WO2011004361A2 - Long-acting coagulation factors and methods of producing same - Google Patents
Long-acting coagulation factors and methods of producing same Download PDFInfo
- Publication number
- WO2011004361A2 WO2011004361A2 PCT/IL2010/000532 IL2010000532W WO2011004361A2 WO 2011004361 A2 WO2011004361 A2 WO 2011004361A2 IL 2010000532 W IL2010000532 W IL 2010000532W WO 2011004361 A2 WO2011004361 A2 WO 2011004361A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- coagulation factor
- ctp
- another embodiment
- polypeptide
- factor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/24—Follicle-stimulating hormone [FSH]; Chorionic gonadotropins, e.g. HCG; Luteinising hormone [LH]; Thyroid-stimulating hormone [TSH]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/36—Blood coagulation or fibrinolysis factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/02—Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/505—Erythropoietin [EPO]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/59—Follicle-stimulating hormone [FSH]; Chorionic gonadotropins, e.g.hCG [human chorionic gonadotropin]; Luteinising hormone [LH]; Thyroid-stimulating hormone [TSH]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/745—Blood coagulation or fibrinolysis factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/90—Fusion polypeptide containing a motif for post-translational modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/90—Fusion polypeptide containing a motif for post-translational modification
- C07K2319/91—Fusion polypeptide containing a motif for post-translational modification containing a motif for glycosylation
Definitions
- Polypeptides and polynucleotides encoding same comprising at least one carboxy- terminal peptide (CTP) of chorionic gonadotrophs attached to a C-terminus (carboxy terminus) of a coagulation factor are disclosed.
- Pharmaceutical compositions comprising the polypeptide and polynucleotides of the invention and methods of using same are also disclosed.
- Polypeptides are susceptible to denaturation or enzymatic degradation in the blood, liver or kidney. Accordingly, polypeptides typically have short circulatory half-lives of several hours. Because of their low stability, peptide drugs are usually delivered in a sustained frequency so as to maintain an effective plasma concentration of the active peptide. Moreover, since peptide drugs are usually administrated by infusion, frequent injection of peptide drugs cause considerable discomfort to a subject. Thus, there is a need for technologies that will prolong the half-lives of therapeutic polypeptides while maintaining a high pharmacological efficacy thereof.
- Such desirous peptide drugs should also meet the requirements of enhanced serum stability, high activity and a low probability of inducing an undesired immune response when injected into a subject.
- Unfavorable pharmacokinetics such as a short serum half-life, can prevent the pharmaceutical development of many otherwise promising drug candidates. Serum half-life is an empirical characteristic of a molecule, and must be determined experimentally for each new potential drug. For example, with lower molecular weight polypeptide drugs, physiological clearance mechanisms such as renal filtration can make the maintenance of therapeutic levels of a drug unfeasible because of cost or frequency of the required dosing regimen. Conversely, a long serum half-life is undesirable where a drug or its metabolites have toxic side effects.
- the present invention provides a polypeptide consisting a coagulation factor and one to five gonadotrophin carboxy terminal (CTP) peptides attached to a carboxy terminus of the coagulation factor.
- CTP gonadotrophin carboxy terminal
- the present invention further provides a polynucleotide molecule comprising a coding portion encoding a polypeptide consisting a coagulation factor and one to five gonadotrophin carboxy terminal peptides attached to a carboxy terminus of the coagulation factor.
- the present invention further provides a A method of extending a biological half life of a coagulation factor, comprising the step of attaching one to five chorionic gonadotrophin carboxy terminal peptides to a carboxy terminus of the coagulation factor, thereby improving a biological half life of a coagulation factor.
- the present invention further provides a method of improving the area under the curve (AUC) of a coagulation factor, comprising the step of attaching one to five chorionic gonadotrophin carboxy terminal peptides to a carboxy terminus of the coagulation factor, thereby improving the area under the curve (AUC) of a coagulation factor.
- the present invention further provides a method of reducing a dosing frequency of a coagulation factor, comprising the step of attaching one to five chorionic gonadotrophin carboxy terminal peptides to a carboxy terminus of the coagulation factor, thereby reducing a dosing frequency of a coagulation factor.
- the present invention further provides a method of increasing compliance in the use of coagulation factor therapy, comprising providing to a subject in need thereof, a polypeptide comprising a coagulation factor, one to five chorionic gonadotrophin carboxy terminal peptides attached to a carboxy terminus of the coagulation factor, thereby increasing compliance in the use of coagulation factor therapy.
- Figure 1 is a diagram illustrating rFVII-CTP construct (A), rFVII-CTP-CTP construct (B), rFIX-CTP construct (C), and rFIX-CTP-CTP construct (D).
- Figure 2 A is a bar graph showing harvests limited diluted clone transfected and selected cells with FVII-CTP variants in the presence of 5 ⁇ g/ml of Vitamin K3. The level of FVII was quantified using FVII Elisa (AssayPro).
- Figure 2B is a bar graph showing harvests of limited diluted transfected and selected cells with FVII-CTP variants in the presence of 5 ⁇ g of Vitamin K3.activity. FVII activity was quantified using FVII chromogenic activity assay (AssayPro).
- Figure 2C is a bar graph showing harvests of limited diluted transfected and selected cells with FVII-CTP variants in the presence of 5 ⁇ g of Vitamin K3. The specific activity of FVII was calculated for each version by dividing the activity value by the harvest FVII concentration.
- Figure 2D is a graph showing harvests of limited diluted transfected and selected cells with FVII, FVII-CTP and FVII-(CTP) 2 coagulation activity compared to normal poll human plasma coagulation activity.
- Figure 2E is a graph showing PK profile of FVII, FVII-CTP-CTP, and FVII-CTP harvests.
- Figure 3 A is a bar graph showing harvests of limited diluted transfected and selected cells with FIX-CTP and FIX-CTP-CTP variants in the presence of 5 ⁇ g/ml of Vitamin K3.
- the level of FIX was quantified using Human FIX ELISA kit (Affinity Biologicals; cat. No. FIX-AG RUO), the calculated protein concentration ( ⁇ g/ml) is the average of two independent runs.
- FIG. 3B depicts SDS-PAGE gel micrographs of FIX Ab recognition
- Micrograph A depicts recognition of anti-FIX antibody in Western-blot
- Micrograph B depicts recognition of anti- ⁇ carboxylation antibody in Western-blot.
- Lane 1 in A-B was loaded with a sample containing recombinant FIX
- Lane 2 in A-B was loaded with a sample containing FIX-CTP harvets.
- Lane 3 in A-B was loaded with a sample containing FIX-(CTP) 2 harvest.
- Figure 4 is a graph showing FIX-CTP and FIX-(CTP) 2 harvests comparative chromogenic activity (measured by a the EC 50 . concentration) compared to rhFIX ( American Diagnostics).
- Figure 5 is a graph showing FIX-CTP and FIX-(CTP) harvests coagulation activity compared to rhFIX( American Diagnostics) coagulation activity.
- Figure 6 is a graph showing PK profile of rhFIX, harvest of FIX-CTP-CTP, and harvest of FIX-CTP.
- Figure 7 is a bar graph showing harvests of FIX-CTP and FFX-CTP-CTP_MOD-3011 and MOD-3012, respectively harvests and MOD3012 purified protein FIX antigen level as determined using Human FIX ELISA kit (Affinity Biologicals; cat. No. FIX-AG RUO), the calculated protein concentration ( ⁇ g/ml) is the average of two independent runs.
- FIG. 8 depicts SDS-PAGE gel micrographs of FIX Ab recognition.
- Micrograph A depicts a coomassie blue staining
- Micrograph B depicts recognition of anti-FIX antibody in Western-blot
- Micrograph C depicts recognition of anti- ⁇ carboxylation antibody in Western- blot.
- Lane 1 in A-C was loaded with a sample containing FIX-(CTP) 2 (MOD-3012).
- Lane 2 in A-C was loaded with a sample containing unbound FIX-(CTP) 2 .
- Lane 3 in A-C was loaded with a sample containing a concentrated elution OfFIX-(CTP) 2 (MOD-3012).
- Figure 9 is a graph showing MOD3012 Comparative chromogenic activity (sample concentration/O.D.) compared to human normal pool plasma and rhFIX ( American Diagnostics).
- Figure 10 is a graph showing MOD3012 Comparative coagulation activity compared to human normal pool plasma and rhFIX.
- Figure 11 is a graph showing PK profile of purified MOD3012, rhFIX, harvest of FIX-CTP-CTP, and harvest of FIX-CTP.
- the present invention provides long-acting coagulation factors and methods of producing and using same.
- long-acting coagulation factors comprise carboxy terminal peptide (CTP, also referred to as CTP unit), hi another embodiment, long-acting polypeptides which comprise a coagulation factor further comprise carboxy terminal peptide (CTP) of human Chorionic Gonadotropin (hCG).
- CTP acts as a protectant against degradation of coagulation factors.
- CTP extends the C max of coagulation factors.
- CTP extends the T max of coagulation factors.
- CTP extends circulatory half-lives of coagulation factors, hi some embodiments, CTP enhances the potency of coagulation factors.
- a method of extending a biological half life of a coagulation factor comprising the step of attaching one to ten CTPs to a carboxy terminus of a coagulation factor, thereby improving a biological half life of a coagulation factor.
- a method of extending a biological half life of a coagulation factor comprising the step of attaching one to five CTPs to a carboxy terminus of a coagulation factor, thereby improving a biological half life of a coagulation factor.
- a method of improving the area under the curve (AUC) of a coagulation factor comprising the step of attaching one to ten CTPs to a carboxy terminus of a coagulation factor, thereby improving the area under the curve (AUC) of a coagulation factor.
- a method of improving the area under the curve (AUC) of a coagulation factor comprising the step of attaching one to five CTPs to a carboxy terminus of a coagulation factor, thereby improving the area under the curve (AUC) of a coagulation factor.
