WO2012048721A1 - Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases - Google Patents

Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases Download PDF

Info

Publication number
WO2012048721A1
WO2012048721A1 PCT/EP2010/006284 EP2010006284W WO2012048721A1 WO 2012048721 A1 WO2012048721 A1 WO 2012048721A1 EP 2010006284 W EP2010006284 W EP 2010006284W WO 2012048721 A1 WO2012048721 A1 WO 2012048721A1
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
poly
seq
jnk
chimeric
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2010/006284
Other languages
English (en)
French (fr)
Inventor
Jean-Marc Combette
Catherine Deloche
Claire Abadie
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Xigen SA
Original Assignee
Xigen SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Xigen SA filed Critical Xigen SA
Priority to CA2807036A priority Critical patent/CA2807036C/en
Priority to PCT/EP2010/006284 priority patent/WO2012048721A1/en
Priority to JP2013533091A priority patent/JP5857056B2/ja
Priority to US13/879,059 priority patent/US9150618B2/en
Priority to AU2010362444A priority patent/AU2010362444B2/en
Priority to ES11775734.4T priority patent/ES2575226T3/es
Priority to PL14004427T priority patent/PL2902035T3/pl
Priority to DK11775734.4T priority patent/DK2627346T3/en
Priority to HK14100332.1A priority patent/HK1187266B/en
Priority to DK14004427.2T priority patent/DK2902035T3/en
Priority to EP11775734.4A priority patent/EP2627346B1/en
Priority to EP14004427.2A priority patent/EP2902035B1/en
Priority to PCT/EP2011/005172 priority patent/WO2012048893A1/en
Priority to ES14004427T priority patent/ES2688030T3/es
Priority to PL11775734.4T priority patent/PL2627346T3/pl
Publication of WO2012048721A1 publication Critical patent/WO2012048721A1/en
Anticipated expiration legal-status Critical
Priority to US14/849,374 priority patent/US20160089413A1/en
Priority to HK15111042.8A priority patent/HK1210056A1/en
Priority to US15/934,735 priority patent/US10967038B2/en
Priority to CY181100963T priority patent/CY1120936T1/el
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/005Enzyme inhibitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention refers to the use of protein kinase inhibitors and more specifically to the use of inhibitors of the protein kinase c-Jun amino terminal kinase, JNK inhibitor (polypeptides, chimeric peptides, or of nucleic acids encoding same as well as pharmaceutical compositions containing same, for the treatment of non-chronic or chronic inflammatory eye diseases, such as hordeolum, chalazion, conjunktivitis, keratitis, scleritis, episcleritis, endophthalmitis, panophtalmitis, ulceritis, uveitis, cyclitis, chorioiditis, orbital phlegmon, and/or myositis of the eye muscle, etc.
  • non-chronic or chronic inflammatory eye diseases such as hordeolum, chalazion, conjunktivitis, keratitis, scleritis, episcleritis, endophthal
  • Ophthalmological diseases are diseases that pertain to the eye.
  • the present invention focuses on non-chronic or chronic inflammatory eye diseases. These include for example inflammatory diseases of the blephara, conjunctiva, cornea, sclera, the vitreous body, uvea, ciliary body, choroid, orbital bone, lacrimal gland, iris, etc.
  • inflammatory diseases are hordeolum, chalazion, conjunktivitis, keratitis, scleritis, episcleritis, endophthalmitis, panophtalmitis, ulceritis, uveitis, cyclitis, chorioiditis, orbital phlegmon, and/or myositis of the eye muscle.
  • JNKs The c-Jun NH2-terminal kinases
  • the JNK pathway is activated by certain cytokines, mitogens, osmotic stress and irradiation.
  • the phosphorylation of the c-Jun component of the activator protein AP-1 transcription factor results in pro-inflammatory cytokines production.
  • leukocytes infiltration and rolling result from the early activation of the vascular endothelium that releases important chemotactic factors such as RANTES, IL-8, ICAM and VCAM.
  • Infiltrating cells in turn release distinct sets of pro- or anti- inflammatory products that contribute to tissue damages and inflammation.
  • Many of the gene products involved in the inflammatory response are regulated by the transcription factor activator protein-1 (AP-1 ), and the c-Jun NH2-terminal kinase (JNK) pathway: COX-2, cyclooxygenase-2; IFN-g, interferon-gamma; iNOS, inducible nitric oxide synthase; TNF-a, tumor-necrosis factor-alpha; MCP-1 , membrane cofactor protein-1 ; MIP-1 , major intrinsic protein-1 ; IL-2, interleukin-2, ...
  • COX-2 cyclooxygenase-2
  • IFN-g interferon-gamma
  • iNOS inducible nitric oxide synthase
  • TNF-a tumor-necrosis factor-alpha
  • MCP-1 membrane cofactor protein-1
  • MIP-1 major
  • TNF-a is produced through the JNK pathway activation and modulated by its inhibition.
  • JNK inhibitors have been therefore used in various models of inflammation and shown to exert anti-inflammatory and beneficial effects in inflammatory diseases such arthritis and asthma.
  • the object of the present invention is thus to provide alternative or improved therapies, which allow new and preferably improved cure of non-chronic or chronic (inflammatory) eye diseases, such as hordeolum, chalazion, conjunktivitis, keratitis, scleritis, episcleritis, endophthalmitis, panophtalmitis, ulceritis, uveitis, cyclitis, chorioiditis, orbital phlegmon, myositis of the eye muscle, etc..
  • This object is solved by the use of a JNK inhibitor (poly-)peptide comprising less than 1 50 amino acids in length for the preparation of a pharmaceutical composition for treating non- chronic or chronic inflammatory eye diseases in a subject.
  • non-chronic or chronic inflammatory eye disease typically denotes non-chronic or chronic inflammatory diseases that pertain to the eye. This includes diseases of the blephara, conjunctiva, cornea, sclera, the vitreous body, uvea, ciliary body, choroid, orbital bone, lacrimal gland, iris, etc..
  • hordeolum chalazion, conjunktivitis, keratitis, scleritis, episcleritis, endophthalmitis, panophtalmitis, ulceritis, uveitis, cyclitis, chorioiditis, orbital phlegmon, myositis of the eye muscle.
  • uveitis for example treatment of anterior uveitis, intermediate uveitis, posterior uveitis and panuveitis.
  • jNK inhibitor (poly-)peptides s are particularly suitable for treating such chronic or non-chronic inflammatory eye diseases in a subject. This was neither obvious nor suggested by the prior art, even though JNK inhibitor (poly-)peptides in general have been known from the art.
  • a JNK inhibitor (poly-)peptide may be typically derived from a human or rat IB1 sequence, preferably from an amino acid sequence as defined or encoded by any of sequences according to SEQ ID NO: 102 (depicts the IB1 cDNA sequence from rat and its predicted amino acid sequence), SEQ ID NO: 103 (depicts the IB1 protein sequence from rat encoded by the exon-intron boundary of the rlB1 gene - splice donor), SEQ ID NO: 104 (depicts the IB1 protein sequence from Homo sapiens), or SEQ ID NO: 105 (depicts the IB1 cDNA sequence from Homo sapiens), more preferably from an amino acid sequence as defined or encoded by any of sequences according to SEQ ID NO: 104 (depicts the IB1 protein sequence from Homo sapiens), or SEQ ID NO: 105 (depicts the IB1 cDNA sequence from Hom
  • the JNK inhibitor (poly-)peptide comprises a fragment, variant, or variant of such fragment of a human or rat IB1 sequence.
  • Human or rat IB sequences are defined or encoded, respectively, by the sequences according to SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104 or SEQ ID NO: 105.
  • such a JNK inhibitor (poly-)peptide as used herein comprises a total length of less than 150 amino acid residues, preferably a range of 5 to 150 amino acid residues, more preferably 10 to 100 amino acid residues, even more preferably 10 to 75 amino acid residues and most preferably a range of 10 to 50 amino acid residues, e.g. 10 to 30, 10 to 20, or 10 to 15 amino acid residues.
  • such a JNK inhibitor (poly-)peptide and the above ranges may be selected from any of the above mentioned sequences, even more preferably from an amino acid sequence as defined according to SEQ ID NO: 104 or as encoded by SEQ ID NO: 105, even more preferably in the region between nucleotides 420 and 980 of SEQ ID NO: 105 or amino acids 105 and 291 of SEQ ID NO: 104, and most preferably in the region between nucleotides 561 and 647 of SEQ ID NO: 105 or amino acids 152 and 180 of SEQ ID NO:
  • a JNK inhibitor (poly-)peptide as used herein typically binds JNK and/or inhibits the activation of at least one JNK activated transcription factor, e.g. c-Jun or ATF2 (see e.g. SEQ ID NOs: 15 and 16, respectively) or Elk1 .
  • the JNK inhibitor (poly-)peptide as used herein preferably comprises or consists of at least one amino acid sequence according to any one of SEQ ID NOs: 1 to 4, 13 to 20 and 33 to 100, or a fragment, derivative or variant thereof. More preferably, the JNK inhibitor (poly-)peptide as used herein may contain 1 , 2, 3, 4 or even more copies of an amino acid sequence according to SEQ ID NOs: 1 to 4, 13 to 20 and 33 to 100, or a variant, fragment or derivative thereof.
  • these amino acid sequences according to SEQ ID NOs: 1 to 4, 13 to 20 and 33 to 100, or variants, fragments, or derivatives thereof as used herein may be directly linked with each other without any linker sequence or via a linker sequence comprising 1 to 10, preferably 1 to 5 amino acids.
  • Amino acids forming the linker sequence are preferably selected from glycine or proline as amino acid residues. More preferably, these amino acid sequences according to SEQ ID NOs: 1 to 4, 13 to 20 and 33 to 100, or fragments, variants or derivatives thereof, as used herein, may be separated by each other by a hinge of two, three or more proline residues.
  • the JNK inhibitor (poly-)peptides as used herein may be composed of L-amino acids, D- amino acids, or a combination of both.
  • the JNK inhibitor (poly-)peptides as used herein comprise at least 1 or even 2, preferably at least 3, 4 or 5, more preferably at least 6, 7, 8 or 9 and even more preferably at least 10 or more D- and/or L-amino acids, wherein the D- and/or L-amino acids may be arranged in the JNK inhibitor sequences as used herein in a blockwise, a non-blockwise or in an alternate manner.
  • the JNK inhibitor (poly-)peptides as used herein may be exclusively composed of L-amino acids.
  • the JNK inhibitor (poly-)peptides as used herein may then comprise or consist of at least one mitnative JNK inhibitor sequence" according to SEQ ID NO: 1 or 3.
  • the term "native” or “native JNK inhibitor sequence(s)” is referred to non-altered JNK inhibitor (poly-)peptide sequences according to any of SEQ ID NOs: 1 or 3, as used herein, entirely composed of L-amino acids.
  • the JNK inhibitor (poly-)peptide as used herein may comprise or consist of at least one (native) amino acid sequence NH 2 -X n b -X n a -RP TLXLXXXXXXQD-X n b -COOH (L-IB generic (s)) [SEQ ID NO: 3] and/or the JNK binding domain (JBDs) of IB1 XRPTTLXLXXXXXXXQDS TX (L-IB (generic)) [SEQ ID NO: 19].
  • each X typically represents an amino acid residue, preferably selected from any (native) amino acid residue.
  • X n a typically represents one amino acid residue, preferably selected from any amino acid residue except serine or threonine, wherein n (the number of repetitions of X) is 0 or 1.
  • each X n b may be selected from any amino acid residue, wherein n (the number of repetitions of X) is 0-5, 5-10, 10-15, 15-20, 20-30 or more, provided that if n (the number of repetitions of X) is 0 for X n a , X n does preferably not comprise a serine or threonine at its C-terminus, in order to avoid a serine or threonine at this position.
  • X n b represents a contiguous stretch of peptide residues derived from SEQ ID NO: 1 or 3.
  • X n a and X n b may represent either D or L amino acids.
  • the JNK inhibitor (poly-)peptide as used herein may comprise or consist of at least one (native) amino acid sequence selected from the group comprising the JNK binding domain of IB1 DTYRPKRPTTLNLFPQVPRSQDT (L- IB1 ) [SEQ ID NO: 1 7].
  • the JNK inhibitor (poly-)peptide as used herein further may comprise or consist of at least one (native) amino acid sequence NH 2 - RPKRPTTLNLFPQVPRSQD-COOH (L-IBI (s)) [SEQ ID NO: 1 ].
  • the JNK inhibitor (poly-)peptide as used herein may comprise or consist of at least one (native) amino acid sequence selected from the group comprising the JNK binding domain of IB1 L- IB1 (s1 ) (NH 2 -TLNLFPQVPRSQD-COOH, SEQ ID NO: 33); L-IB1 (s2) (NH 2 - TTLNLFPQVPRSQ-COOH, SEQ ID NO: 34); L-IB1 (s3) (NH 2 -PTTLNLFPQVPRS-COOH, SEQ ID NO: 35); L-IB1 (s4) (NH 2 -RPTTLNLFPQVPR-COOH, SEQ ID NO: 36); L-IB1 (s5) (NH 2 - KRPTTLNLFPQVP-COOH, SEQ ID NO: 37); L-IB1 (s6) (NH 2 -PKRPTTLNLFPQV-COOH, SEQ ID NO: 38); L-IB1 (s7) (NH 2 -RPK
  • the JNK inhibitor (poly-)peptide as used herein may comprise or consist of at least one (native) amino acid sequence selected from the group comprising the (long) JNK binding domain (JBDs) of IB1 PGTGCGDTYRPKRPTTLNLFPQVPRSQDT (IB1 -long) [SEQ ID NO: 13], the (long) JNK binding domain of IB2 IPSPSVEEPHKHRPTTLRLTTLGAQDS (IB2- long) [SEQ ID NO: 14], the JNK binding domain of c-Jun GAYGYSNPKILKQSMTLNLADPVGNLKPH (c-Jun) [SEQ ID NO: 1 5], the JNK binding domain of ATF2 TNEDHLAVHKHKHEMTLKFGPARNDSVIV (ATF2) [SEQ ID NO: 1 6] (see e.g.
  • FIGS. 1 A-1 C an alignment revealed a partially conserved 8 amino acid sequence (see e.g. FIG.1 A) and a further comparison of the JBDs of IB1 and IB2 revealed two blocks of seven and three amino acids that are highly conserved between the two sequences.
  • the JNK inhibitor (poly-)peptides as used herein may be composed in part or exclusively of D-amino acids as defined above. More preferably, these JNK inhibitor (poly-)peptides composed of D-amino acids are non-native D retro-inverso sequences of the above (native) JNK inhibitor sequences.
  • the term "retro- inverso (poly-)peptides" refers to an isomer of a linear peptide sequence in which the direction of the sequence is reversed and the chirality of each amino acid residue is inverted (see e.g.
  • any given L-amino acid sequence or peptide as used according to the present invention may be converted into an D retro-inverso sequence or peptide by synthesizing a reverse of the sequence or peptide for the corresponding native L- amino acid sequence or peptide.
  • D retro-inverso (poly-)peptides as used herein and as defined above have a variety of useful properties.
  • D retro-inverso (poly-)peptides as used herein enter cells as efficiently as L-amino acid sequences as used herein, whereas the D retro-inverso sequences as used herein are more stable than the corresponding L-amino acid sequences.
  • the JNK inhibitor (poly-)peptides as used herein may comprise or consist of at least one D retro-inverso sequence according to the amino acid sequence NH 2 -X n b - DQXXXXXXLXLTTPR-X n a -X n b -COOH (D-IB1 generic (s)) [SEQ ID NO: 4] and/or XS/TDQXXXXXXXLXLTTPRX (D-IB (generic)) [SEQ ID NO: 20] .
  • X, X n a and X n b are as defined above (preferably, representing D amino acids), wherein X n b preferably represents a contiguous stretch of residues derived from SEQ ID NO: 2 or 4.
  • the JNK inhibitor (poly-)peptides as used herein may comprise or consist of at least one D retro-inverso sequence according to the amino acid sequence comprising the JNK binding domain (JBDs) of IB1 TDQSRPVQPFLNLTTPRKPRYTD (D-IB1 ) [SEQ ID NO: 18].
  • the JNK inhibitor (poly-)peptides as used herein may comprise or consist of at least one D retro-inverso sequence according to the amino acid sequence NH 2 - DQSRPVQPFLNLTTPRKPR-COOH (D-IB1 (s)) [SEQ ID NO: 2].
  • the JNK inhibitor (poly-)peptides as used herein may comprise or consist of at least one D retro- inverso sequence according to the amino acid sequence comprising the JNK binding domain (JBDs) of IB1 D-IB1 (si ) (NH 2 -QPFLNLTTPRKPR-COOH, SEQ ID NO: 67); D-IB1 (s2) (NH 2 -VQPFLNLTTPRKP-COOH, SEQ ID NO: 68); D-IB1 (s3) (NH 2 -PVQPFLNLTTPRK- COOH, SEQ ID NO: 69); D-IB1 (s4) (NH 2 -RPVQPFLNLTTPR-COOH, SEQ ID NO: 70); D- IB1 (s5) (NH 2 -SRPVQPFLNLTTP-COOH, SEQ ID NO: 71 ); D-IB1 (s6) (NH 2 - QS R PVQ PF L N LTT-COO H ,
  • the JNK inhibitor (poly-)peptides as used herein and as disclosed above are presented in Table 1 (SEQ ID NO:s 1 -4, 1 3-20 and 33-100).
  • the table presents the name of the JNK inhibitor (poly-)peptides/sequences as used herein, as well as their sequence identifier number, their length, and amino acid sequence.
  • Table 1 shows sequences as well as their generic formulas, e.g. for SEQ ID NO's: 1 , 2, 5, 6, 9 and 1 1 and SEQ ID NO's: 3, 4, 7, 8, 10 and 12, respectively.
  • Table 1 furthermore discloses the chimeric sequences SEQ ID NOs: 9-12 and 23-32 (see below), L-IB1 sequences SEQ ID NOs: 33 to 66 and D- IB1 sequences SEQ ID NOs: 67 to 100.
  • L-generic-TAT (s) 7 1 1 NH 2 -X n b -RKKRRQRRR-X n b -COOH
  • D-generic-TAT (s) 8 1 1 NH 2 -X n b -RRRQRRKKR-X n b -COOH
  • L-TAT-IB (generic) (s) 10 29 NH 2 -X n b -RKKRRQRRR-X n b -X n a -RPTTLXLXXXXXXQD-X n b -COOH
  • D-TAT-IBKs 1 1 31 DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG
  • D-TAT-IB (generic) (s) 12 29 NH 2 -X n b -DQXXXXXXLXLTTPR-X n a -X n b -RRRQRR KR-X n b -COOH
  • L-IB (generic) 19 19 XRPTTLXLXXXXXXQDS/TX
  • L-generic-TAT 21 1 7 XXXXRKKRRQRRRXXXX
  • D-generic-TAT 22 1 7 XXXXRRRQRRKKRXXXX
  • L-TAT-IB 1 23 35 GRKKRRQRRRPPDTYRPKRPTTLNLFPQVPRSQDT
  • L-TAT-IB (generic) 24 42 XXXXXXRKKRRQRRRXXXXXXXRPTTLXLXXXXXXXQDS/TX
  • D-TAT-IB 1 25 35 TDQSRPVQPFLNLTTPRKPRYTDPPRRRQRRKKRG
  • D-TAT-IB (generic) 26 42 XT/SDQXXXXXXLXLTTPRXXXXXXXRRRQRRKKRXXXXXXX
  • L-TAT-IB1 (s2) 28 30 GRKKRRQRRRX n c RPKRPTTLNLFPQVPRSQD
  • D-TAT-IB1 (s3) 32 29 DQSRPVQPFLNLTTPRKPRX n c RRRQRRKKR
  • D-IB1 (s34) 100 10 LNLTTPRKPR
  • D-name a sequence herein which is composed exclusively of D-amino acids
  • SEQ ID NO:100 has the sequence/peptide name "D-IB1 (s34)".
  • the given amino acid sequence is LNLTTPRKPR.
  • all amino acids are here D-amino acids.
  • L-TAT SEQ ID NO:5
  • D-TAT SEQ ID NO:6
  • the JNK inhibitor (poly-)peptide as used herein comprises or consists of at least one variant, fragment and/or derivative of the above defined native or non-native amino acid sequences according to SEQ ID NOs: 1 -4, 13-20 and 33- 100.
  • these variants, fragments and/or derivatives retain biological activity of the above disclosed native or non-native JNK inhibitor (poly-)peptides as used herein, particularly of native or non-native amino acid sequences according to SEQ ID NOs: 1 -4, 13-20 and 33-100, i.e. binding JNK and/or inhibiting the activation of at least one JNK activated transcription factor, e.g. c-Jun, ATF2 or Elk1.
  • Functionality may be tested by various tests, e.g. binding tests of the peptide to its target molecule or by biophysical methods, e.g. spectroscopy, computer modeling, structural analysis, etc..
  • an JNK inhibitor poly-
  • an JNK inhibitor poly-
  • an JNK inhibitor poly-
  • variants, fragments and/or derivatives thereof as defined above may be analyzed by hydrophilicity analysis (see e.g. Hopp and Woods, 1981 . Proc Natl Acad Sci USA 78: 3824-3828) that can be utilized to identify the hydrophobic and hydrophilic regions of the peptides, thus aiding in the design of substrates for experimental manipulation, such as in binding experiments, or for antibody synthesis.
  • JNK inhibitor polypeptide or of variants, fragments and/or derivatives thereof as used herein that assume specific structural motifs
  • Manipulation, translation, secondary structure prediction, hydrophilicity and hydrophobicity profiles, open reading frame prediction and plotting, and determination of sequence homologies can be accomplished using computer software programs available in the art.
  • Other methods of structural analysis include, e.g. X-ray crystallography (see e.g. Engstrom, 1974. Biochem Exp Biol 1 1 : 7-13), mass spectroscopy and gas chromatography (see e.g.
  • JNK inhibitor (poly-)peptide as used herein may comprise or consist of at least one variant of (native or non-native) amino acid sequences according to SEQ ID NOs: 1 -4, 13-20 and 33-100.
  • a "variant of a (native or non-native) amino acid sequence according to SEQ ID NOs: 1 -4, 13-20 and 33-100" is preferably a sequence derived from any of the sequences according to SEQ ID NOs: 1 -4, 13-20 and 33-100, wherein the variant comprises amino acid alterations of the amino acid sequences according to SEQ ID NOs: 1 -4, 13-20 and 33-100.
  • Such alterations typically comprise 1 to 20, preferably 1 to 10 and more preferably 1 to 5 substitutions, additions and/or deletions of amino acids according to SEQ ID NOs: 1 -4, 13-20 and 33-100, wherein the variant exhibits a sequence identity with any of the sequences according to SEQ ID NOs: 1 -4, 13-20 and 33-100 of at least about 30%, 50%, 70%, 80%, 90%, 95%, 98% or even at least about 99%.
  • variants of (native or non-native) amino acid sequences according to SEQ ID NOs: 1 -4, 13-20 and 33-100 as defined above and used herein are obtained by substitution of specific amino acids, such substitutions preferably comprise conservative amino acid substitutions.
  • Conservative amino acid substitutions may include synonymous amino acid residues within a group which have sufficiently similar physicochemical properties, so that a substitution between members of the group will preserve the biological activity of the molecule (see e.g. Grantham, R. (1974), Science 185, 862-864). It is evident to the skilled person that amino acids may also be inserted and/or deleted in the above-defined sequences without altering their function, particularly if the insertions and/or deletions only involve a few amino acids, e.g.
  • substitutions shall be avoided in variants as used herein, which lead to additional threonines at amino acid positions which are accessible for a phosphorylase, preferably a kinase, in order to avoid inactivation of the JNK-inhibitor (poly-)peptide as used herein or of the chimeric peptide as used herein in vivo or in vitro.
  • synonymous amino acid residues which are classified into the same groups and are typically exchangeable by conservative amino acid substitutions, are defined in Table 2.
  • Tyr Trp Met, Phe, lie, Val, Leu, Tyr
  • Lys Glu Gin, His, Arg, Lys
  • a specific form of a variant of SEQ ID NOs: 1 -4, 13-20 and 33-100 as used herein is a fragment of the (native or non-native) amino acid sequences according to SEQ ID NOs: 1 , 1 -4, 13-20 and 33-100" as used herein, which is typically altered by at least one deletion as compared to SEQ ID NOs 1 -4, 13-20 and 33-100.
