
  • Analytical Chemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Physics & Mathematics (AREA)
  • Optics & Photonics (AREA)
  • Nanotechnology (AREA)
  • Zoology (AREA)
  • Botany (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Rheumatology (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Cardiology (AREA)
  • Pain & Pain Management (AREA)
  • Heart & Thoracic Surgery (AREA)
PCT/US2012/054534 2011-09-09 2012-09-10 Methods and compositions for controlling assembly of viral proteins Ceased WO2013036973A2 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
AU2012305714A AU2012305714A1 (en) 2011-09-09 2012-09-10 Methods and compositions for controlling assembly of viral proteins
CA2847888A CA2847888A1 (en) 2011-09-09 2012-09-10 Methods and compositions for controlling assembly of viral proteins
JP2014529962A JP2014527072A (ja) 2011-09-09 2012-09-10 ウイルスタンパク質の集合を制御するための方法および組成物
EP12829920.3A EP2747774A4 (en) 2011-09-09 2012-09-10 METHOD AND COMPOSITIONS FOR CONTROLLING VIRUS PROTECTION

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161532986P 2011-09-09 2011-09-09
US61/532,986 2011-09-09

Publications (2)

Publication Number Publication Date
WO2013036973A2 true WO2013036973A2 (en) 2013-03-14
WO2013036973A3 WO2013036973A3 (en) 2013-07-11

Family

ID=47832822

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2012/054534 Ceased WO2013036973A2 (en) 2011-09-09 2012-09-10 Methods and compositions for controlling assembly of viral proteins

Country Status (6)

Country Link
US (2) US8865188B2 (https=)
EP (1) EP2747774A4 (https=)
JP (1) JP2014527072A (https=)
AU (1) AU2012305714A1 (https=)
CA (1) CA2847888A1 (https=)
WO (1) WO2013036973A2 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN106279379A (zh) * 2016-09-13 2017-01-04 华兰生物工程股份有限公司 一种免疫原HM4‑M2e及其制备方法与应用
CN107488217A (zh) * 2017-09-13 2017-12-19 华兰生物疫苗有限公司 一种多肽、免疫原性偶联物和流感疫苗
CN108064230A (zh) * 2015-04-22 2018-05-22 Ucb生物制药私人有限公司 使重组抗体分子单体化的方法
WO2021163538A1 (en) * 2020-02-13 2021-08-19 The Trustees Of Indiana University Hepadnavirus capsid protein heterodimers and virus-like particles
US11116837B2 (en) * 2016-11-22 2021-09-14 National Taiwan University Vaccine composition comprising hepatitis B virus like particle as adjuvant
US20210332089A1 (en) * 2018-10-12 2021-10-28 Riken Hepatitis b virus replication inhibitor and pharmaceutical composition for treating hepatitis b comprising the same
WO2024018188A1 (en) * 2022-07-18 2024-01-25 University Of Dundee Virus-like particles, heterodimeric capsid proteins and methods of production thereof

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010120874A2 (en) 2009-04-14 2010-10-21 Chimeros, Inc. Chimeric therapeutics, compositions, and methods for using same
CA2847888A1 (en) 2011-09-09 2013-03-14 Biomed Realty, L.P. Methods and compositions for controlling assembly of viral proteins
CA2936092A1 (en) * 2013-01-23 2014-07-31 The Board Of Trustees Of The Leland Stanford Junior University Stabilized hepatitis b core polypeptide
GB201716254D0 (en) * 2017-10-05 2017-11-22 Univ Leuven Kath Live-attenuated flaviruses with heterologous antigens
CN113508125A (zh) * 2018-12-28 2021-10-15 小利兰·斯坦福大学托管委员会 工程化乙型肝炎核心多肽
CN110125434B (zh) * 2019-05-14 2022-07-29 东南大学 一种光热金纳米材料的制备方法