- a coagulation factor of the invention is a protein.
- a coagulation factor of the invention is a peptide. In another embodiment, a coagulation factor of the invention is a polypeptide. In another embodiment, the coagulation factor is an enzyme. In another embodiment, the coagulation factor is a serine protease. In another embodiment, the coagulation factor is a glycoprotein. In another embodiment, the coagulation factor is a transglutaminase. In another embodiment, the coagulation factor is an inactive zymogen. In another embodiment, the coagulation factor is any coagulation factor known to one of skill in the art. hi another embodiment, the coagulation factor is FVIII. In another embodiment, the coagulation factor is FV. In another embodiment, the coagulation factor is Factor XIII.
- the coagulation factor is factor X. In another embodiment, the coagulation factor is thrombin. In another embodiment, the coagulation factor is fibrin. In another embodiment, the coagulation factor is FVIIa. In another embodiment, the coagulation factor is FVII. In another embodiment, the coagulation factor is FIX. In another embodiment, the coagulation factor is FX. In another embodiment, the coagulation factor is FXIa. In another embodiment, the coagulation factor is FXII. In another embodiment, the coagulation factor is FXa. In another embodiment, the coagulation factor is FVa. In another embodiment, the coagulation factor is prothrombin. In another embodiment, the coagulation factor is thrombin.
- the coagulation factor is FV. In another embodiment, the coagulation factor is FXI. In another embodiment, the coagulation factor is vWF. In another embodiment, the coagulation factor is FVIIIa. In another embodiment, the coagulation factor is B-deleted Domain FVIII (FVIIIBDD). In another embodiment, the coagulation factor is FIXa. In another embodiment, the coagulation factor is prekallikrein. In another embodiment, the coagulation factor is kallikrein. In another embodiment, the coagulation factor is FXIIa. In another embodiment, the coagulation factor is fibrinogen. In another embodiment, the coagulation factor is thrombomodulin. In another embodiment, the coagulation factor is FIL
- the coagulation factor is a glycoprotein. In another embodiment, the coagulation factor is a vitamin K dependent glycoprotein. In another embodiment, the coagulation factor is a vitamin K independent glycoprotein. In another embodiment, the coagulation factor is a recombinant protein. In another embodiment, the coagulation factor is a recombinant glycoprotein. In another embodiment, the coagulation factor is a recombinant glycoprotein FV. In another embodiment, the coagulation factor is a recombinant FVI. In another embodiment, the coagulation factor is a recombinant FVII. In another embodiment, the coagulation factor is a recombinant FVIII.
- the coagulation factor is a recombinant FIX. In another embodiment, the coagulation factor is a recombinant FX. In another embodiment, the coagulation factor is a recombinant FXI. In another embodiment, the coagulation factor is a recombinant FXII. In another embodiment, the coagulation factor is a recombinant FvW. In another embodiment, the coagulation factor is a recombinant FII. In another embodiment, the coagulation factor is a recombinant FIXa. In another embodiment, the coagulation factor is a recombinant FXIa. In another embodiment, the coagulation factor is a recombinant fibrin.
- the coagulation factor is a recombinant FVIIa. In another embodiment, the coagulation factor is a recombinant FXa. In another embodiment, the coagulation factor is a recombinant FVa. In another embodiment, the coagulation factor is a recombinant prothrombin. In another embodiment, the coagulation factor is a recombinant thrombin. In another embodiment, the coagulation factor is a recombinant FVIIIa. In another embodiment, the coagulation factor is a recombinant prekallikrein. In another embodiment, the coagulation factor is a recombinant kallikrein.
- the coagulation factor is a recombinant FXIIa. In another embodiment, the coagulation factor is any known recombinant coagulation factor. In another embodiment, the coagulation factor comprising a signal peptide is any known recombinant coagulation factor. In another embodiment, a coagulation factor comprises 1-10 CTP repeats attached to the C-terminus and no CTPs attached to the N-terminus. In another embodiment, the coagulation factor comprising a signal peptide is any known recombinant coagulation factor. In another embodiment, a coagulation factor comprises at least one CTP attached to the C- terminus and no CTPs attached to the N-terminus.
- a coagulation factor comprising 1-10 CTP repeats attached to the C-terminus and no CTPs attached to the N-terminus is an engineered coagulation factor.
- a coagulation factor comprising at least one CTP attached to the C-terminus and no CTPs attached to the N- terminus is an engineered coagulation factor.
- a coagulation factor comprising 1-10 CTP repeats attached to the C-terminus and no CTPs attached to the N- terminus is a conjugated coagulation factor.
- a coagulation factor comprising at least one CTP attached to the C-terminus and no CTPs attached to the N- terminus is a conjugated coagulation factor.
- the coagulation factor comprising a domain organization similar or identical to the domain organization of FIX, FVII 5 factor X, protein C and prothrombin.
- the coagulation factor is synthesized as precursors with N-terminal propeptide.
- the coagulation factor as used herein is in an inactive pro-enzyme form.
- the coagulation factor is produces in hepatocytes.
- the coagulation factor comprises a docking site for gammacarboxylase which converts glutamic acids (GIu) into gamma carboxy glutamic acids (GIa).
- the coagulation factor as used herein is a commercially available coagulation factor .
- amino acid sequence of factor VII comprises the following amino acid sequence:
- nucleic acid sequence encoding factor VII comprises the following nucleic acid sequence:
- the nucleic acid sequence encoding factor VII-CTP (attached to the carboxy terminus) comprises the following nucleic acid sequence: CTCGAGGACATGGTCTCCCAGGCCCTCAGGCTCCTCTGCCTTCTGCTTGGGCTTCA GGGCTGCCTGGCTGCAGTCTTCGTAACCCAGGAGGAAGCCCACGGCGTCCTGCA CCGGCGCCGGCGCGCCAACGCGTTCCTGGAGGAGCTGCGGCCGGGCTCCCTGGA GAGGGAGTGCAAGGAGGAGCAGTGCTCCTTCGAGGAGGCCCGGGAGATCTTCAA GGACGCGGAGAGGACGAAGCTGTTCTGGATTTCTTACAGTGATGGGGACCAGTG TGCCTCAAGTCCATGCCAGAATGGGGGGGCTCCTGCAAGGACCAGCTCCAGTCCTAT ATCTGCTTCTGCCTCCCTTCGAGGGCCGGAACTGTGAGACGCACAAGGATG ACCAGCTGATCTGTGTGAACGAACGGCGGCTGTGAGCAGTGTGAACGAACGGCGGGCT
- the amino acid sequence of factor VII-CTP (attached to the carboxy terminus) comprises the following amino acid sequence: MVSQALRLLCLLLGLQGCLAAVFVTQEEAHGVLHRRRRANAFLEELRPGSLERECK EEQCSFEEAREIFKDAERTKLFWISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAF EGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVE YPCGKIPILEKRNASKPQGRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVV SAAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTNHDIALLR LHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGATALELMVLNVPR LMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGPH
- the nucleic acid sequence encoding factor VII-CTP-CTP (attached to the carboxy terminus) comprises the following nucleic acid sequence: CTCGAGGACATGGTCTCCCAGGCCCTCAGGCTCCTCTGCCTTCTGCTTGGGCTTCA GGGCTGCCTGGCTGCAGTCTTCGTAACCCAGGAGGAAGCCCACGGCGTCCTGCA CCGGCGCCGGCGCGCCAACGCGTTCCTGGAGGAGCTGCGGCCGGGCTCCCTGGA GAGGGAGTGCAAGGAGGAGCAGTGCTCCTTCGAGGAGGCCCGGGAGATCTTCAA GGACGCGGAGAGGACGAAGCTGTTCTGGATTTCTTACAGTGATGGGGACCAGTG TGCCTCAAGTCCATGCCAGAATGGGGGGGCTCCTGCAAGGACCAGCTCCAGTCCTAT ATCTGCTTCTGCCTCCCTTCGAGGGCCGGAACTGTGAGACGCACAAGGATG ACCAGCTGATCTGTGTGAACGAACGGCGGCTGTGTG TGCCTCAAGTCCATGC
- the amino acid sequence of factor VII-CTP-CTP (attached to the carboxy terminus) comprises the following amino acid sequence: MVSQALRLLCLLLGLQGCLAAVFVTQEEAHGVLHRRJRRANAFLEELRPGSLERECK EEQCSFEEAREIFKDAERTKLFWISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAF EGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVE YPCGKIPILEKRNASKPQGMVGGKVCPKGECPWQVLLL WGAQLCGGTLINTIWVV SAAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTNHDIALLR LHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGATALELMVLNVPR LMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSK
- the nucleic acid sequence encoding factor IX comprises the following nucleic acid sequence: GCGATCGCCATGCAGCGCGTGAACATGATCATGGCAGAATCACCAGGCCTCATC ACCATTGCCTTTTAGGATATCTACTCAGTGCTGAATGTACAGTTTTTCTTGATCAT GAAAACGCCAACAAAATTCTGAATCGGCCAAAGAGGTATAATTCAGGTAAATTG GAAGAGTTTGTTCAAGGGAACCTTGAGAGAATGTATGGAAGAAAAGTGTAGT TTTGAAGAAGCACGAGAAGTTTTTGAAAACACTGAAAGAACAACTGAATTTTGG AAGCAGTATGTTGATGGAGATCAGTGTGAGTCCAATCCATGTTTAAATGGCGGCA GTTGCAAGGATGACATTAATTCCTATGAATGTTGGTGTCCCTTTGGATTTGAAGG AAAGAACTGTGAATTAGATGTAACATGTAACATTAAGAATGGCAGAATGGCAGTTTTGAAAAGGAAGG AAAGAACTGTGAATTAGATGTAACATGTAAC
- amino acid sequence of factor IX comprises the following amino acid sequence:
- the nucleic acid sequence encoding factor IX-CTP (attached to the carboxy terminus) comprises the following nucleic acid sequence: GCGATCGCCATGCAGCGCGTGAACATGATCATGGCAGAATCACCAGGCCTCATC ACCATCTGCCTTTTAGGATATCTACTCAGTGCTGAATGTACAGTTTTTCTTGATCA TGAAAACGCCAACAAAATTCTGAATCGGCCAAAGAGGTATAATTCAGGTAAATT GGAAGAGTTTGTTCAAGGGAACCTTGAGAGAATGTATGGAAGAAAAGTGTAG TTTTGAAGAAGCACGAGAAGTTTTTGAAAACACTGAAAGAACAACTGAATTTTG GAAGCAGTATGTTGATGGAGATCAGTGTGAGTCCAATCCATGTTTAAATGGCGGC AGTTGCAAGGATGACATTAATTCCTATGAATGTTGGTTGATGGAGATCAGTGTCCCTTTGGATTTGAAG GAAAGAACTGTAACATGTAACATTAAGAATGGCAGATGCGA
- the amino acid sequence of factor IX-CTP (attached to the carboxy terminus) comprises the following amino acid sequence: MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQ GNLERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINS YECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSC EPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVV GGEDAKPGQFPWQVVLNGKVD AFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNI EETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNI FLKFGSGYVSGWGRVFHKGRS ALVLQYLR
- the nucleic acid sequence encoding factor IX-CTP-CTP (attached to the carboxy terminus) comprises the following nucleic acid sequence: GCGATCGCCATGCAGCGCGTGAACATGATCATGGCAGAATCACCAGGCCTCATC ACCATCTGCCTTTTAGGATATCTACTCAGTGCTGAATGTACAGTTTTTCTTGATCA TGAAAACGCCAACAAAATTCTGAATCGGCCAAAGAGGTATAATTCAGGTAAATT GGAAGAGTTTGTTCAAGGGAACCTTGAGAGAATGTATGGAAGAAAAGTGTAG TTTTGAAGAAGCACGAGAAGTTTTTGAAAACACTGAAAGAACAACTGAATTTTG GAAGCAGTATGTTGATGGAGATCAGTGTGAGTCCAATCCATGTTTAAATGGCGGC AGTTGCAAGGATGACATTAATTCCTATGAATGTTGGTTGATGGAGATCAGTGTCCCTTTGGATTTGAAG GAAAAGATGTATGTTGATGGAGATCAGTGTGAGTCCAATCCATGT
- the amino acid sequence of factor IX-CTP-CTP (attached to the carboxy terminus) comprises the following amino acid sequence: MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQ GNLERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINS YECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSC EPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVV GGEDAKPGQFPWQVVLNGKVD AFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNI EETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNI FLKFGSGYVSGWGRVFHKGRS ALVL
- furin is added to a cell expressing the coagulation factor-CTP of the invention.