  • a fragment comprises at least 4 contiguous amino acids of any of SEQ ID NOs: 1 -4, 13-20 and 33-100, a length typically sufficient to allow for specific recognition of an epitope from any of these sequences.
  • the fragment comprises 4 to 18, 4 to 15, or most preferably 4 to 10 contiguous amino acids of any of SEQ ID NOs: 1 -4, 13-20 and 33-100, wherein the lower limit of the range may be 4, or 5, 6, 7, 8, 9, or 10. Deleted amino acids may occur at any position of SEQ ID NOs: 1 -4, 13-20 and 33-100, preferably N- or C-terminally.
  • a fragment of the (native or non-native) amino acid sequences according to SEQ ID NOs: 1-4, 13-20 and 33-100, as described above, may be defined as a sequence sharing a sequence identity with any of the sequences according to SEQ ID NOs: 1 -4, 13-20 and 33-100 as used herein of at least about 30%, 50%, 70%, 80%, 90%, 95%, 98%, or even 99%.
  • the JNK inhibitor (poly-)peptides/sequences as used herein may further comprise or consist of at least one derivative of (native or non-native) amino acid sequences according to SEQ ID NOs: 1 -4, 1 3-20 and 33-100 as defined above.
  • a "derivative of an (native or non-native) amino acid sequence according to SEQ ID NOs: 1 -4, 1 3-20 and 33-100” is preferably an amino acid sequence derived from any of the sequences according to SEQ ID NOs: 1 -4, 1 3-20 and 33-100, wherein the derivative comprises at least one modified L- or D-amino acid (forming non-natural amino acid(s)), preferably 1 to 20, more preferably 1 to 1 0, and even more preferably 1 to 5 modified L- or D-amino acids.
  • Derivatives of variants or fragments also fall under the scope of the present invention.
  • a modified amino acid in this respect may be any amino acid which is altered e.g. by different glycosylation in various organisms, by phosphorylation or by labeling specific amino acids. Such a label is then typically selected from the group of labels comprising:
  • radioactive labels i.e. radioactive phosphorylation or a radioactive label with sulphur, hydrogen, carbon, nitrogen, etc.
  • colored dyes e.g. digoxygenin, etc.
  • fluorescent groups e.g. fluorescein, etc.
  • (v) groups for immobilization on a solid phase e.g. His-tag, biotin, strep-tag, flag- tag, antibodies, antigen, etc.
  • a solid phase e.g. His-tag, biotin, strep-tag, flag- tag, antibodies, antigen, etc.
  • an amino acid sequence having a sequence "sharing a sequence identity" of at least, for example, 95% to a query amino acid sequence of the present invention is intended to mean that the sequence of the subject amino acid sequence is identical to the query sequence except that the subject amino acid sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence.
  • up to 5% (5 of 1 00) of the amino acid residues in the subject sequence may be inserted or substituted with another amino acid or deleted.
  • a "% identity" of a first sequence may be determined with respect to a second sequence.
  • these two sequences to be compared are aligned to give a maximum correlation between the sequences. This may include inserting "gaps" in either one or both sequences, to enhance the degree of alignment. A % identity may then be determined over the whole length of each of the sequences being compared (so-called global alignment), that is particularly suitable for sequences of the same or similar length, or over shorter, defined lengths (so-called local alignment), that is more suitable for sequences of unequal length.
  • global alignment that is particularly suitable for sequences of the same or similar length, or over shorter, defined lengths (so-called local alignment), that is more suitable for sequences of unequal length.
  • BESTFIT Garnier et al.
  • GAP Garnier et al.
  • BESTFIT uses the "local homology" algorithm of (Smith and Waterman (1981 ), J. Mol. Biol. 147, 195-197.) and finds the best single region of similarity between two sequences.
  • Other programs for determining identity and/or similarity between sequences are also known in the art, for instance the BLAST family of programs (Altschul et a/., 1990, J. Mol. Biol.
  • JNK-inhibitor (poly-)peptides /sequences as used according to the present invention and as defined above may be obtained or produced by methods well-known in the art, e.g. by chemical synthesis or by genetic engineering methods as discussed below.
  • a peptide corresponding to a portion of an JNK inhibitor sequence as used herein including a desired region of said JNK inhibitor sequence, or that mediates the desired activity in vitro or in vivo may be synthesized by use of a peptide synthesizer.
  • JNK inhibitor (poly-)peptide as used herein and as defined above may be furthermore be modified by a trafficking (poly-)peptide, allowing the JNK inhibitor (poly-)peptide as used herein and as defined above to be transported effectively into the cells.
  • modified JNK inhibitor (poly-)peptides are preferably provided and used as chimeric (poly-)peptides.
  • the present invention therefore provides the use of a chimeric (poly-)peptide including at least one first domain and at least one second domain, for the preparation of a pharmaceutical composition for treating non-chronic or chronic inflammatory eye diseases in a subject, wherein the first domain of the chimeric peptide comprises a trafficking sequence, while the second domain of the chimeric (poly-)peptide comprises an JNK inhibitor sequence as defined above, preferably of any of sequences according to SEQ ID NO: 1 -4, 13-20 and 33-100 or a derivative or a fragment thereof.
  • chimeric (poly-)peptides as used according to the present invention have a length of at least 25 amino acid residues, e.g. 25 to 250 amino acid residues, more preferably 25 to 200 amino acid residues, even more preferably 25 to 1 50 amino acid residues, 25 to 100 and most preferably amino acid 25 to 50 amino acid residues.
  • the chimeric (poly-)peptide as used herein preferably comprises a trafficking sequence, which is typically selected from any sequence of amino acids that directs a peptide (in which it is present) to a desired cellular destination.
  • the trafficking sequence typically directs the peptide across the plasma membrane, e.g. from outside the cell, through the plasma membrane, and into the cytoplasm.
  • the trafficking sequence may direct the peptide to a desired location within the cell, e.g. the nucleus, the ribosome, the endoplasmic reticulum (ER), a lysosome, or peroxisome, by e.g. combining two components (e.g.
  • the trafficking sequence may additionally comprise another component, which is capable of binding a cytoplasmic component or any other component or compartment of the cell (e.g. endoplasmic reticulum, mitochondria, gloom apparatus, lysosomal vesicles). Accordingly, e.g. the trafficking sequence of the first domain and the JNK inhibitor sequence of the second domain may be localized in the cytoplasm or any other compartment of the cell. This allows to determine localization of the chimeric peptide in the cell upon uptake.
  • the trafficking sequence (being included in the first domain of the chimeric peptide as used herein) has a length of 5 to 150 amino acid sequences, more preferably a length of 5 to 100 and most preferably a length of from 5 to 50, 5 to 30 or even 5 to 1 5 amino acids.
  • the trafficking sequence (contained in the first domain of the chimeric peptide as used herein) may occur as a continuous amino acid sequence stretch in the first domain.
  • the trafficking sequence in the first domain may be splitted into two or more fragments, wherein all of these fragments resemble the entire trafficking sequence and may be separated from each other by 1 to 10, preferably 1 to 5 amino acids, provided that the trafficking sequence as such retains its carrier properties as disclosed above.
  • These amino acids separating the fragments of the trafficking sequence may e.g. be selected from amino acid sequences differing from the trafficking sequence.
  • the first domain may contain a trafficking sequence composed of more than one component, each component with its own function for the transport of the cargo JNK inhibitor sequence of the second domain to e.g. a specific cell compartment.
  • the trafficking sequence as defined above may be composed of L-amino acids, D-amino acids, or a combination of both.
  • the trafficking sequences (being included in the first domain of the chimeric peptide as used herein) may comprise at least 1 or even 2, preferably at least 3, 4 or 5, more preferably at least 6, 7, 8 or 9 and even more preferably at least 10 or more D- and/or L-amino acids, wherein the D- and/or L-amino acids may be arranged in the JNK trafficking sequences in a blockwise, a non-blockwise or in an alternate manner.
  • the trafficking sequence of the chimeric (polypeptide as used herein may be exclusively composed of L-amino acids. More preferably, the trafficking sequence of the chimeric peptide as used herein comprises or consists of at least one treating or reducing the rate of the chimeric (polypeptide as used herein. In this context, the term "native" is referred to non-altered trafficking sequences, entirely composed of L-amino acids.
  • the trafficking sequence of the chimeric (polypeptide as used herein may be exclusively composed of D-amino acids. More preferably, the trafficking sequence of the chimeric peptide as used herein may comprise a D retro- inverso peptide of the sequences as presented above.
  • the trafficking sequence of the first domain of the chimeric (poly-)peptide as used herein may be obtained from naturally occurring sources or can be produced by using genetic engineering techniques or chemical synthesis (see e.g. Sambrook, J., Fritsch, E. F., Maniatis, T. (1 989) Molecular cloning: A laboratory manual. 2nd edition. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.). Sources for the trafficking sequence of the first domain may be employed including, e.g. native proteins such as e.g. the TAT protein (e.g. as described in U.S. Patent Nos. 5,804,604 and 5,674,980, each of these references being incorporated herein by reference), VP22 (described in e.g.
  • variants, fragments and derivatives of one of the native proteins used as trafficking sequences are disclosed herewith. With regard to variants, fragments and derivatives it is referred to the definition given above for JNK inhibitor sequences as used herein. Variants, fragments as well as derivatives are correspondingly defined as set forth above for JNK inhibitor sequences as used herein. Particularly, in the context of the trafficking sequence, a variant or fragment or derivative may be defined as a sequence sharing a sequence identity with one of the native proteins used as trafficking sequences as defined above of at least about 30%, 50%, 70%, 80%, 90%, 95%, 98%, or even 99%.
  • the trafficking sequence of the first domain comprises or consists of a sequence derived from the human immunodeficiency virus (HIV)1 TAT protein, particularly some or all of the 86 amino acids that make up the TAT protein.
  • HCV human immunodeficiency virus
  • partial sequences of the full-length TAT protein may be used forming a functionally effective fragment of a TAT protein, i.e. a TAT peptide that includes the region that mediates entry and uptake into cells.
  • a functionally effective fragment of the TAT protein can be determined using known techniques (see e.g.
  • the trafficking sequence in the first domain of the chimeric peptide as used herein may be derived from a functionally effective fragment or portion of a TAT protein sequence that comprises less than 86 amino acids, and which exhibits uptake into cells, and optionally the uptake into the cell nucleus. More preferably, partial sequences (fragments) of TAT to be used as carrier to mediate permeation of the chimeric peptide across the cell membrane, are intended to comprise the basic region (amino acids 48 to 57 or 49 to 57) of full-length TAT.
  • the trafficking sequence (being included in the first domain of the chimeric peptide as used herein) may comprise or consist of an amino acid sequence containing TAT residues 48-57 or 49 to 57, and most preferably a generic TAT sequence NH 2 -X n b -R KRRQRRR-X n b -COOH (L-generic-TAT (s)) [SEQ ID NO: 7] and/or XXXXRKKRRQ RRRXXX (L-generic-TAT) [SEQ ID NO: 21 ], wherein X or X n b is as defined above.
  • the number of "X n b " residues in SEQ ID NOs :8 is not limited to the one depicted, and may vary as described above.
  • the trafficking sequence being included in the first domain of the chimeric peptide as used herein may comprise or consist of a peptide containing e.g. the amino acid sequence NH 2 -GRKKRRQRRR-COOH (L-TAT) [SEQ ID NO: 5].
  • the trafficking sequence (being included in the first domain of the chimeric peptide as used herein) may comprise a D retro-inverso peptide of the sequences as presented above, i.e.
  • X n b is as defined above (preferably representing D amino acids).
  • the number of "X tract b " residues in SEQ ID NOs :8 is not limited to the one depicted, and may vary as described above.
  • the trafficking sequence as used herein may comprise the D retro-inverso sequence NH 2 -RRRQ KKRG-COOH (D- TAT) [SEQ ID NO: 6] .
  • the trafficking sequence being included in the first domain of the chimeric peptide as used herein may comprise or consist of variants of the trafficking sequences as defined above.
  • a "variant of a trafficking sequence” is preferably a sequence derived from a trafficking sequence as defined above, wherein the variant comprises a modification, for example, addition, (internal) deletion (leading to fragments) and/or substitution of at least one amino acid present in the trafficking sequence as defined above.
  • modification(s) typically comprise(s) 1 to 20, preferably 1 to 10 and more preferably 1 to 5 substitutions, additions and/or deletions of amino acids.
  • the variant preferably exhibits a sequence identity with the trafficking sequence as defined above, more preferably with any of SEQ ID NOs: 5 to 8 or 21 -22, of at least about 30%, 50%, 70%, 80%,90%, 95%, 98% or even 99%.
  • variants of the trafficking sequence can be designed to modulate intracellular localization of the chimeric peptide as used herein.
  • such variants as defined above are typically designed such that the ability of the trafficking sequence to enter cells is retained (i.e. the uptake of the variant of the trafficking sequence into the cell is substantially similar to that of the native protein used a trafficking sequence). For example, alteration of the basic region thought to be important for nuclear localization (see e.g. Dang and Lee, J. Biol. Chem.
  • any of the above disclosed variants of the trafficking sequences being included in the first domain of the chimeric peptide as used herein can be produced using techniques typically known to a skilled person (see e.g. Sambrook, J., Fritsch, E. F., Maniatis, T. (1 989) Molecular cloning: A laboratory manual. 2nd edition. Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.)
  • the chimeric peptide as used herein typically comprises an JNK inhibitor sequence, selected from any of the JNK inhibitor sequences as defined above, including variants, fragments and/or derivatives of these JNK inhibitor sequences.
  • Both domains i.e. the first and the second domain(s), of the chimeric peptide as used herein, may be linked such as to form a functional unit. Any method for linking the first and second domain(s) as generally known in the art may be applied.
  • the first and the second domain(s) of the chimeric peptide as used herein are preferably linked by a covalent bond.
  • a covalent bond as defined herein, may be e.g. a peptide bond, which may be obtained by expressing the chimeric peptide as defined above as a fusion protein. Fusion proteins, as described herein, can be formed and used in ways analogous to or readily adaptable from standard recombinant DNA techniques, as described below. However, both domains may also be linked via side chains or may be linked by a chemical linker moiety.
  • the first and/or second domains of the chimeric peptide as used herein may occur in one or more copies in said chimeric peptide.
  • the first domain may be linked either to the N-terminal or the C-terminal end of the second domain. If present in multiple copies, the first and second domain(s) may be arranged in any possible order.
  • the first domain can be present in the chimeric peptide as used herein in a multiple copy number, e.g. in two, three or more copies, which are preferably arranged in consecutive order.
  • the second domain may be present in a single copy occurring at the N- or C-terminus of the sequence comprising the first domain.
  • the second domain may be present in a multiple copy number, e.g. in two, three or more copies, and the first domain may be present in a single copy.
  • first and second domain(s) can take any place in a consecutive arrangement. Exemplary arrangements are shown in the following: e.g. first domain - first domain - first domain - second domain; first domain - first domain - second domain - first domain; first domain - second domain - first domain - first domain; or e.g. second domain - first domain - first domain - first domain. It is well understood for a skilled person that these examples are for illustration purposes only and shall not limit the scope of the invention thereto. Thus, the number of copies and the arrangement may be varied as defined initially. Preferably, the first and second domain(s) may be directly linked with each other without any linker.
  • linker sequence comprising 1 to 10, preferably 1 to 5 amino acids.
  • Amino acids forming the linker sequence are preferably selected from glycine or proline as amino acid residues. More preferably, the first and second domain(s) may be separated by each other by a hinge of two, three or more proline residues between the first and second domain(s).
  • the chimeric peptide as defined above and as used herein, comprising at least one first and at least one second domain, may be composed of L-amino acids, D-amino acids, or a combination of both.
  • each domain (as well as the linkers used) may be composed of L-amino acids, D-amino acids, or a combination of both (e.g. D-TAT and L-IB1 (s) or L- TAT and D-IB1 (s), etc.).
  • the chimeric peptide as used herein may comprise at least 1 or even 2, preferably at least 3, 4 or 5, more preferably at least 6, 7, 8 or 9 and even more preferably at least 10 or more D- and/or L-amino acids, wherein the D- and/or L- amino acids may be arranged in the chimeric peptide as used herein in a blockwise, a non- blockwise or in an alternate manner.
  • the chimeric peptide as used herein comprises or consists of the L-amino acid chimeric peptides according to the generic L-TAT-IB peptide NH 2 -X n b -RKKRRQRRR-X n b -X n a -RPTTLXLXXXXXXQD-X n b -COOH (L-TAT-IB (generic) (s)) [SEQ ID NO: 10], wherein X, X n a and X n b are preferably as defined above.
  • the chimeric peptide as used herein comprises or consists of the L-amino acid chimeric peptide NH 2 -GRK RRQRRRPPRPKRPTTLNLFPQVPRSQD-COOH (L-TAT-IB 1 (s)) [SEQ ID NO: 9].
  • the chimeric peptide as used herein comprises or consists of the L-amino acid chimeric peptide sequence GRKKRRQRRR PPDTYRPKRP TTLNLFPQVP RSQDT (L-TAT-IB1 ) [SEQ ID NO: 23], or XXXXXXRKK RRQRRRXXX XXXRPTTLX LXXXXXXQD S TX (L-TAT-IB generic) [SEQ ID NO: 24], wherein X is preferably also as defined above, or the chimeric peptide as used herein comprises or consists of the L-amino acid chimeric peptide sequence R KRRQRRRPPRPKRPTTLNLFPQVPRSQD (L-TAT-IB1 (s1 )) [SEQ ID NO: 27], GRKKRRQRRRX n c RP RPTTLNLFPQVPRSQD (L-TAT-IB1 (
  • each X typically represents an amino acid residue as defined above, more preferably X n c represents a contiguous stretch of peptide residues, each X independently selected from each other from glycine or proline, e.g. a monotonic glycine stretch or a monotonic proline stretch, wherein n (the number of repetitions of X n c ) is typically 0-5, 5- 10, 10-15, 15-20, 20-30 or even more, preferably 0-5 or 5-10.
  • X n c may represent either D or L amino acids.
  • the chimeric peptide as used herein comprises or consists of D-amino acid chimeric peptides of the above disclosed L-amino acid chimeric peptides.
  • Exemplary D retro-inverso chimeric peptides according to the present invention are e.g. the generic D-TAT-IB peptide NH 2 -X n b -DQXXXXXXLXLTTPR-X n a - X n b -RRRQRRKKR-X n b -COOH (D-TAT-IB (generic) (s)) [SEQ ID NO: 12].
  • X, X n a and X n b are preferably as defined above (preferably representing D amino acids). More preferably, the chimeric peptide as used herein comprises or consists of D-amino acid chimeric peptides according to the TAT-IB1 peptide NH 2 - DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-COOH (D-TAT-IB1 (s)) [SEQ ID NO: 1 1 ]. Alternatively or additionally, the chimeric peptide as used herein comprises or consists of the D-amino acid chimeric peptide sequence
  • TDQSRPVQPFLNLTTPR PRYTDPPRRRQRR RG (D-TAT-IB1 ) [SEQ ID NO: 25], or XT/SDQXXXXXLXLTTPRXXXXXXXRRRQRRKKRXXXXXX (D-TAT-IB generic) [SEQ ID NO: 26], wherein X is preferably also as defined above, or the chimeric peptide as used herein comprises or consists of the D-amino acid chimeric peptide sequence DQSRPVQPFLNLTTPRKPRPPRRRQRRKKR (D-TAT-IB1 (s1 )) [SEQ ID NO: 30], DQSRPVQPFLNLTTPR PRX n c RRRQRRKKRG (D-TAT-IB1 (s2)) [SEQ ID NO: 31 ], or DQSRPVQPFLNLTTPRKPRX n c RRRQRRKKR
  • the first and second domain(s) of the chimeric peptide as defined above may be linked to each other by chemical or biochemical coupling carried out in any suitable manner known in the art, e.g. by establishing a peptide bond between the first and the second domain(s) e.g. by expressing the first and second domain(s) as a fusion protein, or e.g. by crosslinking the first and second domain(s) of the chimeric peptide as defined above.
  • one way to increasing coupling specificity is a direct chemical coupling to a functional group present only once or a few times in one or both of the first and second domain(s) to be crosslinked.
  • cysteine which is the only protein amino acid containing a thiol group, occurs in many proteins only a few times.
  • a crosslinking reagent specific for primary amines will be selective for the amino terminus of that polypeptide.
  • Successful utilization of this approach to increase coupling specificity requires that the polypeptide have the suitably rare and reactive residues in areas of the molecule that may be altered without loss of the molecule's biological activity.