Family Cites Families (89)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816564A (en) 1986-01-31 1989-03-28 Merck & Co., Inc. Method for producing hepatitis B virus proteins in yeast
IL90161A0 (en) 1988-05-13 1989-12-15 Phillips Petroleum Co Expression of hepatitis b s and pres2 proteins in methylotrophic yeasts
US5620689A (en) 1989-10-20 1997-04-15 Sequus Pharmaceuuticals, Inc. Liposomes for treatment of B-cell and T-cell disorders
EP0652967B1 (en) 1990-08-15 1998-02-04 Therion Biologics Corporation Self-assembling replication defective hybrid virus particles
WO1993000103A1 (en) 1991-06-21 1993-01-07 The Wistar Institute Of Anatomy And Biology Chimeric envelope proteins for viral targeting
NZ262679A (en) 1993-02-22 1997-08-22 Vivorx Pharmaceuticals Inc Compositions for in vivo delivery of pharmaceutical agents where the agents are contained in a polymeric shell
US6753006B1 (en) 1993-02-22 2004-06-22 American Bioscience, Inc. Paclitaxel-containing formulations
US6749868B1 (en) 1993-02-22 2004-06-15 American Bioscience, Inc. Protein stabilized pharmacologically active agents, methods for the preparation thereof and methods for the use thereof
US6096331A (en) 1993-02-22 2000-08-01 Vivorx Pharmaceuticals, Inc. Methods and compositions useful for administration of chemotherapeutic agents
US6537579B1 (en) 1993-02-22 2003-03-25 American Bioscience, Inc. Compositions and methods for administration of pharmacologically active compounds
US5439686A (en) 1993-02-22 1995-08-08 Vivorx Pharmaceuticals, Inc. Methods for in vivo delivery of substantially water insoluble pharmacologically active agents and compositions useful therefor
EP0804249A2 (en) 1994-03-15 1997-11-05 Brown University Research Foundation Polymeric gene delivery system
WO1995032706A1 (en) 1994-05-31 1995-12-07 Inex Pharmaceuticals Corp. Virosome-mediated intracellular delivery of therapeutic agents
US6204059B1 (en) 1994-06-30 2001-03-20 University Of Pittsburgh AAV capsid vehicles for molecular transfer
US6613749B1 (en) 1994-07-26 2003-09-02 Imperial College Innovations Limited Papovavirus pseudocapsids and use thereof for exogenous material transfer
US5846782A (en) 1995-11-28 1998-12-08 Genvec, Inc. Targeting adenovirus with use of constrained peptide motifs
US7422902B1 (en) 1995-06-07 2008-09-09 The University Of British Columbia Lipid-nucleic acid particles prepared via a hydrophobic lipid-nucleic acid complex intermediate and use for gene transfer
IL160406A0 (en) 1995-06-15 2004-07-25 Crucell Holland Bv A cell harbouring nucleic acid encoding adenoritus e1a and e1b gene products
EE9800160A (et) 1995-11-28 1998-12-15 Genvec, Inc. Vektorid ja meetodid geenide ülekandmiseks rakkudesse
US6284494B1 (en) 1995-12-12 2001-09-04 The University Of British Columbia Methods and compositions for synthesis of oligosaccharides using mutant glycosidase enzymes
US6063370A (en) 1996-04-05 2000-05-16 The Board Of Trustees Of The University Of Illinois Macromolecular complexes for drug delivery
FR2749323B1 (fr) 1996-06-04 1998-07-10 Pasteur Merieux Serums Vacc Pseudo-particules virales utiles en tant que vecteur de delivrance d'acide nucleique
US5980901A (en) 1996-09-18 1999-11-09 The Board Of Regents Of The University Of Texas System Viral defective interfering particles and uses thereof
CA2269097C (en) 1996-11-08 2007-01-09 The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Synthesis and purification of hepatitis c virus-like particles
US6180389B1 (en) 1997-01-03 2001-01-30 The Research And Development Institute, Inc. Virion-constrained nanoparticles comprising a plant virion coat protein shell and encapsulated guest molecules
US6506559B1 (en) 1997-12-23 2003-01-14 Carnegie Institute Of Washington Genetic inhibition by double-stranded RNA
US6287857B1 (en) 1998-02-09 2001-09-11 Genzyme Corporation Nucleic acid delivery vehicles
AU2662999A (en) 1998-02-09 1999-08-23 Genzyme Corporation Nucleic acid delivery vehicles
CZ302092B6 (cs) 1998-02-12 2010-10-06 Immune Complex, Corporation Konjugát upraveného jaderného proteinu hepatitidy B, jeho cástice, inokulum a zpusob indukce protilátek
KR100651113B1 (ko) 1998-08-05 2006-11-30 소니 가부시끼 가이샤 전해질용 조성물, 전해질 및 그의 제조 방법 및 그것을이용한 전지
WO2000009158A1 (en) 1998-08-12 2000-02-24 University Of Virginia Patent Foundation Assay for assembly of herpes simplex virus capsid
US6759237B1 (en) 1998-11-05 2004-07-06 The Trustees Of The University Of Pennsylvania Adeno-associated virus serotype 1 nucleic acid sequences, vectors and host cells containing same
EP1845163A3 (en) 1998-11-05 2007-10-31 The Trustees Of The University Of Pennsylvania Adeno-associated virus serotype l nucleic acid sequences, vetors and host cells containing same
TR200102423T2 (tr) 1998-12-04 2002-02-21 Biogen, Inc. Peptid ligandları yoluyla bağlı birden fazla imünojenik bileşeni olan HBV çekirdek antijeni parçacıkları
US6710173B1 (en) 1999-06-25 2004-03-23 Progenics Pharmaceuticals, Inc. Stabilized viral envelope proteins and uses thereof
WO2001002551A2 (en) 1999-06-30 2001-01-11 Evotec Oai Ag Virus like particles, preparation and use in screening and functional genomics
US20020064520A1 (en) 1999-08-19 2002-05-30 Yanina Rozenberg Targeted artificial gene delivery
US6593308B2 (en) 1999-12-03 2003-07-15 The Regents Of The University Of California Targeted drug delivery with a hyaluronan ligand
US6602932B2 (en) 1999-12-15 2003-08-05 North Carolina State University Nanoparticle composites and nanocapsules for guest encapsulation and methods for synthesizing same
GB9930533D0 (en) 1999-12-23 2000-02-16 Mitsubishi Tokyo Pharm Inc Nucleic acid delivery
US6616944B2 (en) 2000-03-08 2003-09-09 Medinnova Gesellschaft Fur Medizinsche Innovationen Aus Adkademischer Forschung Mbh Self-assembling colloidal carriers for protein delivery
US7332337B2 (en) 2000-05-16 2008-02-19 Galapagos Nv Viral vectors having tissue tropism for T-lymphocytes, B- and mast cells
IL153831A0 (en) 2000-07-19 2003-07-31 Univ California Methods for therapy of neurodegenerative disease of the brain