- furin increases the production efficiency of a coagulation factor-CTP of the invention in a cell.
- furin is co- transfected with the vector comprising the coding sequence of the coagulation factor-CTP of the invention.
- furin is encoded by a separate vector.
- furin and a coagulation factor-CTP are encoded by one vector.
- the coding sequence of furin is inserted into pCI-DHFR.
- the coding sequence of furin is engineered in pCI-dhfr/smal+Notl, Furin/Asisl F.I.+Notl.
- the nucleic acid sequence encoding furin comprises the following nucleic acid sequence: tctagagtcgacccCGCCATGGAGCTGAGGCCCTGGTTGCTATGGGTGGTAGCAGCAACA GGAACCTTGGTCCTGCTAGCAGCTGATGCTCAGGGCCAGAAGGTCTTCACCAACA CGTGGGCTGTGCGCATCCCTGGAGGCCCAGCGGTGGCCAACAGTGTGGCACGGA AGCATGGGTTCCTCAACCTGGGCCAGATCTTCGGGGACTATTACCACTTCTGGCA TCGAGGAGTGACGAAGCGGTCCCTGTCGCCTCACCGCCCGCGGCACAGCCGGCT GCAGAGGGAGCCTCAAGTACAGTGGCTGGAACAGCAGGTGGCAAAGCGACGGA CTAAACGGGACGTGTACCAGGAGCCCACA
- amino acid sequence of furin comprises the following amino acid sequence:
- the term coagulation factor further includes homologues of known coagulation factors which have a coagulating activity.
- homology according to the present invention also encompasses deletions, insertions, or substitution variants, including an amino acid substitution, thereof and biologically active polypeptide fragments thereof.
- the invention includes homologues of a coagulation factor having a coagulation activity. In another embodiment, the invention includes homologues of a coagulation factor as described herein having a coagulation activity. In another embodiment, homologues e.g., polypeptides which are at least 50 %, at least 55 %, at least 60 %, at least 65
- the invention includes homologues of furin.
- homologues e.g., polypeptides which are at least 50 %, at least 55 %, at least 60 %, at least 65 %, at least 70 %, at least 75 %, at least 80 %, at least 85 %, at least 87 %, at least 89 %, at least 91 %, at least 93 %, at least 95 % or more say 99 % homologous to a furin as determined using BlastP software of the National Center of Biotechnology Information (NCBI) using default parameters.
- NCBI National Center of Biotechnology Information
- a polypeptide comprising a coagulation factor and one to ten gonadotrophin carboxy terminal (CTP) peptides attached to a carboxy terminus of the coagulation factor In another embodiment, provided herein a polypeptide comprising a coagulation factor and two to eight gonadotrophin carboxy terminal (CTP) peptides attached to a carboxy terminus of the coagulation factor. In another embodiment, provided herein a polypeptide comprising a coagulation factor and one to three gonadotrophin carboxy terminal (CTP) peptides attached to a carboxy terminus of the coagulation factor.
- a polypeptide comprising a coagulation factor and one to five gonadotrophin carboxy terminal (CTP) peptides attached to a carboxy terminus of the coagulation factor In another embodiment, provided herein a polypeptide consisting a coagulation factor and one to five gonadotropliin carboxy terminal (CTP) peptides attached to a carboxy terminus of the coagulation factor. In another embodiment, provided herein a polypeptide comprising a coagulation factor and one to five CTPs attached to a carboxy temiinus of the coagulation factor. In another embodiment, provided herein a polypeptide comprising a coagulation factor having no CTPs on its amino terminus.
- engineered coagulation factor is a polypeptide comprising a coagulation factor having at least one CTP on its carboxy terminus.
- engineered coagulation factor is a polypeptide comprising a coagulation factor having one CTP on its carboxy terminus, hi other embodiments, engineered coagulation factor is a polypeptide consisting a coagulation factor having one CTP on its carboxy terminus.
- engineered coagulation factor comprises two CTP peptides attached in tandem to the carboxy terminus.
- an engineered coagulation factor as described herein is equivalent to the non CTP modified coagulation factor in terms of biological activity.
- an engineered coagulation factor as described herein is at least equivalent to the non CTP modified coagulation factor, in terms of pharmacological measures such as pharmacokinetics and/or pharmacodynamics.
- engineered coagulation factor is intended to be used for the treatment of hemophilic B patients.
- coagulation factor IX comprising 2 CTPs in tandem in its carboxy terminus (MOD-3012) is intended to be used for the treatment of hemophilic B patients.
- coagulation factor IX comprising 1 CTP repeat in its carboxy terminus (MOD-3011) is intended to be used for the treatment of hemophilic B patients.
- engineered coagulation factor can reduce the rate of infusions, reduce the required doses, or a combination thereof.
- coagulation factor IX comprising 2 CTPs in tandem in its carboxy terminus (MOD-3012) exhibits an improved PK profile while maintaining its coagulation activity vs. FIX-CTP harvest or rhFIX.
- coagulation factor IX comprising 2 CTPs in tandem in its carboxy terminus (MOD-3012) exhibits 3 fold increase in half life and 4.5 fold higher AUC compared to rhFIX.
- the terms “CTP peptide,” “carboxy terminal peptide” and “CTP sequence” are used interchangeably herein.
- the carboxy terminal peptide is a full-length CTP.
- the carboxy terminal peptide is a truncated CTP.
- the term engineered coagulation factor comprises the amino acid sequence of a matured coagulation factor.
- the term engineered coagulation factor comprises the amino acid sequence of coagulation factor including its signal sequence or signal peptide.
- signal sequence and “signal peptide” are used interchangeably herein.
- sequence when in reference to a polynucleotide molecule can refer to a coding portion.
- an engineered coagulation factor comprising at least one CTP as described herein has enhanced in-vivo biological activity compared the same coagulation factor without at least one CTP.
- At least one CTP sequence at the carboxy terminal end of the coagulation factor provides enhanced protection against degradation of a coagulation factor. In some embodiments, at least one CTP sequence at the carboxy terminal end of the coagulation factor provides enhanced protection against clearance. In some embodiments, at least one CTP sequence at the carboxy terminal end of the coagulation factor provides prolonged clearance time. In some embodiments, at least one CTP sequence at the carboxy terminal end of the coagulation factor enhances its C max . In some embodiments, at least one CTP sequence at the carboxy terminal end of the coagulation factor provides enhanced protection against enhances its T max . In some embodiments, at least one CTP sequence at the carboxy terminal end of the coagulation factor prolongs its Tl/2.
- a conjugated coagulation factor of this invention is used in the same manner as an unmodified conjugated coagulation factor.
- a conjugated coagulation factor of this invention have an increased circulating half-life and plasma residence time, decreased clearance, and increased clinical activity in vivo.
- this conjugate is administered less frequently than the unmodified form of the same coagulation factor.
- conjugates having the molecular weight and linker structure of the conjugates of this invention have an improved potency, improved stability, elevated AUC levels, and enhanced circulating half-life.
- a composition comprising the conjugated coagulation factor as described herein.