  • Cysteine residues may be replaced when they occur in parts of a polypeptide sequence where their participation in a crosslinking reaction would otherwise likely interfere with biological activity.
  • a cysteine residue is replaced, it is typically desirable to minimize resulting changes in polypeptide folding. Changes in polypeptide folding are minimized when the replacement is chemically and sterically similar to cysteine. For these reasons, serine is preferred as a replacement for cysteine.
  • a cysteine residue may be introduced into a polypeptide's amino acid sequence for crosslinking purposes. When a cysteine residue is introduced, introduction at or near the amino or carboxy terminus is preferred.
  • N-succinimidyl 3-(2-pyridyldithio) propionate SPDP
  • N,N'-(l ,3-phenylene) bismaleimide both of which are highly specific for sulfhydryl groups and form irreversible linkages
  • N, N'-ethylene-bis-(iodoacetamide) or other such reagent having 6 to 1 1 carbon methylene bridges which are relatively specific for sulfhydryl groups
  • 1 ,5-difluoro-2,4-dinitrobenzene which forms irreversible linkages with amino and tyrosine groups.
  • crosslinking reagents useful for this purpose include: p,p'-difluoro-m, m'-dinitrodiphenylsulfone which forms irreversible crosslinkages with amino and phenolic groups); dimethyl adipimidate (which is specific for amino groups); phenol-1,4 disulfonylchloride (which reacts principally with amino groups); hexamethylenediisocyanate or diisothiocyanate, or azophenyl-p-diisocyanate (which reacts principally with amino groups); glutaraldehyde (which reacts with several different side chains) and disdiazobenzidine (which reacts primarily with tyrosine and histidine).
  • Crosslinking reagents used for crosslinking the first and second domain(s) of the chimeric peptide as defined above may be homobifunctional, i.e. having two functional groups that undergo the same reaction.
  • a preferred homobifunctional crosslinking reagent is bismaleimidohexane ("BMH").
  • BMH contains two maleimide functional groups, which react specifically with sulfhydryl-containing compounds under mild conditions (pH 6.5-7.7). The two maleimide groups are connected by a hydrocarbon chain. Therefore, BMH is useful for irreversible crosslinking of polypeptides that contain cysteine residues.
  • Crosslinking reagents used for crosslinking the first and second domain(s) of the chimeric peptide as defined above may also be heterobifunctional.
  • Heterobifunctional crosslinking agents have two different functional groups, for example an amine-reactive group and a thiol-reactive group, that will crosslink two proteins having free amines and thiols, respectively.
  • heterobifunctional crosslinking agents are succinimidyl 4-(N- maleimidomethyl)cyclohexane-1 -carboxylate (“SMCC”), m-maleimidobenzoyl-N- hydroxysuccinimide ester (“MBS”), and succinimide 4-(p-maleimidophenyl)butyrate (“SMPB”), an extended chain analog of MBS.
  • SMCC succinimidyl 4-(N- maleimidomethyl)cyclohexane-1 -carboxylate
  • MBS m-maleimidobenzoyl-N- hydroxysuccinimide ester
  • SMPB succinimide 4-(p-maleimidophenyl)butyrate
  • Crosslinking reagents suitable for crosslinking the first and second domain(s) of the chimeric peptide as defined above often have low solubility in water.
  • a hydrophilic moiety such as a sulfonate group, may thus be added to the crosslinking reagent to improve its water solubility.
  • Sulfo-MBS and Sulfo-SMCC are examples of crosslinking reagents modified for water solubility, which may be used according to the present invention.
  • many crosslinking reagents yield a conjugate that is essentially non-cleavable under cellular conditions.
  • crosslinking reagents particularly suitable for crosslinking the first and second domain(s) of the chimeric peptide as defined above contain a covalent bond, such as a disulfide, that is cleavable under cellular conditions.
  • a covalent bond such as a disulfide
  • DSP dithiobis(succinimidylpropionate)
  • SPDP N-succinimidyl 3- (2-pyridyldithio)propionate
  • the use of a cleavable crosslinking reagent permits the cargo moiety to separate from the transport polypeptide after delivery into the target cel l. Direct disulfide linkage may also be useful.
  • crosslinking reagents including the ones discussed above, are commercially available. Detailed instructions for their use are readi ly available from the commercial suppliers. A general reference on protein crosslinking and conjugate preparation is: Wong, CHEMISTRY OF PROTEIN CONJUGATION AND CROSSLINKING, CRC Press (1991 ).
  • Chemical crosslinking of the first and second domain(s) of the chimeric peptide as defined above may include the use of spacer arms.
  • Spacer arms provide intramolecular flexibility or adjust intramolecular distances between conjugated moieties and thereby may help preserve biological activity.
  • a spacer arm may be in the form of a polypeptide moiety that includes spacer amino acids, e.g. proline.
  • a spacer arm may be part of the crosslinking reagent, such as in "long-chain SPDP" (Pierce Chem. Co., Rockford, IL., cat. No. 21 651 H).
  • variants, fragments or derivatives of one of the above disclosed chimeric peptides may be used herein.
  • a "variant of a chimeric peptide” is preferably a sequence derived from any of the sequences according to SEQ ID NOs: 9 to 12 and 23 to 32, wherein the chimeric variant comprises amino acid alterations of the chimeric peptides according to SEQ ID NOs: 9 to 12 and 23 to 32 as used herein.
  • Such alterations typically comprise 1 to 20, preferably 1 to 10 and more preferably 1 to 5 substitutions, additions and/or deletions (leading to fragments) of amino acids according to SEQ ID NOs: 9 to 12 and 23 to 32, wherein the altered chimeric peptide as used herein exhibits a sequence identity with any of the sequences according to SEQ ID NOs: 9-12 and 23 to 32 of at least about 30%, 50%, 70%, 80%, or 95%, 98%, or even 99%.
  • these variants retain the biological activity of the first and the second domain as contained in the chimeric peptide as used herein, i.e. the trafficking activity of the first domain as disclosed above and the activity of the second domain for binding JNK and/or inhibiting the activation of at least one JNK activated transcription factor.
  • the chimeric peptide as used herein also comprises fragments of the afore disclosed chimeric peptides, particularly of the chimeric peptide sequences according to any of SEQ ID NOs: 9 to 12 and 23 to 32.
  • a "fragment of the chimeric peptide" is preferably a sequence derived any of the sequences according to SEQ ID NOs: 9 to 12 and 23 to 32, wherein the fragment comprises at least 4 contiguous amino acids of any of SEQ ID NOs: 9 to 12 and 23 to 32.
  • This fragment preferably comprises a length which is sufficient to allow specific recognition of an epitope from any of these sequences and to transport the sequence into the cells, the nucleus or a further preferred location.
  • the fragment comprises 4 to 18, 4 to 15, or most preferably 4 to 10 contiguous amino acids of any of SEQ ID NOs: 9 to 12 and 23 to 32.
  • Fragments of the chimeric peptide as used herein further may be defined as a sequence sharing a sequence identity with any of the sequences according to any of SEQ ID NOs: 99 to 12 and 23 to 32 of at least about 30%, 50%, 70%, 80%, or 95%, 98%, or even 99%.
  • the chimeric peptide as used herein also comprises derivatives of the afore disclosed chimeric peptides, particularly of the chimeric peptide sequences according to any of SEQ ID NOs: 9 to 12 and 23 to 32.
  • a particularly preferred use of the present invention is the use of a JNK inhibitor (poly-)peptide consisting of or comprising the amino acid sequence of SEQ ID NO: 1 1 , or consisting of or comprising an amino acid sequence sharing a sequence identity of at least about 30%, 50%, 70%, 80%, 90%, 92% or even 95% with SEQ ID NO: 1 1 , for the treatment of inflammatory eye diseases, in particular for the treatment of uveitis, for example for the treatment of anterior uveitis, intermediate uveitis, posterior uveitis or panuveitis.
  • the JNK inhibitor (poly-)peptide consisting of or comprising the amino acid sequence of SEQ ID NO: 11 , or consisting of or comprising an amino acid sequence sharing a sequence identity of at least about 30%, 50%, 70%, 80%, 90%, 92% or even 95% with SEQ ID NO: 1 1 may be administered for example locally to the eye or systemically.
  • the present application also clearly contemplates the use of other JNK inhibitor chimeric (poly-)peptides, i.e.
  • JNK inhibitor poly-)peptide used does not consist of or comprise the amino acid sequence of SEQ ID NO: 1 1 for the treatment of inflammatory eye diseases, in particular for the treatment of uveitis, for example for the treatment of anterior uveitis, intermediate uveitis, posterior uveitis or panuveitis.
  • the inventors also clearly contemplate the use of the JNK inhibitor (poly-)peptides of the present invention, in particular where the JNK inhibitor polypeptide used consists of or comprises the amino acid sequence of SEQ ID NO: 1 1 or consists of or comprises an amino acid sequence sharing a sequence identity of at least about 30%, 50%, 70%, 80%, 90%, 92% or even 95% with SEQ ID NO: 1 1 , for the treatment of inflammatory eye diseases other than inflammation of the uvea and/or retina, e.g. for the treatment of inflammatory eye diseases which are not uveitis and/or retinitis.
  • the present invention does in particular not contemplate the treatment of (noninflammatory) retinopathy.
  • the present invention additionally refers to the use of nucleic acid sequences encoding JNK inhibitor sequences as defined above, chimeric peptides or their fragments, variants or derivatives, all as defined above, for the preparation of a pharmaceutical composition for treating non-chronic or chronic inflammatory eye diseases in a subject as defined herein.
  • a preferable suitable nucleic acid encoding an JNK inhibitor sequence as used herein is typically chosen from human IB1 nucleic acid (GenBank Accession No. (AF074091 ), rat IB1 nucleic acid (GenBank Accession No. AF 108959), or human IB2 (GenBank Accession No AF218778) or from any nucleic acid sequence encoding any of the sequences as defined above, i.e. any sequence according to SEQ ID NO: 1 -26.
  • Nucleic acids encoding the JNK inhibitor sequences as used herein or chimeric peptides as used herein may be obtained by any method known in the art (e.g. by PCR amplification using synthetic primers hybridizable to the 3'- and 5'-termini of the sequence and/or by cloning from a cDNA or genomic library using an oligonucleotide sequence specific for the given gene sequence).
  • nucleic acid sequences are disclosed herein as well, which hybridize under stringent conditions with the appropriate strand coding for a (native) JNK inhibitor sequence or chimeric peptide as defined above.
  • nucleic acid sequences comprise at least 6 (contiguous) nucleic acids, which have a length sufficient to allow for specific hybridization. More preferably, such nucleic acid sequences comprise 6 to 38, even more preferably 6 to 30, and most preferably 6 to 20 or 6 to 10 (contiguous) nucleic acids.
  • stringent conditions are sequence dependent and will be different under different circumstances. Generally, stringent conditions can be selected to be about 5°C lower than the thermal melting point (TM) for the specific sequence at a defined ionic strength and pH. The TM is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is at least about 0.02 molar at pH 7 and the temperature is at least about 60°C. As other factors may affect the stringency of hybridization (including, among others, base composition and size of the complementary strands), the presence of organic solvents and the extent of base mismatching, the combination of parameters is more important than the absolute measure of any one.
  • High stringency conditions may comprise the following, e.g. Step 1 : Filters containing DNA are pretreated for 8 hours to overnight at 65°C in buffer composed of 6*SSC, 50 mM Tris-HCI (pH 7.5), 1 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 pg/ml denatured salmon sperm DNA. Step 2: Filters are hybridized for 48 hours at 65°C. in the above prehybridization mixture to which is added 100 mg/ml denatured salmon sperm DNA and 5-20*10 6 cpm of 32 P-labeled probe.
  • Step 3 Filters are washed for 1 hour at 37°C in a solution containing 2*SSC, 0.01 % PVP, 0.01 % Ficoll, and 0.01 % BSA. This is followed by a wash in 0.1 *SSC at 50°C for 45 minutes.
  • Step 4 Filters are autoradiographed. Other conditions of high stringency that may be used are well known in the art (see e.g. Ausubel et a/., (eds.), 1993, Current Protocols in Molecular Biology, John Wiley and Sons, NY; and Kriegler, 1990, Gene Transfer and Expression, a Laboratory Manual, Stockton Press, NY).
  • Moderate stringency conditions can include the following: Step 1 : Filters containing DNA are pretreated for 6 hours at 55°C. in a solution containing 6*SSC, 5*Denhardt's solution, 0.5% SDS and 100 mg/ml denatured salmon sperm DNA. Step 2: Filters are hybridized for 18-20 hours at 55°C in the same solution with 5-20*10 6 cpm 32 P-labeled probe added. Step 3: Filters are washed at 37°C for 1 hour in a solution containing 2*SSC, 0.1 % SDS, then washed twice for 30 minutes at 60°C in a solution containing 1 *SSC and 0.1 % SDS.
  • Step 4 Filters are blotted dry and exposed for autoradiography.
  • Other conditions of moderate stringency that may be used are well-known in the art (see e.g. Ausubel et a/., (eds.), 1993, Current Protocols in Molecular Biology, John Wiley and Sons, NY; and Kriegler, 1990, Gene Transfer and Expression, a Laboratory Manual, Stockton Press, NY).
  • low stringency conditions can include: Step 1 : Filters containing DNA are pretreated for 6 hours at 40°C in a solution containing 35% formamide, 5X SSC, 50 mM Tris-HCI (pH 7.5), 5 mM EDTA, 0.1 % PVP, 0.1 % Ficoll, 1 % BSA, and 500 pg/ml denatured salmon sperm DNA.
  • Step 2 Filters are hybridized for 1 8-20 hours at 40°C in the same solution with the addition of 0.02% PVP, 0.02% Ficoll, 0.2% BSA, 100 pg/ml salmon sperm DNA, 10% (wt/vol) dextran sulfate, and 5-20 x 106 cpm 32 P-labeled probe.
  • Step 3 Filters are washed for 1 .5 hours at 55 C in a solution containing 2X SSC, 25 mM Tris-HCI (pH 7.4), 5 mM EDTA, and 0.1 % SDS. The wash solution is replaced with fresh solution and incubated an additional 1 .5 hours at 60°C.
  • Step 4 Filters are blotted dry and exposed for autoradiography.
  • filters are washed for a third time at 65-68°C and reexposed to film.
  • Other conditions of low stringency that may be used are well known in the art (e.g. as employed for cross-species hybridizations). See e.g. Ausubel et a/., (eds.), 1993, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley and Sons, NY; and Kriegler, 1990, GENE TRANSFER AND EXPRESSION, A LABORATORY MANUAL, Stockton Press, NY.
  • the nucleic acid sequences as defined above according to the present invention can be used to express peptides, i.e.
  • an JNK inhibitor sequence as used herein or an chimeric peptide as used herein for analysis, characterization or therapeutic use as markers for tissues in which the corresponding peptides (as used herein) are preferentially expressed (either constitutively or at a particular stage of tissue differentiation or development or in disease states).
  • Other uses for these nucleic acids include, e.g. molecular weight markers in gel electrophoresis-based analysis of nucleic acids.
  • expression vectors may be used for the above purposes for recombinant expression of one or more JNK inhibitor sequences and/or chimeric peptides as defined above.
  • expression vector is used herein to designate either circular or linear DNA or RNA, which is either double-stranded or single-stranded. It further comprises at least one nucleic acid as defined above to be transferred into a host cell or into a unicellular or multicellular host organism.
  • the expression vector as used herein preferably comprises a nucleic acid as defined above encoding the JNK inhibitor sequence as used herein or a fragment or a variant thereof, or the chimeric peptide as used herein, or a fragment or a variant thereof.
  • an expression vector according to the present invention preferably comprises appropriate elements for supporting expression including various regulatory elements, such as enhancers/promoters from viral, bacterial, plant, mammalian, and other eukaryotic sources that drive expression of the inserted polynucleotide in host cells, such as insulators, boundary elements, LCRs (e.g. described by Blackwood and Kadonaga (1998), Science 281, 61 -63) or matrix scaffold attachment regions (e.g. described by Li, Harju and Peterson, (1999), Trends Genet. 15, 403-408).
  • the regulatory elements are heterologous (i.e. not the native gene promoter).
  • promoter refers to a region of DNA that functions to control the transcription of one or more nucleic acid sequences as defined above, and that is structurally identified by the presence of a binding site for DNA-dependent RNA- polymerase and of other DNA sequences, which interact to regulate promoter function.
  • a functional expression promoting fragment of a promoter is a shortened or truncated promoter sequence retaining the activity as a promoter. Promoter activity may be measured by any assay known in the art (see e.g. Wood, de Wet, Dewji, and DeLuca, (1984), Biochem Biophys. Res. Commun. 124, 592-596; Seliger and McElroy, (1960), Arch. Biochem. Biophys. 88, 136-141 ) or commercially available from Promega ® ).
  • an “enhancer region” to be used in the expression vector as defined herein typically refers to a region of DNA that functions to increase the transcription of one or more genes. More specifically, the term “enhancer”, as used herein, is a DNA regulatory element that enhances, augments, improves, or ameliorates expression of a gene irrespective of its location and orientation vis-a-vis the gene to be expressed, and may be enhancing, augmenting, improving, or ameliorating expression of more than one promoter.
  • promoter/enhancer sequences to be used in the expression vector as defined herein may utilize plant, animal, insect, or fungus regulatory sequences.
  • promoter/enhancer elements can be used from yeast and other fungi (e.g. the GAL4 promoter, the alcohol dehydrogenase promoter, the phosphoglycerol kinase promoter, the alkaline phosphatase promoter).
  • yeast and other fungi e.g. the GAL4 promoter, the alcohol dehydrogenase promoter, the phosphoglycerol kinase promoter, the alkaline phosphatase promoter.
  • they may include animal transcriptional control regions, e.g. (i) the insulin gene control region active within pancreatic beta-cells (see e.g. Hanahan, et al, 1985.
  • the expression vector as defined herein may comprise an amplification marker.
  • This amplification marker may be selected from the group consisting of, e.g. adenosine deaminase (ADA), dihydrofolate reductase (DHFR), multiple drug resistance gene (MDR), ornithine decarboxylase (ODC) and N-(phosphonacetyl)-L-aspartate resistance (CAD).
  • Exemplary expression vectors or their derivatives suitable for the present invention particularly include, e.g. human or animal viruses (e.g. vaccinia virus or adenovirus); insect viruses (e.g. baculovirus); yeast vectors; bacteriophage vectors (e.g. lambda phage); plasmid vectors and cosmid vectors.
  • human or animal viruses e.g. vaccinia virus or adenovirus
  • insect viruses e.g. baculovirus
  • yeast vectors e.g. bacteriophage vectors (e.g. lambda phage); plasmid vectors and cosmid vectors.
  • the present invention additionally may uti lize a variety of host-vector systems, which are capable of expressing the peptide coding sequence(s) of nucleic acids as defined above.
  • host-vector systems which are capable of expressing the peptide coding sequence(s) of nucleic acids as defined above.
  • These include, but are not limited to: (i) mammalian cell systems that are infected with vaccinia virus, adenovirus, and the like; (ii) insect cell systems infected with baculovirus and the like; (iii) yeast containing yeast vectors or (iv) bacteria transformed with bacteriophage, DNA, plasmid DNA, or cosmid DNA.
  • any one of a number of suitable transcription and translation elements may be used.
  • a host cell strain suitable for such a host-vector system, may be selected that modulates the expression of inserted sequences of interest, or modifies or processes expressed peptides encoded by the sequences in the specific manner desired.
  • expression from certain promoters may be enhanced in the presence of certain inducers in a selected host strain; thus facilitating control of the expression of a genetically-engineered peptide.
  • different host cells possess characteristic and specific mechanisms for the translational and post-translational processing and modification (e.g. glycosylation, phosphorylation, and the like) of expressed peptides. Appropriate cell lines or host systems may thus be chosen to ensure the desired modification and processing of the foreign peptide is achieved.
  • peptide expression within a bacterial system can be used to produce an non-glycosylated core peptide; whereas expression within mammalian cells ensures "native" glycosylation of a heterologous peptide.
  • the present invention further provides the use of antibodies directed against the JNK inhibitor sequences and/or chimeric peptides as described above, for preparing a pharmaceutical composition for the treatment of non-chronic or chronic inflammatory eye diseases as defined herein.
  • efficient means for production of antibodies specific for JNK inhibitor sequences according to the present invention, or for chimeric peptides containing such an inhibitor sequence are described and may be utilized for this purpose.
  • JNK inhibitor sequences and/or chimeric peptides as defined herein, as well as, fragments, variants or derivatives thereof, may be utilized as immunogens to generate antibodies that immunospecifically bind these peptide components.
  • Such antibodies include, e.g. polyclonal, monoclonal, chimeric, single chain, Fab fragments and a Fab expression library.
  • the present invention provides antibodies to chimeric peptides or to JNK inhibitor sequences as defined above. Various procedures known within the art may be used for the production of these antibodies.
  • various host animals may be immunized for production of polyclonal antibodies by injection with any chimeric peptide or JNK inhibitor sequence as defined above.