US6696038B1 (en) 2000-09-14 2004-02-24 Expression Genetics, Inc. Cationic lipopolymer as biocompatible gene delivery agent
CA2429814C (en) 2000-12-01 2014-02-18 Thomas Tuschl Rna interference mediating small rna molecules
WO2002044204A2 (en) 2000-12-01 2002-06-06 The Government Of The United States, As Represented By The Secretary Of Health And Human Services Cell-free assembly of lentiviral capsids
DE60037263T2 (de) 2000-12-29 2008-10-09 Evotec Ag Virus-ähnliche Partikel, ihre Herstellung und ihre Verwendung beim pharmazeutischen Screening und funktionelle Genomanwendungen
EP1409748B1 (en) 2001-06-22 2011-10-26 The Trustees of The University of Pennsylvania Recombinant Adenoviruses comprising simian adenovirus proteins and uses thereof.
US7101995B2 (en) 2001-08-27 2006-09-05 Mirus Bio Corporation Compositions and processes using siRNA, amphipathic compounds and polycations
AU2002335709B8 (en) 2001-09-06 2008-12-18 Cornell Research Foundation, Inc. Human Immunodeficiency Virus Envelope Clycoprotein Mutants and Uses Thereof
US7148343B2 (en) 2001-10-12 2006-12-12 Gentra Systems, Inc. Compositions and methods for using a solid support to purify RNA
AU2002365366B2 (en) 2001-11-21 2007-05-10 The Trustees Of The University Of Pennsylvania Simian adenovirus nucleic acid and amino acid sequences, vectors containing same, and methods of use
EP1944043A1 (en) 2001-11-21 2008-07-16 The Trustees of the University of Pennsylvania Simian adenovirus nucleic acid and amino acid sequences, vectors containing same, and methods of use
PT1453547T (pt) 2001-12-17 2016-12-28 Univ Pennsylvania Sequências do vírus adeno-associado (aav) do serotipo 8, vetores contendo as mesmas, e utilizações destas
BR0311995A (pt) 2002-06-20 2005-04-05 Cytos Biotechnology Ag Partìculas semelhantes a vìrus empacotadas para o uso como adjuvantes: método de preparação e uso
US7148342B2 (en) 2002-07-24 2006-12-12 The Trustees Of The University Of Pennyslvania Compositions and methods for sirna inhibition of angiogenesis
EP1447079A1 (de) 2003-02-15 2004-08-18 Fraunhofer-Gesellschaft für angewandte Forschung e.V. Vesikel mit chimären Rezeptoren zur Induktion einer gerichteten T-Zellantwort in vivo
EP1585504A4 (en) 2002-11-06 2009-07-15 Azaya Therapeutics Inc Protein stabilized liposomal formulations of pharmaceutical active ingredients
JP2004175665A (ja) 2002-11-22 2004-06-24 Japan Science & Technology Agency タンパク質中空ナノ粒子およびそれを用いた薬剤
CA2509365C (en) 2002-12-09 2012-08-07 American Bioscience, Inc. Compositions and methods of delivery of pharmacological agents
US20070178066A1 (en) 2003-04-21 2007-08-02 Hall Frederick L Pathotropic targeted gene delivery system for cancer and other disorders
JP2007513261A (ja) 2003-10-15 2007-05-24 ボード・オブ・リージエンツ,ザ・ユニバーシテイ・オブ・テキサス・システム ウイルスファイバー
EP1773303A2 (en) 2004-05-25 2007-04-18 Chimeracore, Inc. Self-assembling nanoparticle drug delivery system
US20080131928A1 (en) 2004-07-01 2008-06-05 Hiroshi Handa Viral Particle-Like Construct and Method of Forming the Same Under Physiological Conditions
GB0416487D0 (en) 2004-07-23 2004-08-25 Isis Innovation Modified virus
CN101056539B (zh) 2004-09-09 2012-12-12 综合医院公司 调节心脏细胞中的磷酸酶活性
US20070248573A1 (en) 2004-09-17 2007-10-25 Joseph Sturino Chimeric Bacteriophages, Chimeric Phage-Like Particles, and Chimeric Phage Ghost Particles, Methods for Their Production and Use
CN2763975Y (zh) 2004-12-11 2006-03-08 鸿富锦精密工业(深圳)有限公司 热管式散热装置
US20090123426A1 (en) 2004-12-17 2009-05-14 Chiang Li Compositions for Bacterial Mediated Gene Silencing and Methods of Using the Same
WO2006088229A1 (ja) 2005-02-16 2006-08-24 The Circle For The Promotion Of Science And Engineering 改変されたウイルスカプシドタンパク質及びその使用
US20070160628A1 (en) * 2005-08-31 2007-07-12 Birkett Ashley J Stabilized virus-like particles and epitope display systems
WO2008037504A1 (en) 2006-09-28 2008-04-03 Cytos Biotechnology Ag Interleukin-1 muteins linked to virus-like particles to treat il-1 associated diseases
US20070258889A1 (en) 2005-11-09 2007-11-08 Montana State University Novel nanoparticles and use thereof
US20110104051A1 (en) 2006-03-27 2011-05-05 The Regents Of The University Of California Chemically Modified Viral Capsids as Targeted Delivery Vectors for Diagnostic and Therapeutic Agents
CA2648581A1 (en) * 2006-04-07 2008-09-12 Chimeros, Inc. Compositions and methods for treating b- cell malignancies
WO2008027084A2 (en) 2006-04-28 2008-03-06 The Trustees Of The University Of Pennsylvania Modified aav vectors having reduced capsid immunogenicity and use thereof
EP2012822B1 (en) 2006-04-28 2010-01-20 The Trustees of the University of Pennsylvania Modified adenovirus hexon protein and uses thereof
US20090238885A1 (en) 2006-05-22 2009-09-24 Nizo Food Research B.V. Protein encapsulated particles
EP2056794A4 (en) 2006-08-08 2012-12-26 Univ Texas MULTIPLE ADMINISTRATION OF ACTIVE SUBSTANCES
US9803189B2 (en) 2006-08-23 2017-10-31 Stc.Unm Virus-like platform for rapid vaccine discovery
EP2120894A1 (en) 2006-10-25 2009-11-25 Universidade de Coimbra Oral submicron particle delivery system for proteins and process for its production
CA2683063A1 (en) 2007-04-09 2008-10-16 Chimeros, Inc. Self-assembling nanoparticle drug delivery system
CA2597878A1 (en) * 2007-09-13 2009-03-13 Ankegens Laboratories Capsid protein and use therefore
WO2010042751A2 (en) 2008-10-08 2010-04-15 Chimeros Inc. Chimeric therapeutics, compositions, and methods for using same
WO2010042749A2 (en) 2008-10-08 2010-04-15 Chimeros Inc. Chimeric therapeutics, compositions, and methods for using same
WO2010042743A2 (en) * 2008-10-08 2010-04-15 Chimeros Inc. Chimeric multiplexes, compositions, and methods for using same
WO2010042755A2 (en) 2008-10-08 2010-04-15 Chimeros Inc. Chimeric therapeutics, compositions, and methods for using same
WO2010120874A2 (en) 2009-04-14 2010-10-21 Chimeros, Inc. Chimeric therapeutics, compositions, and methods for using same
CA2847888A1 (en) 2011-09-09 2013-03-14 Biomed Realty, L.P. Methods and compositions for controlling assembly of viral proteins