- a pharmaceutical composition comprising the conjugated coagulation factor as described herein.
- a therapeutically effective amount of a conjugated coagulation factor is determined according to factors as the exact type of condition being treated, the condition of the patient being treated, as well as the other ingredients in the composition.
- a therapeutically effective amount of a conjugated coagulation factor is between 50-500 IU per kg body weight administered once a day to once a week.
- a therapeutically effective amount of a conjugated coagulation factor is 150-250 IU per kg body weight, administered once a day.
- a pharmaceutical composition comprising a conjugated coagulation factor is formulated at a strength effective for administration by various means to a human patient.
- a conjugated coagulation factor as described herein is useful in the treatment of subjects afflicted with Hemophilia.
- a conjugated coagulation factor as described herein is useful in the prophylactic therapy of Hemophilia thus reducing the risk of bleeding and associated complications.
- a conjugated coagulation factor as- described herein is useful in the treatment of subjects afflicted with Hemophilia while reducing the risk of developing inhibitory antibodies to exogenously administered coagulation factors.
- a conjugated coagulation factor as described herein is useful in the treatment of subjects afflicted with Hemophilia thus inducing homeostasis.
- a conjugated coagulation factor as described herein is useful in the treatment of subjects experiencing excessive bleeding or bruising or having a prolonged Prothrombin Time (PT) or Partial Thromboplastin Time (PTT).
- PT Prothrombin Time
- PTT Partial Thromboplastin Time
- a conjugated coagulation factor as described herein is useful in the treatment of subjects having an acquired condition that is causing bleeding, such as vitamin K deficiency or liver disease.
- a conjugated coagulation factor as described herein is useful in the treatment of subjects having deficiencies in coagulation factors that are acquired (due to other diseases) or inherited, mild or severe, permanent or temporary.
- a conjugated coagulation factor as described herein is useful in the treatment of subjects afflicted with hemophilia A.
- a conjugated coagulation factor as described herein is useful in the treatment of subjects afflicted with hemophilia B.
- a conjugated coagulation factor as described herein is useful in the treatment of subjects having acquired deficiencies due to chronic diseases, such as liver disease or cancer; to an acute condition such as disseminated intravascular coagulation (DIC), which uses up clotting factors at a rapid rate; or to a deficiency in vitamin K or treatment with a vitamin K antagonist like warfarin (the production of factors II, VII, IX, and X require vitamin K).
- DIC disseminated intravascular coagulation
- a conjugated coagulation factor as described herein is useful in the treatment of subjects afflicted with a disease in which causes clotting imbalances such as but not limited to: a liver disease, uremia, a cancer, a bone marrow disorder, an exposure to snake venom, a vitamin K deficiency, an anticoagulation therapy, an accidental ingestion of the anticoagulant warfarin, a multiple blood transfusions (stored units of blood lose some of their clotting factors).
- a disease in which causes clotting imbalances such as but not limited to: a liver disease, uremia, a cancer, a bone marrow disorder, an exposure to snake venom, a vitamin K deficiency, an anticoagulation therapy, an accidental ingestion of the anticoagulant warfarin, a multiple blood transfusions (stored units of blood lose some of their clotting factors).
- a subject as used herein is a human subject.
- a subject is a pet.
- a subject is a mammal.
- a subject is a farm animal.
- a subject is a monkey.
- a subject is a horse.
- a subject is a cow.
- a subject is a mouse.
- a subject is a rat.
- a [(CTP) n>1 -coagulation factor] as described herein comprises a full length coagulation factor or an active fragment thereof connected via a peptide bond on its carboxy terminus to at least one CTP unit with no CTPs on its amino terminus.
- a [(CTP) n> i-coagulation factor] as described herein comprises a coagulation factor or an active fragment thereof connected via a peptide bond to at least one CTP unit which is connected to an additional CTP unit via a peptide bond with no CTPs on its amino terminus.
- one nucleic acid molecule encodes an engineered coagulation factor comprising at least one CTP attached to its C-terminus and no CTPs on its amino terminus.
- the CTP is attached to the coagulation factor via a linker.
- the linker which connects the CTP sequence to the coagulation factor is a covalent bond.
- the linker which connects the CTP sequence to the coagulation factor is a peptide bond.
- the linker which connects the CTP sequence to the coagulation factor is a substituted peptide bond.
- the CTP sequence comprises an amino acid sequence selected from the sequences set forth in SEQ ID NO: 1 and SEQ ID NO: 2.
- SEQ ID NO: 1 comprises the following amino acid (AA) sequence: DPRPQDSSSSKAPPPSLPSPSRLPGPSDTPIL (SEQ ID NO: 1).
- SEQ ID NO: 2 comprises the following amino acid (AA) sequence: SSSSKAPPPSLPSPSRLPGPSDTPILPQ (SEQ ID NO: 2).
- the carboxy terminal peptide (CTP) peptide of the present invention comprises the amino acid sequence from amino acid 112 to position 145 of human chorionic gonadotropin, as set forth in SEQ ID NO: 1.
- the CTP sequence of the present invention comprises the amino acid sequence from amino acid 118 to position 145 of human chorionic gonadotropin, as set forth in SEQ ID NO: 2.
- the CTP sequence also commences from any position between positions 112- 118 and terminates at position 145 of human chorionic gonadotrophin.
- the CTP sequence peptide is 28, 29, 30, 31, 32, 33 or 34 amino acids long and commences at position 112, 113, 114, 115, 116, 117 or 118 of the CTP amino acid sequence.
- the CTP peptide is a variant of chorionic gonadotrophin CTP which differs from the native CTP by 1-5 conservative amino acid substitutions as described in U.S. Pat. No. 5,712,122 which is incorporated herein be reference.
- the CTP peptide is a variant of chorionic gonadotrophin CTP which differs from the native CTP by 1 conservative amino acid substitution.
- the CTP peptide is a variant of chorionic gonadotrophin CTP which differs from the native CTP by 2 conservative amino acid substitutions.
- the CTP peptide is a variant of chorionic gonadotrophin CTP which differs from the native CTP by 3 conservative amino acid substitutions.
- the CTP peptide is a variant of chorionic gonadotrophin CTP which differs from the native CTP by 4 conservative amino acid substitutions. In another embodiment, the CTP peptide is a variant of chorionic gonadotrophin CTP which differs from the native CTP by 5 conservative amino acid substitutions. In another embodiment, the CTP peptide amino acid sequence of the present invention is at least 70% homologous to the native CTP amino acid sequence or a peptide thereof. In another embodiment, the CTP peptide amino acid sequence of the present invention is at least 80% homologous to the native CTP amino acid sequence or a peptide thereof.
- the CTP peptide amino acid sequence of the present invention is at least 90% homologous to the native CTP amino acid sequence or a peptide thereof. In another embodiment, the CTP peptide amino acid sequence of the present invention is at least 95% homologous to the native CTP amino acid sequence or a peptide thereof. [071] In another embodiment, the CTP peptide DNA sequence of the present invention is at least 70% homologous to the native human CTP DNA sequence or a peptide thereof. In another embodiment, the CTP peptide DNA sequence of the present invention is at least 80% homologous to the native human CTP DNA sequence or a peptide thereof.
- the CTP peptide DNA sequence of the present invention is at least 90% homologous to the native CTP DNA sequence or a peptide thereof. In another embodiment, the CTP peptide DNA sequence of the present invention is at least 95% homologous to the native CTP DNA sequence or a peptide thereof.
- At least one of the chorionic gonadotrophin CTP amino acid sequences is truncated. In another embodiment, both of the chorionic gonadotrophin CTP amino acid sequences are truncated. In another embodiment, 2 of the chorionic gonadotrophin CTP amino acid sequences are truncated. In another embodiment, 2 or more of the chorionic gonadotrophin CTP amino acid sequences are truncated. In another embodiment, all of the chorionic gonadotrophin CTP amino acid sequences are truncated. In one embodiment, the truncated CTP comprises the first 10 amino acids of SEQ ID NO: 3. In another embodiment, SEQ ID NO: 3 comprises the following amino acid (AA) sequence: SSSSKAPPPSLP.
- the truncated CTP comprises the first 10 amino acids of SEQ ID NO: 4.
- SEQ ID NO: 4 comprises the following amino acid (AA) sequence: SSSSKAPPPSLPSPSRLPGPSDTPILPQ.
- the truncated CTP comprises the first 11 amino acids of SEQ ID NO: 4. In one embodiment, the truncated CTP comprises the first 12 amino acids of SEQ ID NO: 4.
- the truncated CTP comprises the first 8 amino acids of SEQ ID NO: 4.
- the truncated CTP comprises the first 13 amino acids of SEQ ID NO: 4. In one embodiment, the truncated CTP comprises the first 14 amino acids of SEQ ID NO: 4. In one embodiment, the truncated CTP comprises the first 6 amino acids of SEQ ID NO: 4 or SEQ ID NO: 3. In one embodiment, the truncated CTP comprises the first 5 amino acids of SEQ ID NO: 4 or SEQ ID NO: 3. [075] In one embodiment, at least one of the chorionic gonadotropin CTP amino acid sequences is glycosylated. In another embodiment, both of the chorionic gonadotrophin CTP amino acid sequences are glycosylated.
- the CTP sequence of the present invention comprises at least one glycosylation site. In one embodiment, the CTP sequence of the present invention comprises 2 glycosylation sites. In one embodiment, the CTP sequence of the present invention comprises 3 glycosylation sites. In one embodiment, the CTP sequence of the present invention comprises 4 glycosylation sites.
- the CTP sequences modification is advantageous in permitting the usage of lower dosages. In some embodiments, the CTP sequences modification is advantageous in permitting fewer dosages. In some embodiments, the CTP sequences modification is advantageous in permitting a safe long acting effect.