  • Various adjuvants may be used thereby to increase the immunological response which include, but are not limited to, Freund's (complete and incomplete) adjuvant, mineral gels (e.g. aluminum hydroxide), surface active substances (e.g. lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), CpG, polymers, Pluronics, and human adjuvants such as Bacille Calmette-Guerin and Corynebacterium parvum.
  • any technique may be utilized that provides for the production of antibody molecules by continuous cell line culture.
  • Such techniques include, but are not limited to, the hybridoma technique (see Kohler and Milstein, 1975. Nature 256: 495-497); the trioma technique; the human B-cell hybridoma technique (see Kozbor, et al, 1983, Immunol Today 4: 72) and the EBV hybridoma technique to produce human monoclonal antibodies (see Cole, et al., 1985. In: Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96).
  • Human monoclonal antibodies may be utilized in the practice of the present invention and may be produced by the use of human hybridomas (see Cote, et a/., 1983. Proc Natl Acad Sci USA 80: 2026-2030) or by transforming human B-cells with Epstein Barr Virus in v/tro (see Cole, et a/.,1985. In: Monoclonal Antibodies and Cancer Therapy (Alan R. Liss, Inc., pp. 77-96).
  • techniques can be adapted for the production of single-chain antibodies specific to the JNK inhibitor sequences and/or chimeric peptides (see e.g. U. S. Patent No. 4,946,778) as defined herein.
  • methods can be adapted for the construction of Fab expression libraries (see e.g. Huse et a/., 1989. Science 246: 1275- 1281 ) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for these JNK inhibitor sequences and/or chimeric peptides.
  • Non-human antibodies can be "humanized" by techniques well known in the art (see e.g. U. S. Patent No. 5,225,539).
  • Antibody fragments that contain the idiotypes to a JNK inhibitor sequences and/or chimeric peptide as defined herein may be produced by techniques known in the art including, e.g. (i) a F(ab') 2 fragment produced by pepsin digestion of an antibody molecule; (ii) a Fab fragment generated by reducing the disulfide bridges of an F(ab') 2 fragment ; (iii) a Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent and (iv) Fv fragments.
  • ELISA enzyme-linked immunosorbent assay
  • selection of antibodies that are specific to a particular epitope of an JNK inhibitor sequence and/or an chimeric peptide as defined herein is facilitated by generation of hybridomas that bind to the fragment of an JNK inhibitor sequence and/or an chimeric peptide, as defined herein, possessing such an epitope.
  • ELISA enzyme-linked immunosorbent assay
  • the antibodies as defined herein may be used in methods known within the art referring to the localization and/or quantification of an JNK inhibitor sequence (and/or correspondingly to a chimeric peptide as defined above), e.g. for use in measuring levels of the peptide within appropriate physiological samples, for use in diagnostic methods, or for use in imaging the peptide, and the like.
  • JNK inhibitor sequences, chimeric peptides, nucleic acids, vectors, host cells and/or antibodies as defined according to the invention can be formulated in a pharmaceutical composition, which may be applied in the prevention or treatment of any of the diseases as defined herein, particularly in the prevention or treatment of non-chronic or chronic inflammatory eye diseases as defined herein.
  • such a pharmaceutical composition used according to the present invention includes as an active component, e.g.: (i) any one or more of the JNK inhibitor sequences and/or chimeric peptides as defined above, and/or variants, fragments or derivatives thereof, particularly JNK inhibitor sequences according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or chimeric peptides according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or JNK inhibitor sequences according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions; and/or (ii) nucleic acids encoding an JNK inhibitor sequence and/or an chimeric peptide as defined above and/or variants or fragments thereof, and/or (iii) cells comprising any one or more of
  • such a pharmaceutical composition as used according to the present invention typically comprises a safe and effective amount of a component as defined above, preferably of at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or at least one chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5-8 and 21 to 22, or variants or fragments thereof within the above definitions, or at least one nucleic acids encoding same, or at least one vector, host cell or antibody as defined above.
  • a component as defined above preferably of at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or at least one chimeric peptide according to any of sequences of S
  • the amount of a JNK-inhibitor sequence and chimeric peptide, respectively, in the pharmaceutical composition to be administered to a subject may -without being limited thereto - have a very low dose.
  • the dose may be much lower than for peptide drugs known in the art, such as DTS-1 08 (Florence Meyer-Losic et al., Clin Cancer Res., 2008, 2145-53). This has several positive aspects, for example a reduction of potential side reactions and a reduction in costs.
  • the dose (per kg bodyweight) is in the range of up to 10 mmol kg, preferably up to 1 mmol/kg, more preferably up to 100 pmol/kg, even more preferably up to 1 0 pmol/kg, even more preferably up to 1 pmol/kg, even more preferably up to 100 nmol/kg, most preferably up to 50 nmol/kg.
  • the dose range may preferably be from about 1 pmol/kg to about 1 mmol/kg, from about 1 0 pmol/kg to about 0, 1 mmol/kg, from about 10 pmol/kg to about 0,01 mmol/kg, from about 50 pmol/kg to about 1 pmol/kg, from about 100 pmol/kg to about 500 nmol/kg, from about 200 pmol/kg to about 300 nmol/kg, from about 300 pmol/kg to about 100 nmol/kg, from about 500 pmol/kg to about 50 nmol/kg, from about 750 pmol/kg to about 30 nmol/kg, from about 250 pmol/kg to about 5 nmol/kg, from about 1 nmol/kg to about 1 0 nmol/kg, or a combination of any two of said values.
  • a "safe and effective amount" as defined above for components of the pharmaceutical compositions as used according to the present invention means an amount of each or all of these components, that is sufficient to significantly induce a positive modification of a non-chronic or chronic inflammatory eye diseases as defined herein.
  • a "safe and effective amount” is small enough to avoid serious side-effects, that is to say to permit a sensible relationship between advantage and risk. The determination of these limits typically lies within the scope of sensible medical judgment.
  • a "safe and effective amount” of such a component will vary in connection with the particular condition to be treated and also with the age and physical condition of the patient to be treated, the severity of the condition, the duration of the treatment, the nature of the accompanying therapy, of the particular pharmaceutically acceptable carrier used, and similar factors, within the knowledge and experience of the accompanying doctor.
  • the pharmaceutical compositions according to the invention can be used according to the invention for human and also for veterinary medical purposes.
  • the pharmaceutical composition as used according to the present invention may furthermore comprise, in addition to one of these substances, a (compatible) pharmaceutically acceptable carrier, excipient, buffer, stabilizer or other materials well known to those skilled in the art.
  • a pharmaceutically acceptable carrier preferably includes the liquid or non-liquid basis of the composition.
  • compatible means that the constituents of the pharmaceutical composition as used herein are capable of being mixed with the pharmaceutically active component as defined above and with one another component in such a manner that no interaction occurs which would substantially reduce the pharmaceutical effectiveness of the composition under usual use conditions.
  • Pharmaceutically acceptable carriers must, of course, have sufficiently high purity and sufficiently low toxicity to make them suitable for administration to a person to be treated.
  • the pharmaceutically acceptable carrier will typically comprise one or more (compatible) pharmaceutically acceptable liquid carriers.
  • the composition may comprise as (compatible) pharmaceutically acceptable liquid carriers e.g. pyrogen-free water; isotonic saline or buffered (aqueous) solutions, e.g. phosphate, citrate etc. buffered solutions, vegetable oils, such as, for example, groundnut oil, cottonseed oil, sesame oil, olive oil, corn oil and oil from theobroma; polyols, such as, for example, polypropylene glycol, glycerol, sorbitol, mannitol and polyethylene glycol; alginic acid, etc..
  • a buffer preferably an aqueous buffer
  • the pharmaceutically acceptable carrier will typically comprise one or more (compatible) pharmaceutically acceptable solid carriers.
  • the composition may comprise as (compatible) pharmaceutically acceptable solid carriers e.g. one or more compatible solid or liquid fillers or diluents or encapsulating compounds may be used as well, which are suitable for administration to a person.
  • suitable pharmaceutically acceptable solid carriers are e.g.
  • sugars such as, for example, lactose, glucose and sucrose
  • starches such as, for example, corn starch or potato starch
  • cellulose and its derivatives such as, for example, sodium carboxymethylcellulose, ethylcellulose, cellulose acetate
  • powdered tragacanth malt
  • gelatin gelatin
  • tallow solid glidants, such as, for example, stearic acid, magnesium stearate; calcium sulphate, etc.
  • the precise nature of the (compatible) pharmaceutically acceptable carrier or other material may depend on the route of administration.
  • the choice of a (compatible) pharmaceutically acceptable carrier may thus be determined in principle by the manner in which the pharmaceutical composition as used according to the invention is administered.
  • the pharmaceutical composition as used according to the invention can be administered, for example, systemically.
  • Routes for administration include, for example, parenteral routes (e.g. via injection), such as intravenous, intramuscular, subcutaneous, intradermal, or transdermal routes, etc., enteral routes, such as oral, or rectal routes, etc., topical routes, such as nasal, or intranasal routes, etc., or other routes, such as epidermal routes or patch delivery.
  • parenteral routes e.g. via injection
  • enteral routes such as oral, or rectal routes, etc.
  • topical routes such as nasal, or intranasal routes, etc.
  • epidermal routes or patch delivery Partiularly preferred is also the local administration at/in the eye, e
  • the suitable amount of the pharmaceutical composition to be used can be determined by routine experiments with animal models. Such models include, without implying any limitation, rabbit, sheep, mouse, rat, dog and non-human primate models.
  • Preferred unit dose forms for injection include sterile solutions of water, physiological saline or mixtures thereof. The pH of such solutions should be adjusted to about 7.4.
  • Suitable carriers for injection include hydrogels, devices for controlled or delayed release, polylactic acid and collagen matrices.
  • Suitable pharmaceutically acceptable carriers for topical application include those, which are suitable for use in lotions, creams, gels and the like. If the compound is to be administered perorally, tablets, capsules and the like are the preferred unit dose form.
  • the pharmaceutically acceptable carriers for the preparation of unit dose forms which can be used for oral administration are well known in the prior art.
  • the choice thereof wi ll depend on secondary considerations such as taste, costs and storability, which are not critical for the purposes of the present invention, and can be made without difficulty by a person skilled in the art.
  • compositions for oral administration may be in tablet, capsule, powder or liquid form.
  • a tablet may include a solid carrier as defined above, such as gelatin, and optionally an adjuvant.
  • Liquid pharmaceutical compositions for oral administration generally may include a liquid carrier as defined above, such as water, petroleum, animal or vegetable oi ls, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
  • the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
  • Preservatives, stabilizers, buffers, antioxidants and/or other additives may be included, as required.
  • administration is preferably in a "prophylactically effective amount or a "therapeutically effective amount” (as the case may be), this being sufficient to show benefit to the individual.
  • a proliferatively effective amount or a "therapeutically effective amount” (as the case may be)
  • the actual amount administered, and rate and time-course of administration will depend on the nature and severity of what is being treated.
  • Prevention and/or treatment of a disease as defined herein typically includes administration of a pharmaceutical composition as defined above.
  • the term "modulate” includes the suppression of expression of JNK when it is over-expressed in any of the above diseases. It also includes, without being limited thereto, suppression of phosphorylation of c-jun, ATF2 or NFAT4 in any of the above diseases, for example, by using at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or at least one chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions, as a competitive inhibitor of the natural c-jun, ATF2 and NFAT4 binding
  • modulate also includes suppression of hetero- and homomeric complexes of transcription factors made up of, without being limited thereto, c-jun, ATF2, or NFAT4 and their related partners, such as for example the AP-1 complex that is made up of c-jun, AFT2 and c-fos.
  • suppressive JNK inhibitor sequences can be introduced to a cell.
  • modulate may then include the increase of JNK expression, for example by use of an IB peptide-specific antibody that blocks the binding of an IB-peptide to JNK, thus preventing JNK inhibition by the IB-related peptide.
  • Prevention and/or treatment of a subject with the pharmaceutical composition as disclosed above may be typically accomplished by administering ⁇ in vivo) an ("therapeutically effective") amount of said pharmaceutical composition to a subject, wherein the subject may be e.g. any mammal, e.g. a human, a primate, mouse, rat, dog, cat, cow, horse or pig.
  • therapeutically effective means that the active component of the pharmaceutical composition is of sufficient quantity to ameliorate the non-chronic or chronic inflammatory eye disease.
  • peptides as defined above e.g. at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or at least one chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions, may be utilized in a specific embodiment of the present invention to treat non-chronic or chronic inflammatory eye diseases.
  • Peptides as defined above and as contained in the inventive pharmaceutical composition may be also encoded by nucleic acids. This is particularly advantageous, if the above peptides are administered for the purpose of gene therapy.
  • gene therapy refers to therapy that is performed by administration of a specific nucleic acid as defined above to a subject, e.g. by way of a pharmaceutical composition as defined above, wherein the nucleic acid(s) exclusively comprise(s) L-amino acids.
  • the nucleic acid produces its encoded peptide(s), which then serve(s) to exert a therapeutic effect by modulating function of the disease or disorder.
  • Any of the methods relating to gene therapy available within the art may be used in the practice of the present invention (see e.g. Goldspiel, eta/., 1993. Clin Pharm 12: 488-505).
  • the nucleic acid as defined above and as used for gene therapy is part of an expression vector encoding and expressing any one or more of the IB-related peptides as defined above within a suitable host, i.e. an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or a chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions.
  • a suitable host i.e. an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or a chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to
  • such an expression vector possesses a promoter that is operably-l inked to coding region(s) of a JNK inhibitor sequence.
  • the promoter may be defined as above, e.g. inducible or constitutive, and, optionally, tissue-specific.
  • a nucleic acid molecule as defined above is used for gene therapy, in which the coding sequences of the nucleic acid molecule (and any other desired sequences thereof) as defined above are flanked by regions that promote homologous recombination at a desired site within the genome, thus providing for intra-chromosomal expression of these nucleic acids (see e.g. Koller and Smithies, 1989. Proc Natl Acad Sci USA 86: 8932-8935).
  • nucleic acid as defined above according to the invention into a patient for the purpose of gene therapy, particular in the context of the above mentioned non-chronic or chronic inflammatory eye diseases as defined above may be either direct (i.e. the patient is directly exposed to the nucleic acid or nucleic acid-containing vector) or indirect (i.e. cells are first transformed with the nucleic acid in vitro, then transplanted into the patient). These two approaches are known, respectively, as in vivo or ex vivo gene therapy.
  • a nucleic acid is directly administered in vivo, where it is expressed to produce the encoded product. This may be accomplished by any of numerous methods known in the art including, e.g.
  • nucleic acid as part of an appropriate nucleic acid expression vector and administering the same in a manner such that it becomes intracellular (e.g. by infection using a defective or attenuated retroviral or other viral vector; see U. S. Patent No. 4,980,286); directly injecting naked DNA; using microparticle bombardment (e.g.
  • a "GeneGun” Biolistic, DuPont
  • coating the nucleic acids with lipids using associated cell-surface receptors/transfecting agents; encapsulating in liposomes, microparticles, or microcapsules; administering it in linkage to a peptide that is known to enter the nucleus; or by administering it in linkage to a ligand predisposed to receptor-mediated endocytosis (see e.g. Wu and Wu, 1987.J Biol Chem 262: 4429-4432), which can be used to "target" cell types that specifically express the receptors of interest, etc.
  • An additional approach to gene therapy in the practice of the present invention involves transferring a nucleic acid as defined above into cells in in vitro tissue culture by such methods as electroporation, lipofection, calcium phosphate-mediated transfection, viral infection, or the like.
  • the method of transfer includes the concomitant transfer of a selectable marker to the cells.
  • the cells are then placed under selection pressure (e.g. antibiotic resistance) so as to facilitate the isolation of those cells that have taken up, and are expressing, the transferred gene.
  • selection pressure e.g. antibiotic resistance
  • Those cells are then delivered to a patient.
  • the nucleic acid prior to the in vivo administration of the resulting recombinant cell, the nucleic acid is introduced into a cell by any method known within the art including e.g.
  • transfection electroporation, microinjection, infection with a viral or bacteriophage vector containing the nucleic acid sequences of interest, cell fusion, chromosome-mediated gene transfer, microcell-mediated gene transfer, spheroplast fusion, and similar methods that ensure that the necessary developmental and physiological functions of the recipient cells are not disrupted by the transfer. See e.g. Loeffler and Behr, 1993. Meth Enzymol 21 7 : 599- 618.
  • the chosen technique should provide for the stable transfer of the nucleic acid to the cell, such that the nucleic acid is expressible by the cell.
  • the transferred nucleic acid is heritable and expressible by the cell progeny.
  • the resulting recombinant cells may be delivered to a patient by various methods known within the art including, e.g. injection of epithelial cells (e.g. subcutaneously), application of recombinant skin cells as a skin graft onto the patient, and intravenous injection of recombinant blood cells (e.g. hematopoietic stem or progenitor cells).
  • epithelial cells e.g. subcutaneously
  • recombinant skin cells as a skin graft onto the patient
  • recombinant blood cells e.g. hematopoietic stem or progenitor cells.
  • the total amount of cells that are envisioned for use depend upon the desired effect, patient state, and the like, and may be determined by one skilled within the art.
  • Cells into which a nucleic acid can be introduced for purposes of gene therapy encompass any desired, available cell type, and may be xenogeneic, heterogeneic, syngeneic, or autogeneic.
  • Cell types include, but are not limited to, differentiated cells such as epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes and blood cells, or various stem or progenitor cells, in particular embryonic heart muscle cells, liver stem cells (International Patent Publication WO 94/08598), neural stem cells (Stemple and Anderson, 1992, Cell 71 : 973-985), hematopoietic stem or progenitor cells, e.g. as obtained from bone marrow, umbilical cord blood, peripheral blood, fetal liver, and the like.
  • the cells utilized for gene therapy are autologous to the patient.
  • targeting therapies may be used to deliver the JNK inhibitor sequences, chimeric peptides, and/or nucleic acids as defined above more specifically to certain types of cell, by the use of targeting systems such as (a targeting) antibody or cell specific ligands.
  • targeting systems such as (a targeting) antibody or cell specific ligands.
  • Antibodies used for targeting are typically specific for cell surface proteins of cells associated with any of the diseases as defined below.
  • these antibodies may be directed to cell surface antibodies such as e.g. B eel I -associated surface proteins such as MHC class II DR protein, CD18 (LFA-1 beta chain), CD45RO, CD40 or Bgp95, or cell surface proteins selected from e.g.