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
None
See also references of EP2747774A4

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN108064230A (zh) * 2015-04-22 2018-05-22 Ucb生物制药私人有限公司 使重组抗体分子单体化的方法
CN108064230B (zh) * 2015-04-22 2021-04-06 Ucb生物制药有限责任公司 使重组抗体分子单体化的方法
CN106279379A (zh) * 2016-09-13 2017-01-04 华兰生物工程股份有限公司 一种免疫原HM4‑M2e及其制备方法与应用
CN106279379B (zh) * 2016-09-13 2020-05-22 华兰生物工程股份有限公司 一种免疫原HM4-M2e及其制备方法与应用
US11116837B2 (en) * 2016-11-22 2021-09-14 National Taiwan University Vaccine composition comprising hepatitis B virus like particle as adjuvant
CN107488217A (zh) * 2017-09-13 2017-12-19 华兰生物疫苗有限公司 一种多肽、免疫原性偶联物和流感疫苗
US20210332089A1 (en) * 2018-10-12 2021-10-28 Riken Hepatitis b virus replication inhibitor and pharmaceutical composition for treating hepatitis b comprising the same
US12275759B2 (en) * 2018-10-12 2025-04-15 Riken Hepatitis B virus replication inhibitor and pharmaceutical composition for treating hepatitis B comprising the same
WO2021163538A1 (en) * 2020-02-13 2021-08-19 The Trustees Of Indiana University Hepadnavirus capsid protein heterodimers and virus-like particles
US12612433B2 (en) 2020-02-13 2026-04-28 The Trustees Of Indiana University Hepadnavirus capsid protein heterodimers and virus-like particles
WO2024018188A1 (en) * 2022-07-18 2024-01-25 University Of Dundee Virus-like particles, heterodimeric capsid proteins and methods of production thereof