- polypeptide engineered coagulation factor
- protein encompasses native polypeptides (either degradation products, synthetically synthesized polypeptides or recombinant polypeptides) and peptidomimetics (typically, synthetically synthesized polypeptides), as well as peptoids and semipeptoids which are polypeptide analogs, which have, in some embodiments, modifications rendering the polypeptides comprising a coagulation factor even more stable while in a body or more capable of penetrating into cells.
- modifications include, but are limited to C terminus modification, polypeptide bond modification, including, but not limited to, CH2-NH, CH2-S,
- Methods for preparing peptidomimetic compounds are well known in the art and are specified, for example, in Quantitative Drug Design, CA.
- polypeptide bonds (-CO-NH-) within the polypeptide are substituted.
- the polypeptide bonds are substituted by N-methylated bonds (-N(CH3)-CO-).
- the polypeptide bonds are substituted by ester bonds (-C(R)H-C-O-O-C(R)-N-).
- the polypeptide bonds are substituted by ketomethylen bonds (-CO-CH2-).
- the polypeptide bonds are substituted by ⁇ -aza bonds (-NH-N(R)-CO-), wherein R is any alkyl, e.g., methyl, carba bonds (-CH2-NH-).
- natural aromatic amino acids of the polypeptide such as Trp, Tyr and Phe
- synthetic non-natural acid such as Phenylglycme, TIC, naphthylelanine (NoI), ring-methylated derivatives of Phe, halogenated derivatives of Phe or o-methyl-Tyr.
- the polypeptides of the present invention include one or more modified amino acid or one or more non-amino acid monomers (e.g. fatty acid, complex carbohydrates etc).
- amino acid or “amino acid sequence” is understood to include the 20 naturally occurring amino acid; those amino acid often modified post-translationally in vivo, including, for example, hydroxyproline, phosphoserine and phosphothreonine; and other unusual amino acid including, but not limited to, 2-aminoadipic acid, hydroxylysine, isodesmosine, nor-valine, nor-leucine and ornithine.
- amino acid includes both D- and L-amino acid.
- the polypeptides of the present invention are utilized in therapeutics which requires the polypeptides comprising a coagulation factor to be in a soluble form.
- the polypeptides of the present invention include one or more non-natural or natural polar amino acid, including but not limited to serine and threonine which are capable of increasing polypeptide solubility due to their hydroxyl- containing side chain.
- the engineered coagulation factor of the present invention is utilized in a linear form, although it will be appreciated by one skilled in the art that in cases where cyclicization does not severely interfere with engineered coagulation factors characteristics, cyclic forms of the engineered coagulation factors can also be utilized.
- the engineered coagulation factors of present invention are biochemically synthesized such as by using standard solid phase techniques.
- these biochemical methods include exclusive solid phase synthesis, partial solid phase synthesis, fragment condensation, or classical solution synthesis.
- recombinant protein techniques are used to generate the engineered coagulation factors of the present invention.
- recombinant protein techniques are used for the generation of relatively long polypeptides (e.g., longer than 18-25 amino acids).
- recombinant protein techniques are used for the generation of large amounts of the engineered coagulation factors of the present invention.
- recombinant techniques are described by Bitter et al., (1987) Methods in Enzymol. 153:516-544, Studier et al. (1990) Methods in Enzymol. 185:60-89, Brisson et al.
- the invention provides a polynucleotide molecule comprising a coding portion encoding a polypeptide comprising a coagulation factor and one to ten gonadotrophin carboxy terminal peptides attached to a carboxy terminus of the coagulation factor.
- the invention provides a polynucleotide molecule comprising a coding portion encoding a polypeptide consisting a coagulation factor and one to ten gonadotrophin carboxy terminal peptides attached to a carboxy terminus of the coagulation factor.
- the invention provides a polynucleotide molecule comprising a coding portion encoding a polypeptide consisting a coagulation factor and one to seven gonadotrophin carboxy terminal peptides attached to a carboxy terminus of the coagulation factor. In another embodiment, the invention provides a polynucleotide molecule comprising a coding portion encoding a polypeptide consisting a coagulation factor and two to eight gonadotrophin carboxy terminal peptides attached to a carboxy terminus of the coagulation factor.
- the invention provides a polynucleotide molecule comprising a coding portion encoding a polypeptide consisting a coagulation factor and one to five gonadotrophin carboxy terminal peptides attached to a carboxy terminus of the coagulation factor.
- the invention provides an expression vector comprising a polynucleotide molecule as described herein.
- the invention provides a cell comprising the expression vector as described herein.
- the invention provides a composition comprising the expression vector as described herein.
- the invention provides a composition comprising the cell as described herein.
- the cell is a eukaryotic cell.
- the cell is a prokaryotic cell.
- engineered coagulation factors of the present invention are synthesized using a polynucleotide molecule encoding a polypeptide of the present invention.
- the polynucleotide molecule encoding engineered coagulation factors of the present invention is ligated into an expression vector, comprising a transcriptional control of a cis-regulatory sequence (e.g., promoter sequence).
- a cis-regulatory sequence e.g., promoter sequence.
- the cis- regulatory sequence is suitable for directing constitutive expression of the engineered coagulation factors of the present invention.
- the cis-regulatory sequence is suitable for directing tissue specific expression of the engineered coagulation factors of the present invention.
- the cis-regulatory sequence is suitable for directing inducible expression of the engineered coagulation factors of the present invention.
- tissue-specific promoters suitable for use with the present invention include sequences which are functional in specific cell population, example include, but are not limited to promoters such as albumin that is liver specific [Pinkert et al., (1987) Genes Dev. 1:268-277], lymphoid specific promoters [Calame et al., (1988) Adv. Immunol. 43:235-275]; in particular promoters of T-cell receptors [Winoto et al., (1989) EMBO J. 8:729-733] and immunoglobulins; [Banerji et al.
- neuron-specific promoters such as the neurofilament promoter [Byrne et al. (1989) Proc. Natl. Acad. Sci. USA 86:5473-5477], pancreas-specific promoters [Edlunch et al. (1985) Science 230:912- 916] or mammary gland-specific promoters such as the milk whey promoter (U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166).
- Inducible promoters suitable for use with the present invention include for example the tetracycline-inducible promoter (Srour, M.A., et al., 2003. Thromb. Haemost. 90: 398-405).
- a polynucleotide molecule refers to a single or double stranded nucleic acid sequence which be isolated and provided in the form of an RNA sequence, a complementary polynucleotide sequence (cDNA), a genomic polynucleotide sequence and/or a composite polynucleotide sequences (e.g., a combination of the above).
- complementary polynucleotide sequence refers to a sequence, which results from reverse transcription of messenger RNA using a reverse transcriptase or any other RNA dependent DNA polymerase.
- the sequence can be subsequently amplified in-vivo or in-vitro using a DNA polymerase.
- genomic polynucleotide sequence refers to a sequence derived (isolated) from a chromosome and thus it represents a contiguous portion of a chromosome.
- composite polynucleotide sequence refers to a sequence, which is at least partially complementary and at least partially genomic.
- a composite sequence can include some exonal sequences required to encode the polypeptide of the present invention, as well as some intronic sequences interposing there between.
- the intronic sequences can be of any source, including of other genes, and typically will include conserved splicing signal sequences.
- intronic sequences include cis acting expression regulatory elements.
- polynucleotides of the present invention are prepared using PCR techniques, or any other method or procedure known to one skilled in the art.
- the procedure involves the ligation of two different DNA sequences (See, for example, "Current Protocols in Molecular Biology", eds. Ausubel et al., John Wiley & Sons, 1992).
- polynucleotides of the present invention which encode the engineered coagulation factors are inserted into expression vectors (i.e., a nucleic acid construct) to enable expression of the recombinant polypeptide.
- the expression vector of the present invention includes additional sequences which render this vector suitable for replication and integration in prokaryotes.
- the expression vector of the present invention includes additional sequences which render this vector suitable for replication and integration in eukaryotes.
- the expression vector of the present invention includes a shuttle vector which renders this vector suitable for replication and integration in both prokaryotes and eukaryotes.
- cloning vectors comprise transcription and translation initiation sequences (e.g., promoters, enhances) and transcription and translation terminators (e.g., polyadenylation signals).
- prokaryotic or eukaryotic cells can be used as host- expression systems to express the coagulation factors of the present invention.
- these include, but are not limited to, microorganisms, such as bacteria transformed with a recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vector containing the polypeptide coding sequence; yeast transformed with recombinant yeast expression vectors containing the polypeptide coding sequence; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors, such as Ti plasmid, containing the polypeptide coding sequence.
- microorganisms such as bacteria transformed with a recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vector containing the polypeptide coding sequence
- yeast transformed with recombinant yeast expression vectors containing the polypeptide coding sequence e.
- non-bacterial expression systems are used (e.g. mammalian expression systems such as CHO cells) to express the coagulation factors of the present invention.
- the expression vector used to express polynucleotides of the present invention in mammalian cells is pCI-DHFR vector comprising a CMV promoter and a neomycin resistance gene. Construction of the pCI-dhfr vector is described, according to one embodiment, in Example 1.
- a number of expression vectors can be advantageously selected depending upon the use intended for the polypeptide expressed.
- large quantities of polypeptide are desired.
- vectors that direct the expression of high levels of the protein product, possibly as a fusion with a hydrophobic signal sequence, which directs the expressed product into the periplasm of the bacteria or the culture medium where the protein product is readily purified are desired.
- vectors adaptable to such manipulation include, but are not limited to, the pET series of E. coli expression vectors [Studier et al, Methods in Enzymol. 185:60-89 (1990)].
- yeast expression systems are used.
- a number of vectors containing constitutive or inducible promoters can be used in yeast as disclosed in U.S. Pat. Application. No: 5,932,447.
- vectors which promote integration of foreign DNA sequences into the yeast chromosome are used.