  • Targeting constructs may be typically prepared by covalently binding the JNK inhibitor sequences, chimeric peptides, and nucleic acids as defined herein according to the invention to an antibody specific for a cell surface protein or by binding to a cell specific ligand. Proteins may e.g. be bound to such an antibody or may be attached thereto by a peptide bond or by chemical coupling, crosslinking, etc..
  • the targeting therapy may then be carried out by administering the targeting construct in a pharmaceutically efficient amount to a patient by any of the administration routes as defined below, e.g. intraperitoneal, nasal, intravenous, oral and patch delivery routes.
  • the JNK inhibitor sequences, chimeric peptides, or nucleic acids as defined herein according to the invention, being attached to the targeting antibodies or cell specific ligands as defined above may be released in vitro or in vivo, e.g. by hydrolysis of the covalent bond, by peptidases or by any other suitable method.
  • the JNK inhibitor sequences, chimeric peptides, or nucleic acids as defined herein according to the invention are attached to a small cell specific ligand, release of the ligand may not be carried out. If present at the cell surface, the chimeric peptides may enter the cell upon the activity of its trafficking sequence. Targeting may be desirable for a variety of reasons; for example if the JNK inhibitor sequences, chimeric peptides, and nucleic acids as defined herein according to the invention are unacceptably toxic or if it would otherwise require a too high dosage.
  • the JNK inhibitor sequences and/or chimeric peptides as defined herein according to the invention could be produced in the target cells by expression from an encoding gene introduced into the cells, e.g. from a viral vector to be administered.
  • the viral vector typically encodes the JNK inhibitor sequences and/or chimeric peptides as defined herein according to the invention.
  • the vector could be targeted to the specific cells to be treated.
  • the vector could contain regulatory elements, which are switched on more or less selectively by the target cells upon defined regulation.
  • This technique represents a variant of the VDEPT technique (virus-directed enzyme prodrug therapy), which utilizes mature proteins instead of their precursor forms.
  • the JNK inhibitor sequences and/or chimeric peptides as defined herein could be administered in a precursor form by use of an antibody or a virus. These JNK inhibitor sequences and/or chimeric peptides may then be converted into the active form by an activating agent produced in, or targeted to, the cells to be treated.
  • an activating agent produced in, or targeted to, the cells to be treated.
  • This type of approach is sometimes known as ADEPT (antibody-directed enzyme prodrug therapy) or VDEPT (virus- directed enzyme prodrug therapy); the former involving targeting the activating agent to the cells by conjugation to a cell-specific antibody, while the latter involves producing the activating agent, e.g. a JNK inhibitor sequence or the chimeric peptide, in a vector by expression from encoding DNA in a viral vector (see for example, EP-A-415731 and WO 90/07936).
  • immunoassays to detect, prognose, diagnose, or monitor various conditions and disease states selected from non-chronic or chronic inflammatory eye diseases as defined above, or monitor the treatment thereof.
  • the immunoassay may be performed by a method comprising contacting a sample derived from a patient with an antibody to an JNK inhibitor sequence, a chimeric peptide, or a nucleic acid sequence, as defined above, under conditions such that immunospecific-binding may occur, and subsequently detecting or measuring the amount of any immunospecific-binding by the antibody.
  • an antibody specific for an JNK inhibitor sequence, a chimeric peptide or a nucleic acid sequence may be used to analyze a tissue or serum sample from a patient for the presence of JNK or a JNK inhibitor sequence; wherein an aberrant level of JNK is indicative of a diseased condition.
  • the immunoassays include, but are not limited to, competitive and non-competitive assay systems using techniques such as Western Blots, radioimmunoassays (RIA), enzyme linked immunosorbent assay (ELISA), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, fluorescent immunoassays, complement- fixation assays, immunoradiometric assays, and protein-A immunoassays, etc..
  • ⁇ in vitro assays may be performed by delivering the JNK inhibitor sequences, chimeric peptides, nucleic acid sequences or antibodies to JNK inhibitor sequences or to chimeric peptides, as defined above, to target cells typically selected from e.g. cultured animal cells, human cells or micro-organisms, and to monitor the cell response by biophysical methods typically known to a skilled person.
  • the target cells typically used therein may be cultured cells ⁇ in vitro) or in vivo cells, i.e. cells composing the organs or tissues of living animals or humans, or microorganisms found in living animals or humans.
  • kits for diagnostic or therapeutic purposes particular for the treatment, prevention or monitoring of non-chronic or chronic inflammatory eye diseases as defined above
  • the kit includes one or more containers containing JNK inhibitor sequences, chimeric peptides, nucleic acid sequences and/or antibodies to these JNK inhibitor sequences or to chimeric peptides as defined above, e.g.
  • an anti-JNK inhibitor sequence antibody to an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100, to a chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, to an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or to or variants or fragments thereof within the above definitions, or such an anti-JNK inhibitor sequence antibody and, optionally, a labeled binding partner to the antibody.
  • kits for diagnostic use in the treatment, prevention or monitoring of non-chronic or chronic inflammatory eye diseases as defined above which comprise one or more containers containing nucleic acids that encode, or alternatively, that are the complement to, an JNK inhibitor sequence and/or a chimeric peptide as defined above, optionally, a labeled binding partner to these nucleic acids, are also provided.
  • the kit may be used for the above purposes as a kit, comprising one or more containers, a pair of oligonucleotide primers (e.g.
  • kits may, optionally, further comprise a predetermined amount of a purified JNK inhibitor sequence as defined above, a chimeric peptide as defined above, or nucleic acids encoding these, for use as a diagnostic, standard, or control in the assays for the above purposes.
  • A-C SEQ ID NO: 1 1 was undetectable in ocular tissues 24 hours after IV injection in healthy eyes.
  • D-L After IVT injection in healthy eyes, SEQ ID NO: 1 was found in iris epithelium (D, G), ciliary body epithelium (E, J), GCL (H), INL (K), IS (I) and RPE (L).
  • SEQ ID NO: 1 1 was detected in infiltrating inflammatory cells after IV injection of SEQ ID NO: 1 1 (M-P), but not after IV or IVT injections of vehicle (not shown) or in untreated EIU eyes (V,W).
  • Q-U In uveitic eyes treated by IVT of SEQ ID NO: 11, distribution of SEQ ID NO: 1 1 was similar to that of healthy treated eyes but was also detected in migrating resident inflammatory cells (S-T). Scale bar: 50 ⁇ .
  • c cornea; ir: iris; I: lens; cb: ciliary body; st: stroma; ep: epithelium; GCL: ganglion cell layer; INL: inner nuclear layer; ONL: outer nuclear layer; RPE: retinal pigment epithelium; IS: photoreceptor inner segment; aq. h: aqueous humor.
  • the (poly-)peptide of SEQ ID NO: 1 1 decreased the number of PMNs after intravenous (IV) (** p ⁇ 0.005 vs LPS) and intravitreous (IVT) (** p ⁇ 0.005 vs LPS; 9 it p ⁇ 0.009 vs Vehicle) administrations. No statistical difference (ns) was observed between IVT of the (poly-)peptide of SEQ ID NO: 1 1 and dexamethasone that was used as a positive control.
  • RT-PCR analysis of inducible nitric oxide synthase (iNOS) mRNA levels in neuroretinas 24 hours after IV or IVT injections of SEQ ID NO:1 1 or vehicle (n 2 eyes per group) in EIU conditions.
  • iNOS inducible nitric oxide synthase
  • Figure 1 1 shows the IB1 protein sequence from rat encoded by the exon-intron boundary of the rIBl gene - splice donor (SEQ ID NO:103)
  • Figure 12 shows the IB1 protein sequence from Homo sapiens (SEQ ID NO:l 04)
  • Figure 13 shows the IB1 cDNA sequence from Homo sapiens fSEQ ID NO:105)
  • Example 1 Solutions and products
  • the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 powder was dissolved under sterile conditions at the concentration of 1 0 ⁇ in saline (NaCl 0.9%, Versol®, Aguettant) in a National Scientific (NSC) deactivated glass vial (NSC-C401 5- S1 ) and stored at 4°C until use.
  • Dexamethasone sodium phosphate 4 mg/mL (Soludecadron; Laboratoire Roussel, Paris, France) was used as positive control for anti inflammatory activity on EIU.10 Animals
  • Rats 7 weeks old female Lewis rats weighing 1 75 g (Eievage Janvier, Le Genest Saint Isle, France) were used and handled in accordance with the ARVO Statement for the Use of Animals in Ophthalmic and Vision Research. Rats were anesthetized with intramuscular injection of Ketamine (88 mg/kg) (Virbac, France) and Largactil (0.6 mg/kg) (Sanofi-Aventis, France) before intravenous or ocular injection.
  • Ketamine 88 mg/kg
  • Largactil 0.6 mg/kg
  • IV injection 100 pL of saline (NaCl 0.9%) or the JNK-inhibitor (polypeptide of SEQ ID NO: 1 1 (20 pg/kg in saline) were injected in a tail vein using a 25G- needle connected on a 1 mL syringe (Becton Dickinson, France).
  • IVT intravitreous
  • 5 pL of saline or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 5 pL of saline or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 (0.2 pg/injection in saline) were injected in both eyes using a 30G disposable needle (BD- microfine syringe, nm Medical, Asniere, France).
  • the IV dose of 20 pg kg (i.e. 3.5 pg rat in rats weighing 175g) was chosen according to studies showing that the JNK-inhibitor (polypeptide of SEQ ID NO: 1 1 is active at very low doses in other models.
  • the inventors used the minimal dose used in direct ear application after acute noise trauma in patients. This corresponds to 5% of the dose injected intravenously.
  • EIU Endotoxin-lnduced Uveitis
  • Aqueous humor and vitreous were collected and pooled from each enucleated eye. Ocular fluids were immediately centrifuged and the cell-free fractions were collected and frozen at -20°C before analysis by Multiplex assay. Blood samples were first clotted at room temperature for 2 hours and then at 4°C overnight. Serum was collected, centrifuged and the clear supernatant was collected and frozen at -20°C before Multiplex analysis. Retinas and RPE/choroid/sclera complexes were carefully dissected out on enucleated eyes, snap frozen and stored at -80°C until being used for RT-PCR and Western-Blot analyses.
  • eyeballs were collected and fixed for 1 h at room temperature in phosphate buffered saline (PBS) containing 4% paraformaldehyde before being rinsed overnight in PBS. The next day, samples were embedded and frozen in optimal cutting- temperature (OCT) compound (Tissue-Tek®, Sakura Finetek, Zoeterwoude, Netherland) and stored at -80°C. Frozen antero-posterior sections of eyes (10 pm thick) were performed at the optic nerve level using a cryostat (Leica CM 3050S, Rueil-Malmaison, France) and mounted on super-frost slides for immunohistochemical analysis.
  • OCT optimal cutting- temperature
  • mice were randomized into 14 experimental groups with 5 rats per group. Uveitis was induced in each group and rats were killed 6 hours (4 groups), 24 hours (6 groups) and 48 hours (4 groups) after LPS challenge.
  • rats treated by intravenous or intravitreous injections of vehicle (NaCI 0.9%) or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 were compared to untreated control uveitic rats.
  • Two additional groups, treated by intravenous injection of vehicle and intravitreal injection of dexamethasone were used at 24 hours.
  • a second set of experiment was designed to evaluate the anti-inflammatory effect of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 at the cellular and tissue level as well as the biodistribution of this molecule 24 hours after administration.
  • Rats were randomized into 1 1 experimental groups. 6 groups of rats with uveitis: untreated uveitic rats, rats injected intravenously with NaCI or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 and rats injected intravitreously with the vehicle, the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 or dexamethasone.
  • the 5 additional groups without uveitis were: untreated healthy rats, rats treated by NaCI IV or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 IV and rats injected IVT with NaCI or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 .
  • Three eyes from separate rats were collected per group and used for immunohistochemistry.
  • EIU Endotoxin-lnduced Uveitis
  • grade (0) indicates no inflammation
  • grade (1 ) indicates the presence of a minimal iris and conjunctival vasodilation but without the observation of flare or cells in the anterior chamber (AC)
  • grade (2) indicates the presence of moderate iris and conjunctival vessel dilation but without evident flare or cells in the AC
  • grade (3) indicates the presence of intense iris vessels dilation, flare and less than 10 cells per slit lamp field in the AC
  • grade (4) indicates the presence of more severe clinical signs than grade 3, with more than 10 cells in the AC with or without the formation of a hypopion
  • grade (5) indicates the presence of intense inflammatory reaction, fibrin formation in the AC and total seclusion of the pupil.
  • Clinical evaluation was performed in a masked manner.
  • RPE/choroid/sclera complexes and neuroretinas (2 per experimental group) were snap frozen immediately after dissection and stored at -80°C until use.
  • Tissues were homogenized in 500 pL of lysis buffer (MOPS SDS Running Buffer, Invitrogen, Cergy- Pontoise, France) supplemented with protease inhibitor cocktail (Roche Diagnostics, Meylan, France) (one tablet for 50 mL).
  • LDS Sample Buffer Invitrogen
  • heating for 5 min at 100°C equal amounts of proteins were subjected to electrophoresis in a NuPAGE 4-12% Bis-Tris gel (Invitrogen) using MOPS SDS Running Buffer.
  • the bands obtained were then electrotransferred onto nitrocellulose membranes (Schleicher & Schuell Bioscience, Dassel, Germany).
  • blots were sequentially incubated with a rabbit phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) (4370) primary antibody (or rabbit phospho-p38 MAPK (Thr180 Tyr182) (9215) antibody) and a horseradish peroxidase- conjugated goat anti-rabbit IgG (H+L) (PI-1000 - Vector Laboratories, Clinisciences, Montrouge, France) secondary antibody at dilution 1 :5000.
  • a rabbit phospho-p44/42 MAPK Erk1/2
  • Thr202/Tyr204 (4370) primary antibody
  • rabbit phospho-p38 MAPK Thr180 Tyr182
  • H+L horseradish peroxidase- conjugated goat anti-rabbit IgG
  • Blots were then dehybridized and rehybridized successively with a rabbit p44/42 MAPK (Erk1/2) (4695) (or rabbit p38 MAP Kinase (9212) antibody) and the same secondary antibody as above.
  • Primary antibodies were purchased from Cell Signaling Technology (Ozyme, St Quentin Yvelines, France) and all steps performed following the manufacturer's instruction.
  • Immunostaining of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 was performed on healthy and uveitic eyes to study its ocular biodistribution after systemic or local administration. Briefly, sections were permeabilized as described above before being sequentially incubated with an anti- SEQ ID NO: 1 1 purified rabbit IgG and a secondary Alexa 594 (red)-conjugated goat anti-rabbit IgG (Invitrogen, Cergy Pontoise, France) diluted 1 :100 and 1 :250 in PBS respectively. Immunostaining of untreated healthy and uveitic eyes were used as negative controls. Nuclei were stained with DAPI before mounting and observation.
  • Immunostaining of p-Erk1/2 was performed to evaluate the effect of the JNK-inhibitor (polypeptide of SEQ ID NO: 1 1 on the ERK pathway after IV or IVT administration. Sections were permeabilized as described above and incubated in blocking solution containing 0.1 % Triton X-100 and 10% FCS (fetal calf serum) in PBS for 1 hour at room temperature. Sections were incubated overnight at 4°C with a rabbit anti-phospho-p44/42 MAPK (Erk1/2) primary antibody (4370) purchased from Cell Signaling Technology (Ozyme, St Quentin Yvelines, France) diluted 1 :400 in blocking solution.
  • JNK-inhibitor polypeptide of SEQ ID NO: 1 1 on the ERK pathway after IV or IVT administration. Sections were permeabilized as described above and incubated in blocking solution containing 0.1 % Triton X-100 and 10% FCS (fetal calf serum) in PBS for 1 hour at room temperature
  • PCR Polymerase-Chain Reaction
  • TGTGTCTGCAGATGTGCTGAAAC-3' were obtained from Invitrogen. After an initial denaturation (3 min at 94°Q, 30 to 32 PCR cycles of denaturation (30 s, 94°C), annealing (1 min, 58°C (GAPDH) and 52°C (iNOS)) and elongation (1 to 2 min, 72°C) were performed on a Crocodile III (Appligene Oncor). The final cycle was completed by 5 min of elongation at 72°C. PCR fragments (162 bp for GAPDH and 657 bp for iNOS) were analyzed by 2.5% agarose gel electrophoresis and visualized by ethidium bromide staining under UV light. The relative band intensity for iNOS was calculated in comparison to that for GAPDH after densitometry analysis (ImageJ software).
  • Intraocular fluids (diluted to obtain a final volume of 25 pL) and sera (25 pL of 1 :5 dilution) were subjected to multiplex bead analysis.
  • This method uses microspheres as the solid support for immunoassays12 and allows the titration of a greater number of cytokines with increased sensitivity than occurs with ELISA.13
  • seventeen analytes were quantified simultaneously using the rat Cytokine/Chemokine-1 7plex kit (Milliplex Map Kit, Millipore, Saint-Quentin-en-Yvelines, France) according to the manufacturer's instructions: Chemokines MCP-1/CCL2, MIP-1a/CCL3, RANTES/CCL5, IP-10/CXCL10 (IFN-inducible protein-10) and GRO/KC ; proinflammatory mediators IL-1 , IL-18 and TNF- ; Th1 Th2 Th1 7 cytokines IL-2 and IFN- / IL-4, IL-5
  • the assay was performed in a 96-well filter plate and standard curves for each cytokine were generated with a Rat Cytokine Standard provided in the kit. All incubation steps were performed under medium orbital agitation and in the dark to protect the beads from light. Data acquisition and analysis were performed with the manager software version 4.1 (Bioplex; Bio-Rad) with four or five logistic parameters for standard curves. Detection thresholds for all the analytes were estimated around 1 to 10 pg/mL. Statistical analysis
  • the all-D-retro-inverso JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 significantly reduced endotoxins induced uveitis (E1U).
  • the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 significantly reduced EIU clinical scores after 20 pg/kg intravenous (IV) injection (2.0 ⁇ 0.1 ) compared to untreated uveitic eyes (3.2 ⁇ 0.1 , p ⁇ 0.001 ) and vehicle IV (3.2 ⁇ 0.1 , p ⁇ 0.001 ) ( Figure 1 A).
  • JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 could have any effect on the other MAPK pathways.
  • the phosphorylation state of Erk1/2 and p38 was evaluated. Whereas Erk1/2 and p38 were detected in RPE/choroid complexes at similar levels among all groups, the phosphorylation form of these two MAPK could not be detected by western-blot analysis (data not shown).
  • JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 was detected mainly in the iris/ ciliary body epithelium (panels G and J) and in the retinal pigment epithelium (panel L).
  • Penetration of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 was also detected in the iris stroma (panel G) as well as in the neural retina in the ganglion cell layer (GCL, panel H), the inner nuclear layer (INL, panel K) and the inner segment (IS, panel I) of photoreceptor cells (PR).
  • the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 accumulated within the cytoplasm. Occasional staining was found in the corneal endothelium and in the lens capsule.
  • the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 was mostly found in ocular tissues like in healthy eyes and in resident cells that are mobilized and participate actively to the inflammatory processes in pathological conditions such as microglial cells (panels S-T). A significant reduction in cells infiltrating the ocular tissues resulted from the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 administration
  • IVT of the JNK- inhibitor (poly-)peptide of SEQ ID NO: 1 1 significantly reduced ED1 positive infiltrating cells (93 ⁇ 8) as compared to vehicle IVT injected eyes (1 75 ⁇ 1 5, p ⁇ 0.009) and untreated uveitic eyes (p ⁇ 0.005) (Figure 5A).
  • the reducing effect of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 on ED1 positive cell infiltration (93 ⁇ 8) did not differ from that induced by dexamethasone (79 ⁇ 1 5), suggesting that both treatments have a similar efficacy on this parameter.
  • the number of polymorphonuclear cells (PMN) ( Figure 5B) was also significantly reduced at 24 hours after IV administration of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 (60 + 6) as compared to control eyes (237 ⁇ 15, p ⁇ 0.005), and after IVT injection of the JNK- inhibitor (poly-)peptide of SEQ ID NO: 1 1 (40 ⁇ 5) as compared to IVT injection of the vehicle (1 52 ⁇ 31 , p ⁇ 0.009) and control uveitic eyes (p ⁇ 0.005).
  • the effect of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 on PMN ocular tissue infiltration did not significantly differ from that of dexamethasone (42 ⁇ 1 1 ).
  • the JNK-inhibitor (poly-)peptide of SEQ ID NO: 1 1 down regulates iNOS expression
  • iNOS inducible nitric oxide synthase
  • chemokines and cytokines were dosed by multiplex analysis on ocular media ( Figures 8 and 9) and sera .
  • Th1 cytokines such as TNF-a, IL-6 and INF- ⁇ were significantly reduced at different time points while IL-10 tended to increase at 6 hours in treated eye (but not significantly), suggesting a switch towards a Th2 profile (Figure 8B). No statistical differences were noticed between eyes from vehicle IV injected rats and untreated uveitic control eyes.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Zoology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Ophthalmology & Optometry (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/EP2010/006284 2010-10-14 2010-10-14 Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases Ceased WO2012048721A1 (en)