Also Published As

Publication number Publication date
EP2747774A4 (en) 2015-02-11
US8865188B2 (en) 2014-10-21
AU2012305714A1 (en) 2014-03-27
WO2013036973A3 (en) 2013-07-11
CA2847888A1 (en) 2013-03-14
JP2014527072A (ja) 2014-10-09
EP2747774A2 (en) 2014-07-02
US20130156818A1 (en) 2013-06-20
US20150252081A1 (en) 2015-09-10

Similar Documents

Publication Publication Date Title
US8865188B2 (en) Methods and compositions for controlling assembly of viral proteins
JP5902679B2 (ja) IL−4Rαに結合する涙液リポカリンムテイン
JP2022101618A (ja) 条件的活性型ポリペプチド
US6267964B1 (en) Stabilized protein or peptide conjugates able to bond albumin having extended biological half-lives
US20140010885A1 (en) Self-assembling nanoparticle drug delivery system
JP7385680B2 (ja) 変異型rsv fタンパク質及びその利用
JP7680745B2 (ja) 1価ccap生成物の製造方法
JP5875990B2 (ja) メチオニンγリアーゼ酵素を含む作製された酵素およびその薬理学的調製物
CN106906230B (zh) 重组药物载体蛋白基因及其制备方法与应用
JP2017529059A5 (https=)
JP2002514892A (ja) 遺伝子治療における合成ウイルス様粒子の使用
JP2022095856A (ja) 増殖分化因子15融合タンパク質
CN114616241B (zh) 基于铁蛋白重链亚基的药物载体
CN112225820B (zh) 肿瘤特异靶向性基质的重组人血清白蛋白-胶原结合域融合蛋白和应用
JP2019520392A (ja) ヒト酵素媒介性シスチン枯渇
US20110104263A1 (en) Claudin-4 binding peptides, compositions and methods of use
CN113121704B (zh) 基于纳米颗粒的冠状病毒疫苗
US7078485B2 (en) N-terminal modified recombinant human endostatin and its production
KR20250166188A (ko) Tnfr2 결합 폴리펩타이드 및 이의 용도의 방법
US9238010B2 (en) Vesicles and nanostructures from recombinant proteins
AU2018309724B2 (en) Modified DDAH polypeptides comprising a pharmacokinetic enhancing moiety, improved pharmacology and their uses
JPH10505835A (ja) 特定の細胞型への化学試薬の細胞内送達
US20120165268A1 (en) P53 fusion proteins and methods of making and using thereof
CN116897162A (zh) 铁蛋白重链亚基突变体及其应用
CN118530961A (zh) 一种用于pe3毒素重构的蛋白组合及其在制备肝癌治疗药物中的应用

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12829920

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2847888

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2014529962

Country of ref document: JP

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2012829920

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2012829920

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2012305714

Country of ref document: AU

Date of ref document: 20120910

Kind code of ref document: A