- the expression vector of the present invention can further include additional polynucleotide sequences that allow, for example, the translation of several proteins from a single mRNA such as an internal ribosome entry site (IRES) and sequences for genomic integration of the promoter-chimeric polypeptide.
- IRS internal ribosome entry site
- mammalian expression vectors include, but are not limited to, pcDNA3, pcDNA3.1 (+/-), pGL3, pZeoSV2(+/-), pSecTag2, pDisplay, pEF/myc/cyto, pCMV/myc/cyto, pCR3.1, pSinRep5, DH26S, DHBB, pNMTl, pNMT41, pNMT81, which are available from Invitrogen, pCI which is available from Promega, pMbac, pPbac, pBK- RSV and pBK-CMV which are available from Strategene, pTRES which is available from Clontech, and their derivatives.
- expression vectors containing regulatory elements from eukaryotic viruses such as retroviruses are used by the present invention.
- SV40 vectors include pSVT7 and pMT2.
- vectors derived from bovine papilloma virus include pBV- IMTHA, and vectors derived from Epstein Bar virus include pHEBO, and p2O5.
- exemplary vectors include pMSG, pAV009/A + , pMTO10/A + , pMAMneo-5, baculo virus pDSVE, and any other vector allowing expression of proteins under the direction of the SV-40 early promoter, SV-40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
- recombinant viral vectors are useful for in-vivo expression of the coagulation factors of the present invention since they offer advantages such as lateral infection and targeting specificity.
- lateral infection is inherent in the life cycle of, for example, retrovirus and is the process by which a single infected cell produces many progeny virions that bud off and infect neighboring cells.
- the result is that a large area becomes rapidly infected, most of which was not initially infected by the original viral particles.
- viral vectors are produced that are unable to spread laterally. In one embodiment, this characteristic can be useful if the desired purpose is to introduce a specified gene into only a localized number of targeted cells.
- various methods can be used to introduce the expression vector of the present invention into cells. Such methods are generally described in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Springs Harbor Laboratory, New York (1989, 1992), in Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1989), Chang et al., Somatic Gene Therapy, CRC Press, Ann Arbor, Mich. (1995), Vega et al., Gene Targeting, CRC Press, Ann Arbor Mich. (1995), Vectors: A Survey of Molecular Cloning Vectors and Their Uses, Butterworths, Boston Mass. (1988) and Gilboa et at.
- introduction of nucleic acid by viral infection offers several advantages over other methods such as lipofection and electroporation, since higher transfection efficiency can be obtained due to the infectious nature of viruses.
- the engineered coagulation factors of the present invention can also be expressed from a nucleic acid construct administered to the individual employing any suitable mode of administration, described hereinabove (i.e., in- vivo gene therapy).
- the nucleic acid construct is introduced into a suitable cell via an appropriate gene delivery vehicle/method (transfection, transduction, homologous recombination, etc.) and an expression system as needed and then the modified cells are expanded in culture and returned to the individual (i.e., ex-vivo gene therapy).
- plant expression vectors are used.
- the expression of a polypeptide coding sequence is driven by a number of promoters.
- viral promoters such as the 35S RNA and 19S RNA promoters of CaMV [Brisson et al, Nature 310:511-514 (1984)], or the coat protein promoter to TMV [Takamatsu et al, EMBO J. 3:17-311 (1987)] are used.
- plant promoters are used such as, for example, the small subunit of RUBISCO [Coruzzi et al, EMBO J.
- constructs are introduced into plant cells using Ti plasmid, Ri plasmid, plant viral vectors, direct DNA transformation, microinjection, electroporation and other techniques well known to the skilled artisan. See, for example, Weissbach & Weissbach [Methods for Plant Molecular Biology, Academic Press, NY, Section VIII, pp 421-463 (1988)].
- Other expression systems such as insects and mammalian host cell systems, which are well known in the art, can also be used by the present invention.
- the expression construct of the present invention can also include sequences engineered to optimize stability, production, purification, yield or activity of the expressed polypeptide.
- Various methods can be used to introduce the expression vector of the present invention into the host cell system.
- such methods are generally described in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Springs Harbor Laboratory, New York (1989, 1992), in Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1989), Chang et al., Somatic Gene Therapy, CRC Press, Ann Arbor, Mich. (1995), Vega et al., Gene Targeting, CRC Press, Ann Arbor Mich. (1995), Vectors: A Survey of Molecular Cloning Vectors and Their Uses, Butterworths, Boston Mass. (1988) and Gilboa et at.
- transformed cells are cultured under effective conditions, which allow for the expression of high amounts of recombinant engineered coagulation factors.
- effective culture conditions include, but are not limited to, effective media, bioreactor, temperature, pH and oxygen conditions that permit protein production.
- an effective medium refers to any medium in which a cell is cultured to produce the recombinant polypeptide of the present invention.
- a medium typically includes an aqueous solution having assimilable carbon, nitrogen and phosphate sources, and appropriate salts, minerals, metals and other nutrients, such as vitamins.
- cells of the present invention can be cultured in conventional fermentation bioreactors, shake flasks, test tubes, microtiter dishes and petri plates. In some embodiments, culturing is carried out at a temperature, pH and oxygen content appropriate for a recombinant cell. In some embodiments, culturing conditions are within the expertise of one of ordinary skill in the art.
- resultant engineered coagulation factors of the present invention either remain within the recombinant cell, secreted into the fermentation medium, secreted into a space between two cellular membranes, such as the periplasmic space in E. coli; or retained on the outer surface of a cell or viral membrane.
- recovery of the recombinant engineered coagulation factor is effected.
- engineered coagulation factors of the present invention are purified using a variety of standard protein purification techniques, such as, but not limited to, affinity chromatography, ion exchange chromatography, filtration, electrophoresis, hydrophobic interaction chromatography, gel filtration chromatography, reverse phase chromatography, concanavalin A chromatography, chromatofocusing and differential solubilization.
- the expressed coding sequence can be engineered to encode the engineered coagulation factor of the present invention and fused cleavable moiety.
- a fusion protein can be designed so that the polypeptide can be readily isolated by affinity chromatography; e.g., by immobilization on a column specific for the cleavable moiety.
- a cleavage site is engineered between the engineered coagulation factor and the cleavable moiety and the polypeptide can be released from the chromatographic column by treatment with an appropriate enzyme or agent that specifically cleaves the fusion protein at this site [e.g., see Booth et ah, Immunol. Lett.
- the engineered coagulation factor of the present invention is retrieved in "substantially pure" form.
- the phrase "substantially pure” refers to a purity that allows for the effective use of the protein in the applications described herein.
- the engineered coagulation factor of the present invention can also be synthesized using in-vitro expression systems. In one embodiment, in-vitro synthesis methods are well known in the art and the components of the system are commercially available.
- the recombinant engineered coagulation factors are synthesized and purified; their therapeutic efficacy can be assayed either in-vivo or in vitro.
- the binding activities of the recombinant engineered coagulation factors of the present invention can be ascertained using various assays as known to one of skill in the art.
- the engineered coagulation factor of the present invention can be provided to the individual per se. In one embodiment, the engineered coagulation factor of the present invention can be provided to the individual as part of a pharmaceutical composition where it is mixed with a pharmaceutically acceptable carrier.
- a "pharmaceutical composition” refers to a preparation of one or more of the active ingredients described herein with other chemical components such as physiologically suitable carriers and excipients.
- the purpose of a pharmaceutical composition is to facilitate administration of a compound to an organism.
- active ingredient refers to the polypeptide sequence of interest, which is accountable for the biological effect.
- any of the compositions of this invention will comprise at least one CTP sequence bound only to the carboxy terminus a engineered coagulation factor of interest, in any form.
- the present invention provides combined preparations.
- "a combined preparation” defines especially a "kit of parts" in the sense that the combination partners as defined above can be dosed independently or by use of different fixed combinations with distinguished amounts of the combination partners i.e., simultaneously, concurrently, separately or sequentially.
- the parts of the kit of parts can then, e.g., be administered simultaneously or chronologically staggered, that is at different time points and with equal or different time intervals for any part of the kit of parts.
- the ratio of the total amounts of the combination partners in some embodiments, can be administered in the combined preparation.
- the combined preparation can be varied, e.g., in order to cope with the needs of a patient subpopulation to be treated or the needs of the single patient which different needs can be due to a particular disease, severity of a disease, age, sex, or body weight as can be readily made by a person skilled in the art.
- physiologically acceptable carrier and “pharmaceutically acceptable carrier” which be interchangeably used refer to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered compound.
- An adjuvant is included under these phrases.
- one of the ingredients included in the pharmaceutically acceptable carrier can be for example polyethylene glycol (PEG), a biocompatible polymer with a wide range of solubility in both organic and aqueous media
- excipient refers to an inert substance added to a pharmaceutical composition to further facilitate administration of an active ingredient.
- excipients include calcium carbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils and polyethylene glycols.
- suitable routes of administration include oral, rectal, transmucosal, transnasal, intestinal or parenteral delivery, including intramuscular, subcutaneous and intramedullary injections as well as intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, or intraocular injections.
- the preparation is administered in a local rather than systemic manner, for example, via injection of the preparation directly into a specific region of a patient's body.
- Various embodiments of dosage ranges are contemplated by this invention.
- the dosage of the engineered coagulation factor of the present invention in one embodiment, is in the range of 0.005-100 mg/day. In another embodiment, the dosage is in the range of 0.005-5 mg/day. In another embodiment, the dosage is in the range of 0.01-50 mg/day. In another embodiment, the dosage is in the range of 0.1-20 mg/day. In another embodiment, the dosage is in the range of 0.1-10 mg/day. In another embodiment, the dosage is in the range of 0.01-5 mg/day.