Priority Applications (19)

Application Number Priority Date Filing Date Title
CA2807036A CA2807036C (en) 2010-10-14 2010-10-14 Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
PCT/EP2010/006284 WO2012048721A1 (en) 2010-10-14 2010-10-14 Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
JP2013533091A JP5857056B2 (ja) 2010-10-14 2010-10-14 慢性又は非慢性の炎症性眼疾患を治療するためのjnkシグナル伝達経路の細胞透過性ペプチド阻害剤の使用
US13/879,059 US9150618B2 (en) 2010-10-14 2010-10-14 Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
AU2010362444A AU2010362444B2 (en) 2010-10-14 2010-10-14 Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
DK14004427.2T DK2902035T3 (en) 2010-10-14 2011-10-14 METHODS FOR TREATING MUSCLE DYROPHY
PL11775734.4T PL2627346T3 (pl) 2010-10-14 2011-10-14 Przechodzące przez komórkę peptydowe inhibitory szlaku przekazywania sygnałów przez JNK do zastosowania w leczeniu zapalenia błony naczyniowej oka
DK11775734.4T DK2627346T3 (en) 2010-10-14 2011-10-14 Cell permeable peptide inhibitors of the JNK signal transduction pathway for use in the treatment of uveitis
HK14100332.1A HK1187266B (en) 2010-10-14 2011-10-14 Cell-permeable peptide inhibitors of the jnk signal transduction pathway for use in the treatment of uveitis
ES11775734.4T ES2575226T3 (es) 2010-10-14 2011-10-14 Péptidos permeables celulares inhibidores de la ruta de transducción de la señal JNK para su uso en el tratamiento de la uiveítis
EP11775734.4A EP2627346B1 (en) 2010-10-14 2011-10-14 Cell-permeable peptide inhibitors of the jnk signal transduction pathway for use in the treatment of uveitis
EP14004427.2A EP2902035B1 (en) 2010-10-14 2011-10-14 Cell-permeable peptide inhibitors of the JNK signal transduction pathway for use in the treatment of inflammatory eye diseases.
PCT/EP2011/005172 WO2012048893A1 (en) 2010-10-14 2011-10-14 Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
ES14004427T ES2688030T3 (es) 2010-10-14 2011-10-14 Péptidos permeables celulares inhibidores de la ruta de transducción de la señal JNK para su uso en el tratamiento de enfermedades oculares inflamatorias
PL14004427T PL2902035T3 (pl) 2010-10-14 2011-10-14 Przechodzące przez komórkę peptydowe inhibitory szlaku przekazywania sygnałów przez JNK do zastosowania w leczeniu chorób zapalnych oka
US14/849,374 US20160089413A1 (en) 2010-10-14 2015-09-09 Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
HK15111042.8A HK1210056A1 (en) 2010-10-14 2015-11-09 Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
US15/934,735 US10967038B2 (en) 2010-10-14 2018-03-23 Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
CY181100963T CY1120936T1 (el) 2010-10-14 2018-09-18 Αναστολεις πεπτιδιου toy μονοπατιου μεταγωγης σηματος jnk οι οποιοι διαπερνουν το κυτταρο για χρηση εις την αγωγη της ραγοειδιτιδας