- the dosage is in the range of 0.001-0.01 mg/day. In another embodiment, the dosage is in the range of 0.001-0.1 mg/day. In another embodiment, the dosage is in the range of 0.1-5 mg/day. hi another embodiment, the dosage is in the range of 0.5-50 mg/day. hi another embodiment, the dosage is in the range of 0.2-15mg/day. In another embodiment, the dosage is in the range of 0.8-65 mg/day. In another embodiment, the dosage is in the range of 1-50 mg/day. hi another embodiment, the dosage is in the range of 5-10 mg/day. In another embodiment, the dosage is in the range of 8-15 mg/day. hi another embodiment, the dosage is in a range of 10-20mg/day.
- the dosage is in the range of 20-40 mg/day. hi another embodiment, the dosage is in a range of 60-120 mg/day. In another embodiment, the dosage is in the range of 12-40 mg/day. hi another embodiment, the dosage is in the range of 40-60 mg/day. In another embodiment, the dosage is in a range of 50-100mg/day. In another embodiment, the dosage is in a range of 1-60 mg/day. hi another embodiment, the dosage is in the range of 15-25 mg/day. In another embodiment, the dosage is in the range of 5-10 mg/day. hi another embodiment, the dosage is in the range of 55-65 mg/day.
- a polypeptide comprising a coagulation factor and at least one CTP unit is formulated in an intranasal dosage form.
- a polypeptide comprising a coagulation factor and at least one CTP unit is formulated in an injectable dosage form.
- a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 0.0001 mg to 0.6 mg.
- a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 0.001 mg to 0.005 mg.
- a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 0.005 mg to 0.01 mg. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 0.01 mg to 0.3 mg. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose in a dose ranging from 0.2 mg to 0.6 mg. In another embodiment, a coagulation factor is free of CTPs on its amino terminus.
- a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 1-100 micrograms. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 10-80 micrograms. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 20-60 micrograms. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 10-50 micrograms.
- a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 40-80 micrograms. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 10-30 micrograms. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 30-60 micrograms.
- a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 0.2 mg to 2 mg. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 2 mg to 6 mg. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 4 mg to 10 mg. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject in a dose ranging from 5 mg and 15 mg.
- a polypeptide comprising a coagulation factor and at least one CTP unit is injected into the muscle (intramuscular injection). In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is injected below the skin (subcutaneous injection). In another embodiment, a polypeptide comprising an IFN protein and CTP units is injected into the muscle. In another embodiment, a polypeptide comprising an IFN protein and CTP units is injected below the skin.
- the methods of the invention include increasing the compliance in the use of coagulation factor therapy, comprising providing to a subject in need thereof, a polypeptide comprising a coagulation factor, one chorionic gonadotrophin carboxy terminal peptide (CTP) attached to an amino terminus of the coagulation factor, and two chorionic gonadotrophin carboxy terminal peptides attached to a carboxy terminus of the coagulation factor, thereby increasing compliance in the use of coagulation factor therapy.
- CTP chorionic gonadotrophin carboxy terminal peptide
- the methods of the invention include increasing the compliance of patients afflicted with chronic illnesses that are in need of a coagulation factor therapy.
- the methods of the invention enable reduction in the dosing frequency of a coagulation factor by modifying the coagulation factor with CTPs as described hereinabove.
- the term compliance comprises adherence.
- the methods of the invention include increasing the compliance of patients in need of a coagulation factor therapy by reducing the frequency of administration of the coagulation factor.
- reduction in the frequency of administration of the coagulation factor is achieved due to the CTP modifications which render the CTP- modified coagulation factor more stable.
- reduction in the frequency of administration of the coagulation factor is achieved as a result of increasing Tl/2 of the coagulation factor. In another embodiment, reduction in the frequency of administration of the coagulation factor is achieved as a result of increasing the clearance time of the coagulation factor. In another embodiment, reduction in the frequency of administration of the coagulation factor is achieved as a result of increasing the AUC measure of the coagulation factor.
- a method of reducing a dosing frequency of a coagulation factor comprising the step of attaching one to ten CTPs to a carboxy terminus of a coagulation factor, thereby reducing a dosing frequency of a coagulation factor.
- a method of reducing a dosing frequency of a coagulation factor comprising the step of attaching one to five CTPs to a carboxy terminus of a coagulation factor, thereby reducing a dosing frequency of a coagulation factor.
- a method of increasing compliance in the use of coagulation factor therapy comprising providing to a subject in need thereof, a polypeptide comprising a coagulation factor and one to ten chorionic gonadotrophin carboxy terminal peptides attached to a carboxy terminus of a coagulation factor, thereby increasing compliance in the use of coagulation factor therapy.
- a method of increasing compliance in the use of coagulation factor therapy comprising providing to a subject in need thereof, a polypeptide comprising a coagulation factor and one to five chorionic gonadotrophin carboxy terminal peptides attached to a carboxy terminus of a coagulation factor, thereby increasing compliance in the use of coagulation factor therapy.
- a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject once a day. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject once every two days. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject once every three days. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject once every four days. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject once every five days.
- a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject once every six days. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject once every week. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject once every 7-14 days. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject once every 10-20 days. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject once every 5-15 days. In another embodiment, a polypeptide comprising a coagulation factor and at least one CTP unit is administered to a subject once every 15-30 days.
- the dosage is in a range of 50-500 mg/day. In another embodiment, the dosage is in a range of 50-150 mg/day. In another embodiment, the dosage is in a range of 100-200 mg/day. hi another embodiment, the dosage is in a range of 150-250 mg/day. In another embodiment, the dosage is in a range of 200-300 mg/day. hi another embodiment, the dosage is in a range of 250-400 mg/day. In another embodiment, the dosage is in a range of 300- 500 mg/day. In another embodiment, the dosage is in a range of 350-500 mg/day.
- the dosage is 20 mg/day. In one embodiment, the dosage is 30 mg/day. In one embodiment, the dosage is 40 mg/day. In one embodiment, the dosage is 50 mg/day. In one embodiment, the dosage is 0.01 mg/day. In another embodiment, the dosage is 0.1 mg/day. In another embodiment, the dosage is 1 mg/day. hi another embodiment, the dosage is 0.530 mg/day. In another embodiment, the dosage is 0.05 mg/day. In another embodiment, the dosage is 50 mg/day. In another embodiment, the dosage is 10 mg/day. In another embodiment, the dosage is 20-70 mg/day. In another embodiment, the dosage is 5 mg/day.
- the dosage is 1-90 mg/day. In another embodiment, the dosage is 1-90 mg/2 days. In another embodiment, the dosage is 1-90 mg/3 days. In another embodiment, the dosage is 1-90 mg/4 days. In another embodiment, the dosage is 1-90 mg/5 days. In another embodiment, the dosage is 1-90 mg/6 days. In another embodiment, the dosage is 1-90 mg/week. In another embodiment, the dosage is 1-90 mg/9 days. In another embodiment, the dosage is 1-90 mg/11 days. In another embodiment, the dosage is 1-90 mg/14 days.
- the coagulation factor dosage is 10-50 mg/day. In another embodiment, the dosage is 10-50 mg/2 days. In another embodiment, the dosage is 10-50 mg/3 days. In another embodiment, the dosage is 10-50 mg/4 days, hi another embodiment, the dosage is 10-50 micrograms mg/5 days. In another embodiment, the dosage is 10-50 mg/6 days. In another embodiment, the dosage is 10-50 mg/week. hi another embodiment, the dosage is 10-50 mg/9 days. In another embodiment, the dosage is 10-50 mg/11 days. In another embodiment, the dosage is 10-50 mg/14 days.
- Oral administration in one embodiment, comprises a unit dosage form comprising tablets, capsules, lozenges, chewable tablets, suspensions, emulsions and the like.
- Such unit dosage forms comprise a safe and effective amount of the desired coagulation factor of the invention, each of which is in one embodiment, from about 0.7 or 3.5 mg to about 280 mg/70 kg, or in another embodiment, about 0.5 or 10 mg to about 210 mg/70 kg.
- the pharmaceutically- acceptable carriers suitable for the preparation of unit dosage forms for peroral administration are well-known in the art.
- tablets typically comprise conventional pharmaceutically-compatible adjuvants as inert diluents, such as calcium carbonate, sodium carbonate, mannitol, lactose and cellulose; binders such as starch, gelatin and sucrose; disintegrants such as starch, alginic acid and croscarmelose; lubricants such as magnesium stearate, stearic acid and talc, hi one embodiment, glidants such as silicon dioxide can be used to improve flow characteristics of the powder-mixture, hi one embodiment, coloring agents, such as the FD&C dyes, can be added for appearance.
- inert diluents such as calcium carbonate, sodium carbonate, mannitol, lactose and cellulose
- binders such as starch, gelatin and sucrose
- disintegrants such as starch, alginic acid and croscarmelose
- lubricants such as magnesium stearate, stearic acid and talc
- glidants such
- Sweeteners and flavoring agents such as aspartame, saccharin, menthol, peppermint, and fruit flavors, are useful adjuvants for chewable tablets.
- Capsules typically comprise one or more solid diluents disclosed above, hi some embodiments, the selection of carrier components depends on secondary considerations like taste, cost, and shelf stability, which are not critical for the purposes of this invention, and can be readily made by a person skilled in the art.
- the oral dosage form comprises predefined release profile.
- the oral dosage form of the present invention comprises an extended release tablets, capsules, lozenges or chewable tablets.
- the oral dosage form of the present invention comprises a slow release tablets, capsules, lozenges or chewable tablets.
- the oral dosage form of the present invention comprises an immediate release tablets, capsules, lozenges or chewable tablets, hi one embodiment, the oral dosage form is formulated according to the desired release profile of the pharmaceutical active ingredient as known to one skilled in the art.
- Peroral compositions in some embodiments, comprise liquid solutions, emulsions, suspensions, and the like.
- pharmaceutically-acceptable carriers suitable for preparation of such compositions are well known in the art.