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
PCT/EP2010/006284 WO2012048721A1 (en) 2010-10-14 2010-10-14 Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/879,059 A-371-Of-International US9150618B2 (en) 2010-10-14 2010-10-14 Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
US14/849,374 Division US20160089413A1 (en) 2010-10-14 2015-09-09 Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases

Publications (1)

Publication Number Publication Date
WO2012048721A1 true WO2012048721A1 (en) 2012-04-19

Family

ID=44123322

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2010/006284 Ceased WO2012048721A1 (en) 2010-10-14 2010-10-14 Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases

Country Status (5)

Country Link
US (3) US9150618B2 (enExample)
JP (1) JP5857056B2 (enExample)
AU (1) AU2010362444B2 (enExample)
CA (1) CA2807036C (enExample)
WO (1) WO2012048721A1 (enExample)

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013091670A1 (en) * 2011-12-21 2013-06-27 Xigen S.A. Novel jnk inhibitor molecules for treatment of various diseases
US8569447B2 (en) 1999-10-12 2013-10-29 Xigen Sa Cell-permeable peptide inhibitors of the JNK signal transduction pathway
US8748395B2 (en) 2005-09-12 2014-06-10 Xigen Inflammation Ltd. Cell-permeable peptide inhibitors of the JNK signal transduction pathway
US8981052B2 (en) 2010-06-21 2015-03-17 Xigen Inflammation Ltd. JNK inhibitor molecules
US9006185B2 (en) 2008-05-30 2015-04-14 Xigen Inflammation Ltd. Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases
US9150618B2 (en) 2010-10-14 2015-10-06 Xigen Inflammation Ltd. Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
US9180159B2 (en) 2008-05-30 2015-11-10 Xigen Inflammation Ltd. Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases
JP2016523274A (ja) * 2013-06-26 2016-08-08 ザイジェン インフラメーション リミテッド 種々の疾患を処置するためのjnkシグナル伝達経路の新規の細胞透過性ペプチド阻害剤の使用
JP2016523275A (ja) * 2013-06-26 2016-08-08 ザイジェン インフラメーション リミテッド 多様な疾患を処置するためのjnk阻害剤分子の新規な用途
WO2018029336A1 (en) 2016-08-12 2018-02-15 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for determining whether a subject was administered with an activator of the ppar beta/delta pathway.
US10023615B2 (en) 2008-12-22 2018-07-17 Xigen Inflammation Ltd. Efficient transport into white blood cells
US11331364B2 (en) 2014-06-26 2022-05-17 Xigen Inflammation Ltd. Use for JNK inhibitor molecules for treatment of various diseases
US11779628B2 (en) 2013-06-26 2023-10-10 Xigen Inflammation Ltd. Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2947508A1 (en) * 2014-06-26 2015-12-30 Xigen Inflammation Ltd. New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases
US20180085391A1 (en) * 2014-08-08 2018-03-29 Modernatx, Inc. Compositions and methods for the treatment of ophthalmic diseases and conditions

Citations (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1990007936A1 (en) 1989-01-23 1990-07-26 Chiron Corporation Recombinant therapies for infection and hyperproliferative disorders
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US4980286A (en) 1985-07-05 1990-12-25 Whitehead Institute For Biomedical Research In vivo introduction and expression of foreign genetic material in epithelial cells
EP0415731A2 (en) 1989-08-30 1991-03-06 The Wellcome Foundation Limited Novel entities for cancer therapy
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
WO1994008598A1 (en) 1992-10-09 1994-04-28 Advanced Tissue Sciences, Inc. Liver reserve cells
WO1997005265A1 (en) 1995-07-28 1997-02-13 Marie Curie Cancer Care Transport proteins and their uses
US5674980A (en) 1989-12-21 1997-10-07 Biogen Inc Fusion protein comprising tat-derived transport moiety
US5804604A (en) 1989-12-21 1998-09-08 Biogen, Inc. Tat-derived transport polypeptides and fusion proteins
WO2004054501A2 (en) * 2002-11-18 2004-07-01 Celgene Corporation Methods of usig and compositions comprising (-)-3-(3,4-dimethoxy-phenyl)-3-(1-oxo-1,3-dihydro-isoindol-2-yl)-propionamide
US20080008749A1 (en) * 2006-07-06 2008-01-10 Eric Pearlman Ceramide composition and method of use
WO2009143865A1 (en) * 2008-05-30 2009-12-03 Xigen S.A. Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases
WO2009143864A1 (en) * 2008-05-30 2009-12-03 Xigen S.A. Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases
WO2010113753A1 (ja) * 2009-03-30 2010-10-07 参天製薬株式会社 JNK(c-Junアミノ末端キナーゼ)阻害ペプチドを用いた網膜疾患の予防または治療剤、網膜疾患の予防または治療方法、ならびに、その使用

Family Cites Families (144)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS5824085B2 (ja) 1978-02-28 1983-05-19 井関農機株式会社 コンバイン用カッタ−
JPS561156A (en) 1979-06-15 1981-01-08 Matsushita Electric Works Ltd Grounding tool for negative potential treating appliance
IT1195304B (it) 1981-12-22 1988-10-12 Anic Spa Metodo per la preparazione di gem-diammino derivati n-monoacilati
US4631211A (en) 1985-03-25 1986-12-23 Scripps Clinic & Research Foundation Means for sequential solid phase organic synthesis and methods using the same
US4698327A (en) 1985-04-25 1987-10-06 Eli Lilly And Company Novel glycopeptide derivatives
IT1190389B (it) 1985-09-19 1988-02-16 Eniricerche Spa Esapeptidi ad attivita' ipotensiva
US5169933A (en) 1988-08-15 1992-12-08 Neorx Corporation Covalently-linked complexes and methods for enhanced cytotoxicity and imaging
IT1227907B (it) 1988-12-23 1991-05-14 Eniricerche S P A Milano Sclav Procedimento per la sintesi di peptidi retro-inversi e nuovi intermediin tale procedimento
US6316003B1 (en) 1989-12-21 2001-11-13 Whitehead Institute For Biomedical Research Tat-derived transport polypeptides
US5840313A (en) 1990-09-27 1998-11-24 Syntello Vaccine Development Kb Peptides for use in vaccination and induction of neutralizing antibodies against human immunodeficiency virus
WO1992018138A1 (en) 1991-04-10 1992-10-29 The General Hospital Corporation Mammalian gap-43 compositions and methods of use
US5994108A (en) 1991-11-05 1999-11-30 Board Of Regents, The University Of Texas System Mutant TAR virus and transdominant tat mutants as pharmacological agents
US5350835A (en) 1991-11-05 1994-09-27 Board Of Regents, University Of Texas Cellular nucleic acid binding protein and uses thereof in regulating gene expression and in the treatment of aids
EP0632722A4 (en) 1992-03-20 1997-07-30 Baylor College Medicine DNA TRANSPORTATION SYSTEM AND INSTRUCTIONS FOR USE.
AU682308C (en) 1992-04-03 2006-08-17 Regents Of The University Of California, The Self-assembling polynucleotide delivery system
EP0673385A4 (en) 1992-08-13 1995-11-29 Gen Hospital Corp COMPOSITIONS CONCERNING GAP-43 MAMMALS AND METHODS OF USE.
EP0903408A3 (en) 1992-08-21 2005-11-02 Biogen, Inc. Tat-derived transport polypeptide
JP4116072B2 (ja) 1992-08-27 2008-07-09 バイオクローンズ(プロプライエタリー)リミテッド 逆向き、鏡像体および逆向き鏡像体合成ペプチド類似物
US5545551A (en) 1992-08-28 1996-08-13 Mt. Sinai School Of Medicine Of The City University Of New York Cloning and expression of pur protein
EP0693939A1 (de) 1993-04-14 1996-01-31 Roche Diagnostics GmbH Nukleinsäure-transferpeptide und deren verwendung zur einschleusung von nukleinsäuren in eukaryontische zellen
CA2153480A1 (en) 1993-11-12 1995-06-01 Kenichi Matsubara Gene signature
US5595756A (en) 1993-12-22 1997-01-21 Inex Pharmaceuticals Corporation Liposomal compositions for enhanced retention of bioactive agents
US5807746A (en) 1994-06-13 1998-09-15 Vanderbilt University Method for importing biologically active molecules into cells
EP0767833A1 (en) 1995-04-25 1997-04-16 Baxter International Inc. Composition containing collagenase and chymopapain for isolating hepatocytes and pancreatic islet cells
CA2232750A1 (en) 1995-09-21 1997-03-27 Innapharma, Inc. Peptides and peptidomimetics inhibiting the oncogenic action of p21 ras
IE80466B1 (en) 1995-11-10 1998-07-29 Elan Corp Plc Peptides which enhance transport across tissues and methods of identifying and using the same
US5877282A (en) 1996-09-20 1999-03-02 Bristol-Myers Squibb Company Peptide inhibitors of nuclear protein translocation having nuclear localization sequences and methods of use thereof
US6187817B1 (en) 1996-10-03 2001-02-13 Southern Illinois University School Of Medicine Therapeutic use of d-methionine to reduce the toxicity of platinum-containing anti-tumor compounds
US6361938B1 (en) 1996-11-08 2002-03-26 Elan Corporation, Plc Peptides which enhance transport across tissues and methods of identifying and using the same
AU7410998A (en) 1996-11-26 1998-06-22 Johns Hopkins University, The Ligand detection system and methods of use thereof
US5989814A (en) 1997-04-01 1999-11-23 Reagents Of The University Of California Screening methods in eucaryotic cells
US5880261A (en) 1997-04-03 1999-03-09 Waeber; Gerard Transcription factor Islet-Brain 1 (IB1)
AU6972798A (en) 1997-04-18 1998-11-13 University Of Medicine And Dentistry Of New Jersey Inhibition of hiv-1 replication by a tat rna-binding domain peptide analog
US6043083A (en) 1997-04-28 2000-03-28 Davis; Roger J. Inhibitors of the JNK signal transduction pathway and methods of use
CA2290756A1 (en) 1997-05-15 1998-11-19 Cytogen Corporation Random peptides that bind to gastro-intestinal tract (git) transport receptors and related methods
US20040152084A1 (en) 2003-01-31 2004-08-05 Slattum Paul M. Compounds and processes for single-pot attachment of a label to nucleic acid
ES2210761T3 (es) 1997-05-21 2004-07-01 The Board Of Trustees Of The Leland Stanford Junior University Composicion y procedimiento para mejorar el transporte a traves de las membranas biologicas.
FR2767323B1 (fr) 1997-08-12 2001-01-05 Synt Em Peptides lineaires derives de peptides antibiotiques, leur preparation et leur utilisation pour vectoriser des substances actives
EP0897002A3 (en) 1997-08-14 2001-10-04 Smithkline Beecham Plc U62317, a protein having a JNK-binding domain
WO1999016787A1 (en) 1997-09-26 1999-04-08 Washington University Cell death agonists
US6420031B1 (en) 1997-11-03 2002-07-16 The Trustees Of Princeton University Highly transparent non-metallic cathodes
EP1025102B1 (en) 1997-10-20 2004-05-19 F. Hoffmann-La Roche Ag Bicyclic kinase inhibitors
US6270956B1 (en) 1997-12-11 2001-08-07 The Salk Institute For Biological Studies Transcriptional coactivator that interacts with Tat protein and regulates its binding to TAR RNA, methods for modulating Tat transactivation, and uses therefor
EP0947524A1 (en) 1998-03-30 1999-10-06 Upither B.V. Novel peptides for the treatment of autoimmune diseases
US6248558B1 (en) 1998-03-31 2001-06-19 Vanderbilt University Sequence and method for genetic engineering of proteins with cell membrane translocating activity
CA2330458A1 (en) 1998-04-29 1999-11-04 Georgetown University Methods of identifying and using hla binding compounds as hla-agonists and antagonists
WO1999058692A2 (en) 1998-05-13 1999-11-18 Incyte Pharmaceuticals, Inc. Human apoptosis associated proteins
US6811992B1 (en) 1998-05-14 2004-11-02 Ya Fang Liu Method for identifying MLK inhibitors for the treatment of neurological conditions
AU3714499A (en) 1998-05-14 1999-11-29 Pasteur Merieux Serums Et Vaccins Hepatitis c virus mimotopes
CA2331384A1 (en) 1998-06-18 1999-12-23 Dnavec Research Inc. Nucleic acid transfer phage
US6589503B1 (en) 1998-06-20 2003-07-08 Washington University Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy
US8038984B2 (en) 1998-06-20 2011-10-18 Washington University Membrane-permeant peptide complexes for treatment of sepsis
AU755564B2 (en) 1998-06-20 2002-12-12 Washington University Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy
DE69914611T2 (de) 1998-08-28 2004-12-23 Gryphon Therapeutics, Inc., South San Francisco Verfahren zur herstellung von polyamidketten von genauer länge und deren konjugate mit proteinen
WO2000018407A1 (en) 1998-09-25 2000-04-06 Cephalon, Inc. Methods for preventing/treating damage to sensory hair cells and cochlear neurons
US20020090696A1 (en) 1998-12-08 2002-07-11 Miller Carol A. Treating neurological disorders using human apoptosis inhibiting protein
US6656474B1 (en) 1999-01-15 2003-12-02 Regeneron Pharmaceuticals, Inc. Methods of using a neurotrophin and its analogues for the treatment of gastrointestinal hypomotility disorders
US6673908B1 (en) 1999-02-22 2004-01-06 Nuvelo, Inc. Tumor necrosis factor receptor 2
CA2373814A1 (en) 1999-05-28 2001-02-15 Apoptosis Technology, Inc. Compounds and methods for regulating apoptosis, and methods of making and screening for compounds that regulate apoptosis
US7510824B2 (en) 1999-06-02 2009-03-31 Nono Inc. Method of screening peptides useful in treating traumatic injury to the brain or spinal cord
WO2000075118A1 (en) 1999-06-03 2000-12-14 Vertex Pharmaceuticals Incorporated INHIBITORS OF c-JUN N-TERMINAL KINASES (JNK)
DK1102785T3 (da) 1999-06-07 2013-05-13 Arrowhead Res Corp Sammensætninger til lægemiddeltilførsel ved anvendelse af pH-følsomme molekyler
EP1210121A2 (en) 1999-08-24 2002-06-05 Cellgate Inc. Enhancing drug delivery across and into epithelial tissues using oligo arginine moieties
US6669951B2 (en) 1999-08-24 2003-12-30 Cellgate, Inc. Compositions and methods for enhancing drug delivery across and into epithelial tissues
WO2001015511A2 (en) 1999-09-01 2001-03-08 University Of Pittsburgh Of The Commonwealth System Of Higher Education Identification of peptides that facilitate uptake and cytoplasmic and/or nuclear transport of proteins, dna and viruses
US20030104622A1 (en) 1999-09-01 2003-06-05 Robbins Paul D. Identification of peptides that facilitate uptake and cytoplasmic and/or nuclear transport of proteins, DNA and viruses
US20040082509A1 (en) 1999-10-12 2004-04-29 Christophe Bonny Cell-permeable peptide inhibitors of the JNK signal transduction pathway
US20030108539A1 (en) 2000-02-14 2003-06-12 Christophe Bonny Cell-permeable peptide inhibitors of the JNK signal transduction pathway
US6610820B1 (en) 1999-10-12 2003-08-26 University Of Lausanne Cell-permeable peptide inhibitors of the JNK signal transduction pathway
US8183339B1 (en) 1999-10-12 2012-05-22 Xigen S.A. Cell-permeable peptide inhibitors of the JNK signal transduction pathway
CA2392615A1 (en) 1999-12-06 2001-06-07 The General Hospital Corporation Pancreatic stem cells and their use in transplantation
ES2335643T3 (es) 1999-12-16 2010-03-31 Biogen Idec Ma Inc. Metodos de tratamiento de lesion isquemica o hemorragica del sistema nervioso central usando antagonistas anti-integrinas alfa 4.
ATE508138T1 (de) 2000-06-16 2011-05-15 Serodus As N- und/oder c-terminal mit kurzen geladenen peptidsequenzen modifizierte peptide
US6586403B1 (en) 2000-07-20 2003-07-01 Salpep Biotechnology, Inc. Treating allergic reactions and inflammatory responses with tri-and dipeptides
US6897231B2 (en) 2000-07-31 2005-05-24 Signal Pharmaceuticals, Inc. Indazole derivatives as JNK inhibitors and compositions and methods related thereto
US7033597B2 (en) 2000-10-13 2006-04-25 Université de Lausanne Intracellular delivery of biological effectors
CA2425610A1 (en) 2000-10-13 2002-04-18 University Of Lausanne Intracellular delivery of biological effectors by novel transporter peptide sequences
ES2386505T3 (es) 2000-10-17 2012-08-22 Diatranz Otsuka Limited Preparación y xenotrasplante de islotes de cerdo
US20030077826A1 (en) 2001-02-02 2003-04-24 Lena Edelman Chimeric molecules containing a module able to target specific cells and a module regulating the apoptogenic function of the permeability transition pore complex (PTPC)
US7199124B2 (en) 2001-02-02 2007-04-03 Takeda Pharmaceutical Company Limited JNK inhibitor
WO2002062396A2 (en) 2001-02-08 2002-08-15 University Of Medicine And Dentistry Of New Jersey Enhanced oral and transcompartmental delivery of therapeutic or diagnostic agents using polymer conjugates
WO2002065986A2 (en) 2001-02-16 2002-08-29 Cellgate, Inc. Transporters comprising spaced arginine moieties
CA2442909C (en) 2001-04-06 2011-11-29 Thomas Jefferson University Multimerization of hiv-1 vif protein as a therapeutic target
DE10117281A1 (de) 2001-04-06 2002-10-24 Inst Molekulare Biotechnologie Peptid zur Diagnose und Therapie der Alzheimer-Demenz
US20060216706A1 (en) 2001-07-17 2006-09-28 Tang Y T Proteins associated with cell growth, differentiation, and death
WO2004045535A2 (en) 2002-11-14 2004-06-03 Arbor Vita Corporation Molecular interactions in neurons
ATE420879T1 (de) 2001-09-19 2009-01-15 Aventis Pharma Sa Indolizine als kinaseproteinhemmer
GB0129044D0 (en) 2001-12-05 2002-01-23 Koninkl Philips Electronics Nv Data storage methods and apparatuses with basic and extended file system capacity
US7803749B2 (en) 2002-01-09 2010-09-28 Xigen Sa Peptide inhibitors of MKK7 kinase binding to insulin binding proteins
EP1487436A4 (en) 2002-03-08 2009-06-03 Signal Pharm Inc POLYTHERAPY FOR TREATING, PREVENTING OR MANAGING PROLIFERATIVE DISORDERS AND CANCERS
SE0201863D0 (en) 2002-06-18 2002-06-18 Cepep Ab Cell penetrating peptides
JP2004066595A (ja) 2002-08-05 2004-03-04 Canon Finetech Inc 記録装置およびレジストレーション用パターンの記録方法
CA2496400A1 (en) 2002-09-09 2004-03-18 Dana-Farber Cancer Institute, Inc. Bh3 peptides and method of use thereof
AU2003278727A1 (en) 2002-09-20 2004-04-08 Alcon, Inc. Use of cytokine synthesis inhibitors for the treatment of dry eye disorders
PT1408114E (pt) 2002-10-11 2007-04-30 Imvision Gmbh Moléculas modulares de transportes de antigénios ( moléculas mat ) para modulação de respostas imunitárias, correspondentes construções, processos e utilizações.
WO2004037196A2 (en) 2002-10-24 2004-05-06 Sangstat Medical Corporation Cytomodulating peptides and methods for treating neurological disorders
RU2005118425A (ru) 2002-11-15 2006-02-10 Сэнгстат Медикал Корпорейшн (Us) Цитомодуляторные пептиды для лечения интерстициального цистита
US20050019366A1 (en) 2002-12-31 2005-01-27 Zeldis Jerome B. Drug-coated stents and methods of use therefor
US7166692B2 (en) 2003-03-04 2007-01-23 Canbrex Bio Science Walkersville, Inc. Intracellular delivery of small molecules, proteins, and nucleic acids
JP4787150B2 (ja) 2003-03-06 2011-10-05 エーザイ・アール・アンド・ディー・マネジメント株式会社 Jnk阻害剤
WO2004092339A2 (en) 2003-04-11 2004-10-28 Ilex Products, Inc. Modulation of muc1 mediated signal transduction
ES2351976T3 (es) 2003-04-29 2011-02-14 Avi Biopharma, Inc. Composiciones para mejorar el transporte y la eficacia antisentido de análogos de ácidos nucleicos en células.
WO2005084158A2 (en) 2003-06-20 2005-09-15 The Regents Of The University Of California Polypeptide transduction and fusogenic peptides
US20050048995A1 (en) 2003-08-25 2005-03-03 Motorola, Inc. System and method for controlling the operating characteristics of a buffer
KR100685345B1 (ko) 2004-03-27 2007-02-22 학교법인조선대학교 세포사 유도 펩타이드
KR20060134198A (ko) 2004-04-08 2006-12-27 어플라이드 리서치 시스템스 에이알에스 홀딩 엔.브이. Jnk 저해제 및 시클로스포린을 포함하는 조성물
WO2006021458A2 (en) 2004-08-27 2006-03-02 Gpc Biotech Ag Pyrimidine derivatives
US7286835B1 (en) 2004-09-10 2007-10-23 Airespace, Inc. Enhanced wireless node location using differential signal strength metric
US20060094753A1 (en) 2004-10-29 2006-05-04 Alcon, Inc. Use of inhibitors of Jun N-terminal kinases for the treatment of glaucomatous retinopathy and ocular diseases
US20100256041A1 (en) 2004-11-12 2010-10-07 Christophe Bonny Conjugate Molecule Compounds With Enhanced Cell Uptake Activity
EP1656951A1 (en) 2004-11-12 2006-05-17 Xigen S.A. Conjugates with enhanced cell uptake activity
EP1661912A1 (en) 2004-11-29 2006-05-31 Xigen S.A. Fusion protein comprising a BH3-domain of a BH3-only protein
EP1676574A3 (en) 2004-12-30 2006-07-26 Johnson & Johnson Vision Care, Inc. Methods for promoting survival of transplanted tissues and cells
US20060223807A1 (en) 2005-03-29 2006-10-05 University Of Massachusetts Medical School, A Massachusetts Corporation Therapeutic methods for type I diabetes
US20060258706A1 (en) 2005-04-29 2006-11-16 Manohar Saindane Solid forms of a JNK inhibitor
US20070015779A1 (en) 2005-04-29 2007-01-18 John Griffin Compositions and treatments for inhibiting kinase and/or hmg-coa reductase
US20070003531A1 (en) 2005-06-30 2007-01-04 University Of Connecticut Methods for improving immunotherapy by enhancing survival of antigen-specific cytotoxic T lymphocytes
US8080517B2 (en) * 2005-09-12 2011-12-20 Xigen Sa Cell-permeable peptide inhibitors of the JNK signal transduction pathway
WO2007031098A1 (en) 2005-09-12 2007-03-22 Xigen S.A. Cell-permeable peptide inhibitors of the jnk signal transduction pathway
EP1884521A1 (en) 2006-07-31 2008-02-06 Xigen S.A. Fusion peptide for inhibiting interaction of neuronal NMDA receptor (NMDAR) and NMDAR interacting proteins
WO2008094208A2 (en) 2006-08-02 2008-08-07 Northwestern University Protein kinase targeted therapeutics
JP5325783B2 (ja) 2006-09-08 2013-10-23 エフ.ホフマン−ラ ロシュ アーゲー ベンゾトリアゾールキナーゼモジュレーター
CA2663545A1 (en) 2006-09-19 2008-03-27 Phylogica Limited Neuroprotective peptide inhibitors of ap-1 signaling and uses thereof
GB0702259D0 (en) 2007-02-06 2007-03-14 Eisai London Res Lab Ltd 7-azaindole derivatives
KR101611824B1 (ko) 2008-04-29 2016-04-12 파넥스트 세포 스트레스 반응 조절을 통한 알츠하이머 질환 및 관련 장애의 치료를 위한 신규 치료학적 접근법
PL2285364T3 (pl) 2008-05-07 2015-04-30 Univ California Terapeutyczne uzupełnienie i wzbogacenie smarowania powierzchni oka
US20100183633A1 (en) 2008-12-04 2010-07-22 University Of Massachusetts Interleukin 6 and tumor necrosis factor alpha as biomarkers of jnk inhibition
WO2010072228A1 (en) 2008-12-22 2010-07-01 Xigen S.A. Novel transporter constructs and transporter cargo conjugate molecules
WO2010073104A2 (en) 2008-12-23 2010-07-01 Carmel - Haifa University Economic Corp Ltd. Improving cognitive function
WO2010091310A1 (en) 2009-02-06 2010-08-12 Elan Pharmaceuticals, Inc. Inhibitors of jun n-terminal kinase
JP2013508401A (ja) 2009-10-22 2013-03-07 ジェネンテック, インコーポレイテッド 軸索変性の調節
AU2010339414A1 (en) 2009-12-31 2012-07-19 Stealth Peptides International, Inc. Methods for performing a coronary artery bypass graft procedure
WO2011160653A1 (en) 2010-06-21 2011-12-29 Xigen S.A. Novel jnk inhibitor molecules
WO2012048893A1 (en) 2010-10-14 2012-04-19 Xigen S.A. Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
JP5857056B2 (ja) * 2010-10-14 2016-02-10 ザイジェン インフラメーション エルティーディー 慢性又は非慢性の炎症性眼疾患を治療するためのjnkシグナル伝達経路の細胞透過性ペプチド阻害剤の使用
US8471027B2 (en) 2011-04-06 2013-06-25 Hoffmann-La Roche Inc. Adamantyl compounds
BR112014013041A2 (pt) 2011-11-30 2019-09-24 Xigen Inflammation Ltd uso de inibidores de peptídeos de permeação celular do curso de transdução de sinal de jnk para o tratamento da síndrome do olho seco
WO2013091670A1 (en) 2011-12-21 2013-06-27 Xigen S.A. Novel jnk inhibitor molecules for treatment of various diseases
PL3013353T3 (pl) 2013-06-26 2021-09-20 Xigen Inflammation Ltd. Przenikające do komórki inhibitory peptydowe szlaku przekazywania sygnału jnk do leczenia zapalenia pęcherza
WO2014206426A1 (en) 2013-06-26 2014-12-31 Xigen Inflammation Ltd. New use for jnk inhibitor molecules for treatment of various diseases
WO2014206427A1 (en) 2013-06-26 2014-12-31 Xigen Inflammation Ltd. New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases
JP2015197193A (ja) 2014-04-02 2015-11-09 トヨタ自動車株式会社 車両用無段変速機の油圧制御装置
EP3160989A2 (en) 2014-06-26 2017-05-03 Xigen Inflammation Ltd. New use for jnk inhibitor molecules for treatment of various diseases
EP3313428A1 (en) 2015-06-26 2018-05-02 Xigen Inflammation Ltd. New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of mild cognitive impairment

Patent Citations (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4980286A (en) 1985-07-05 1990-12-25 Whitehead Institute For Biomedical Research In vivo introduction and expression of foreign genetic material in epithelial cells
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
WO1990007936A1 (en) 1989-01-23 1990-07-26 Chiron Corporation Recombinant therapies for infection and hyperproliferative disorders
EP0415731A2 (en) 1989-08-30 1991-03-06 The Wellcome Foundation Limited Novel entities for cancer therapy
US5804604A (en) 1989-12-21 1998-09-08 Biogen, Inc. Tat-derived transport polypeptides and fusion proteins
US5674980A (en) 1989-12-21 1997-10-07 Biogen Inc Fusion protein comprising tat-derived transport moiety
WO1994008598A1 (en) 1992-10-09 1994-04-28 Advanced Tissue Sciences, Inc. Liver reserve cells
WO1997005265A1 (en) 1995-07-28 1997-02-13 Marie Curie Cancer Care Transport proteins and their uses
WO2004054501A2 (en) * 2002-11-18 2004-07-01 Celgene Corporation Methods of usig and compositions comprising (-)-3-(3,4-dimethoxy-phenyl)-3-(1-oxo-1,3-dihydro-isoindol-2-yl)-propionamide
US20080008749A1 (en) * 2006-07-06 2008-01-10 Eric Pearlman Ceramide composition and method of use
WO2009143865A1 (en) * 2008-05-30 2009-12-03 Xigen S.A. Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases
WO2009143864A1 (en) * 2008-05-30 2009-12-03 Xigen S.A. Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases
WO2010113753A1 (ja) * 2009-03-30 2010-10-07 参天製薬株式会社 JNK(c-Junアミノ末端キナーゼ)阻害ペプチドを用いた網膜疾患の予防または治療剤、網膜疾患の予防または治療方法、ならびに、その使用

Non-Patent Citations (49)

* Cited by examiner, † Cited by third party
Title
"CURRENT COMMUNICATIONS IN MOLECULAR BIOLOGY", 1986, COLD SPRING HARBOR LABORATORY PRESS, article "Computer Graphics and Molecular Modeling"
"Current Protocols in Molecular Biology", 1993, JOHN WILEY AND SONS
"METHODS IN PROTEIN SCIENCE", 1997, J. WILEY AND SONS
"REMINGTON'S PHARMACEUTICAL SCIENCES", 1980
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
BLACKWOOD; KADONAGA, SCIENCE, vol. 281, 1998, pages 61 - 63
BRADY ET AL., NATURE, vol. 368, 1994, pages 692 - 693
CHOU; FASMAN, BIOCHEM, vol. 13, 1974, pages 222 - 223
COLE ET AL.: "|n Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, INC., pages: 77 - 96
COLE: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, INC., pages: 77 - 96
COTE ET AL., PROC NATL ACAD SCI USA, vol. 80, 1983, pages 2026 - 2030
DANG; LEE, J. BIOL. CHEM., vol. 264, 1989, pages 18019 - 18023
DATABASE WPI Week 201068, Derwent World Patents Index; AN 2010-M79716, XP002643212 *
DEVEREUX ET AL., NUCLEIC ACIDS RES., vol. 12, 1984, pages 387 - 395
ELLIOTT; O'HARE, CELL, vol. 88, 1997, pages 223 - 233
ENGSTROM, BIOCHEM EXP BIOL, vol. 11, 1974, pages 7 - 13
FLORENCE MEYER-LOSIC ET AL., CLIN CANCER RES., 2008, pages 2145 - 53
FRANKED ET AL., PROC. NATL. ACAD. SCI, USA, vol. 86, 1989, pages 7397 - 7401
GOLDSPIEL ET AL., CLIN PHARM, vol. 12, 1993, pages 488 - 505
GRANTHAM, R., SCIENCE, vol. 185, 1974, pages 862 - 864
GROSSCHEDL, CELL, vol. 38, 1984, pages 647 - 658
HANAHAN ET AL., NATURE, vol. 315, 1985, pages 115 - 122
HAUBER, J. VIROL., vol. 63, 1989, pages 1181 - 1187
HOPP; WOODS, PROC NATL ACAD SCI USA, vol. 78, 1981, pages 3824 - 3828
HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281
INNIS: "PCR PROTOCOLS", 1990, ACADEMIC PRESS, INC.
J. VIROL., vol. 63, 1989, pages 1 - 8
JAMESON ET AL., NATURE, vol. 368, 1994, pages 744 - 746
KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497
KOLLER; SMITHIES, PROC NATL ACAD SCI USA, vol. 86, 1989, pages 8932 - 8935
KOZBOR ET AL., IMMUNOL TODAY, vol. 4, 1983, pages 72
KRIEGLER: "Gene Transfer and Expression, a Laboratory Manual", 1990, STOCKTON PRESS
LI; HARJU; PETERSON, TRENDS GENET., vol. 15, 1999, pages 403 - 408
LOEFFLER; BEHR, METH ENZYMOL, vol. 217, 1993, pages 599 - 618
MASON ET AL., SCIENCE, vol. 234, 1986, pages 1372 - 1378
MEANS; FEENEY, CHEMICAL MODIFICATION OF PROTEINS, 1974, pages 39 - 43
PEARSON, METHODS ENZYMOL., vol. 183, 1990, pages 63 - 98
PEARSON; LIPMAN, PROC. NATL. ACAD. SCI. U. S. A, vol. 85, 1988, pages 2444 - 2448
PINCKERT ET AL., GENES AND DEV, vol. 1, 1987, pages 268 - 276
QACKSON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 10691 - 10695
READHEAD, CELL, vol. 48, 1987, pages 703 - 712
SAMBROOK, J.; FRITSCH, E. F.; MANIATIS, T.: "Molecular cloning: A laboratory manual", 1989, COLD SPRING HARBOR LABORATORY
SAMBROOK, J.; FRITSCH, E. F.; MANIATIS, T.: "Molecular cloning: A laboratory manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
SELIGER; MCELROY, ARCH. BIOCHEM. BIOPHYS., vol. 88, 1960, pages 136 - 141
SMITH; WATERMAN, J. MOL. BIOL., vol. 147, 1981, pages 195 - 197
STEMPLE; ANDERSON, CELL, vol. 71, 1992, pages 973 - 985
WONG: "CHEMISTRY OF PROTEIN CONJUGATION AND CROSSLINKING", 1991, CRC PRESS
WOOD; DE WET; DEWJI; DELUCA, BIOCHEM BIOPHYS. RES. COMMUN., vol. 124, 1984, pages 592 - 596
WU; WU, J BIOL CHEM, vol. 262, 1987, pages 4429 - 4432

Cited By (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8569447B2 (en) 1999-10-12 2013-10-29 Xigen Sa Cell-permeable peptide inhibitors of the JNK signal transduction pathway
US8748395B2 (en) 2005-09-12 2014-06-10 Xigen Inflammation Ltd. Cell-permeable peptide inhibitors of the JNK signal transduction pathway
US9290538B2 (en) 2005-09-12 2016-03-22 Xigen Inflammation Ltd. Cell-permeable peptide inhibitors of the JNK signal transduction pathway
US9610330B2 (en) 2008-05-30 2017-04-04 Xigen Inflammation Ltd. Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases
US9006185B2 (en) 2008-05-30 2015-04-14 Xigen Inflammation Ltd. Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases
US9180159B2 (en) 2008-05-30 2015-11-10 Xigen Inflammation Ltd. Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases
US10023615B2 (en) 2008-12-22 2018-07-17 Xigen Inflammation Ltd. Efficient transport into white blood cells
US8981052B2 (en) 2010-06-21 2015-03-17 Xigen Inflammation Ltd. JNK inhibitor molecules
US9624267B2 (en) 2010-06-21 2017-04-18 Xigen Inflammation Ltd. JNK inhibitor molecules
US9150618B2 (en) 2010-10-14 2015-10-06 Xigen Inflammation Ltd. Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
US10596223B2 (en) 2011-12-21 2020-03-24 Xigen Inflammation Ltd. JNK inhibitor molecules for treatment of various diseases
WO2013091896A1 (en) * 2011-12-21 2013-06-27 Xigen Inflammation Ltd. Novel jnk inhibitor molecules for treatment of various diseases
WO2013091670A1 (en) * 2011-12-21 2013-06-27 Xigen S.A. Novel jnk inhibitor molecules for treatment of various diseases
EP3718555A1 (en) * 2011-12-21 2020-10-07 Xigen Inflammation Ltd. Novel jnk inhibitor molecules for treatment of various diseases
JP2016523275A (ja) * 2013-06-26 2016-08-08 ザイジェン インフラメーション リミテッド 多様な疾患を処置するためのjnk阻害剤分子の新規な用途
JP2016523274A (ja) * 2013-06-26 2016-08-08 ザイジェン インフラメーション リミテッド 種々の疾患を処置するためのjnkシグナル伝達経路の新規の細胞透過性ペプチド阻害剤の使用
US10624948B2 (en) 2013-06-26 2020-04-21 Xigen Inflammation Ltd. Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases
US11779628B2 (en) 2013-06-26 2023-10-10 Xigen Inflammation Ltd. Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases
US11331364B2 (en) 2014-06-26 2022-05-17 Xigen Inflammation Ltd. Use for JNK inhibitor molecules for treatment of various diseases
WO2018029336A1 (en) 2016-08-12 2018-02-15 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for determining whether a subject was administered with an activator of the ppar beta/delta pathway.

Also Published As

Publication number Publication date
JP2013540770A (ja) 2013-11-07
US10967038B2 (en) 2021-04-06
CA2807036C (en) 2018-01-16
JP5857056B2 (ja) 2016-02-10
US20190060392A1 (en) 2019-02-28
US9150618B2 (en) 2015-10-06
AU2010362444B2 (en) 2015-08-06
US20130337557A1 (en) 2013-12-19
AU2010362444A1 (en) 2013-02-28
CA2807036A1 (en) 2012-04-19
US20160089413A1 (en) 2016-03-31

Similar Documents

Publication Publication Date Title
US10967038B2 (en) Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases
EP2627346B1 (en) Cell-permeable peptide inhibitors of the jnk signal transduction pathway for use in the treatment of uveitis
AU2009253347B2 (en) Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases
US20140309400A1 (en) Use of Cell-Permeable Peptide Inhibitors of the JNK Signal Transduction Pathway for the Treatment of Dry Eye Syndrome
ES2319454T9 (es) Péptidos con permeabilidad celular inhibidores de la ruta de transducción de señales de la JNK
KR20180132807A (ko) 신경퇴행성 질환의 치료용 tdp-43 미토콘드리아 국소화 억제제
JP2018525337A (ja) 軽度認知障害の処置のためのjnkシグナル伝達経路の細胞透過性ペプチド阻害剤の新規使用
US20180170983A1 (en) New Use of Cell-Permeable Peptide Inhibitors of the JNK Signal Transduction Pathway for the Treatment of Mild Cognitive Impairment
HK1187266B (en) Cell-permeable peptide inhibitors of the jnk signal transduction pathway for use in the treatment of uveitis
JP5447784B2 (ja) マキサディランの部分ペプチドを含む神経因性疼痛の治療剤
US20070185020A1 (en) Methods and compositions for treating disorders of the extracellular matrix
EP2785363A1 (en) Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of dry eye syndrome
AU2004253185A1 (en) Methods and compositions for treating disorders of the extracellular matrix

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10767947

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2807036

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2010362444

Country of ref document: AU

Date of ref document: 20101014

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013533091

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 13879059

Country of ref document: US

122 Ep: pct application non-entry in european phase

Ref document number: 10767947

Country of ref document: EP

Kind code of ref document: A1