- liquid oral compositions comprise from about 0.001% to about 0.933% of the desired compound or compounds, or in another embodiment, from about 0.01% to about 10 %.
- compositions for use in the methods of this invention comprise solutions or emulsions, which in some embodiments are aqueous solutions or emulsions comprising a safe and effective amount of the compounds of the present invention and optionally, other compounds, intended for topical intranasal administration, hi some embodiments, h compositions comprise from about 0.001% to about 10.0% w/v of a subject compound, more preferably from about 00.1% to about 2.0, which is used for systemic delivery of the compounds by the intranasal route.
- the pharmaceutical compositions are administered by intravenous, intra-arterial, or intramuscular injection of a liquid preparation
- liquid formulations include solutions, suspensions, dispersions, emulsions, oils and the like
- the pharmaceutical compositions are administered intravenously, and are thus formulated in a form suitable for intravenous administration
- the pharmaceutical compositions are administered intra-arterially, and are thus formulated in a form suitable for intra-arterial administration
- the pharmaceutical compositions are administered intramuscularly, and are thus formulated in a form suitable for intramuscular administration.
- the pharmaceutical compositions are administered topically to body surfaces, and are thus formulated in a form suitable for topical administration.
- Suitable topical formulations include gels, ointments, creams, lotions, drops and the like.
- the compounds of the present invention are combined with an additional appropriate therapeutic agent or agents, prepared and applied as solutions, suspensions, or emulsions in a physiologically acceptable diluent with or without a pharmaceutical carrier.
- compositions of the present invention are manufactured by processes well known in the art, e.g., by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes.
- compositions for use in accordance with the present invention is formulated in conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into preparations which, can be used pharmaceutically.
- formulation is dependent upon the route of administration chosen.
- injectables, of the invention are formulated in aqueous solutions.
- injectables, of the invention are formulated in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer.
- physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer.
- penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
- the preparations described herein are formulated for parenteral administration, e.g., by bolus injection or continuous infusion.
- formulations for injection are presented in unit dosage form, e.g., in ampoules or in multidose containers with optionally, an added preservative.
- compositions are suspensions, solutions or emulsions in oily or aqueous vehicles, and contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- compositions also comprise, in some embodiments, preservatives, such as benzalkonium chloride and thimerosal and the like; chelating agents, such as edetate sodium and others; buffers such as phosphate, citrate and acetate; tonicity agents such as sodium chloride, potassium chloride, glycerin, mannitol and others; antioxidants such as ascorbic acid, acetylcystine, sodium metabisulfote and others; aromatic agents; viscosity adjusters, such as polymers, including cellulose and derivatives thereof; and polyvinyl alcohol and acid and bases to adjust the pH of these aqueous compositions as needed.
- the compositions also comprise, in some embodiments, local anesthetics or other actives.
- the compositions can be used as sprays, mists, drops, and the like.
- compositions for parenteral administration include aqueous solutions of the active preparation in water-soluble form.
- suspensions of the active ingredients are prepared as appropriate oily or water based injection suspensions.
- Suitable lipophilic solvents or vehicles include, in some embodiments, fatty oils such as sesame oil, or synthetic fatty acid esters such as ethyl oleate, triglycerides or liposomes.
- Aqueous injection suspensions contain, in some embodiments, substances, which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol or dextran.
- the suspension also contain suitable stabilizers or agents which increase the solubility of the active ingredients to allow for the preparation of highly concentrated solutions.
- the active compound can be delivered in a vesicle, in particular a liposome (see Langer, Science 249:1527-1533 (1990); Treat et al, in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez- Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid).
- a liposome see Langer, Science 249:1527-1533 (1990); Treat et al, in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez- Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid).
- the pharmaceutical composition delivered in a controlled release system is formulated for intravenous infusion, implantable osmotic pump, transdermal patch, liposomes, or other modes of administration.
- a pump is used (see Langer, supra; Sefton, CRC Grit. Ref. Biomed Eng. 14:201 (1987); Buchwald et al., Surgery 88:507 (1980); Saudek et al., N. Engl. J. Med. 321:51 A (1989).
- polymeric materials can be used.
- a controlled release system can be placed in proximity to the therapeutic target, i.e., the brain, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984). Other controlled release systems are discussed in the review by Langer (Science 249:1527-1533 (1990).
- the active ingredient is in powder form for constitution with a suitable vehicle, e.g., sterile, pyrogen-free water based solution, before use.
- Compositions are formulated, in some embodiments, for atomization and inhalation administration.
- compositions are contained in a container with attached atomizing means.
- the preparation of the present invention is formulated in rectal compositions such as suppositories or retention enemas, using, e.g., conventional suppository bases such as cocoa butter or other glycerides.
- compositions suitable for use in context of the present invention include compositions wherein the active ingredients are contained in an amount effective to achieve the intended purpose.
- a therapeutically effective amount means an amount of active ingredients effective to prevent, alleviate or ameliorate symptoms of disease or prolong the survival of the subject being treated.
- compositions which can serve as pharmaceutically-acceptable carriers or components thereof are sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose, and methyl cellulose; powdered tragacanth; malt; gelatin; talc; solid lubricants, such as stearic acid and magnesium stearate; calcium sulfate; vegetable oils, such as peanut oil, cottonseed oil, sesame oil, olive oil, corn oil and oil of theobroma; polyols such as propylene glycol, glycerine, sorbitol, mannitol, and polyethylene glycol; alginic acid; emulsif ⁇ ers, such as the TweenTM brand emulsifiers; wetting agents,
- a pharmaceutically-acceptable carrier to be used in conjunction with the compound is basically determined by the way the compound is to be administered. If the subject compound is to be injected, in one embodiment, the pharmaceutically-acceptable carrier is sterile, physiological saline, with a blood-compatible suspending agent, the pH of which has been adjusted to about 7.4.
- compositions further comprise binders (e.g. acacia, cornstarch, gelatin, carbomer, ethyl cellulose, guar gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, povidone), disintegrating agents (e.g.
- binders e.g. acacia, cornstarch, gelatin, carbomer, ethyl cellulose, guar gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, povidone
- disintegrating agents e.g.
- cornstarch pojato starch, alginic acid, silicon dioxide, croscarmelose sodium, crospovidone, guar gum, sodium starch glycolate), buffers (e.g., Tris- HCL, acetate, phosphate) of various pH and ionic strength, additives such as albumin or gelatin to prevent absorption to surfaces, detergents (e.g., Tween 20, Tween 80, Pluronic F68, bile acid salts), protease inhibitors, surfactants (e.g.
- sodium lauryl sulfate sodium lauryl sulfate
- permeation enhancers solubilizing agents (e.g., glycerol, polyethylene glycerol), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite, butylated hydroxyanisole), stabilizers (e.g. hydroxypropyl cellulose, hyroxypropylmethyl cellulose), viscosity increasing agents(e.g. carbomer, colloidal silicon dioxide, ethyl cellulose, guar gum), sweeteners (e.g. aspartame, citric acid), preservatives (e.g., Thimerosal, benzyl alcohol, parabens), lubricants (e.g.
- stearic acid magnesium stearate, polyethylene glycol, sodium lauryl sulfate), flow-aids (e.g. colloidal silicon dioxide), plasticizers (e.g. diethyl phthalate, triethyl citrate), emulsifiers (e.g. carbomer, hydroxypropyl cellulose, sodium lauryl sulfate), polymer coatings (e.g., poloxamers or poloxamines), coating and film forming agents (e.g. ethyl cellulose, acrylates, polymethacrylates) and/or adjuvants.
- plasticizers e.g. diethyl phthalate, triethyl citrate
- emulsifiers e.g. carbomer, hydroxypropyl cellulose, sodium lauryl sulfate
- polymer coatings e.g., poloxamers or poloxamines
- coating and film forming agents e.g. ethyl cellulose
- Typical components of carriers for syrups, elixirs, emulsions and suspensions include ethanol, glycerol, propylene glycol, polyethylene glycol, liquid sucrose, sorbitol and water.
- typical suspending agents include methyl cellulose, sodium carboxymethyl cellulose, cellulose (e.g. AvicelTM, RC-591), tragacanth and sodium alginate;
- typical wetting agents include lecithin and polyethylene oxide sorbitan (e.g. polysorbate 80).
- Typical preservatives include methyl paraben and sodium benzoate.
- peroral liquid compositions also contain one or more components such as sweeteners, flavoring agents and colorants disclosed above.
- compositions also include incorporation of the active material into or onto particulate preparations of polymeric compounds such as polylactic acid, polglycolic acid, hydrogels, etc, or onto liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts, or spheroplasts.)
- polymeric compounds such as polylactic acid, polglycolic acid, hydrogels, etc, or onto liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts, or spheroplasts.
- particulate compositions coated with polymers e.g. poloxamers or poloxamines
- polymers e.g. poloxamers or poloxamines
- compounds modified by the covalent attachment of water- soluble polymers such as polyethylene glycol, copolymers of polyethylene glycol and polypropylene glycol, carboxymethyl cellulose, dextran, polyvinyl alcohol, polyvinylpyrrolidone or polyproline.
- the modified compounds exhibit substantially longer half-lives in blood following intravenous injection than do the corresponding unmodified compounds, hi one embodiment, modifications also increase the compound's solubility in aqueous solution, eliminate aggregation, enhance the physical and chemical stability of the compound, and greatly reduce the immunogenicity and reactivity of the compound, hi another embodiment, the desired in-vivo biological activity is achieved by the administration of such polymer-compound abducts less frequently or in lower doses than with the unmodified compound.
- preparation of effective amount or dose can be estimated initially from in-vitro assays.
- a dose can be formulated in animal models and such information can be used to more accurately determine useful doses in humans.
- toxicity and therapeutic efficacy of the active ingredients described herein can be determined by standard pharmaceutical procedures in vitro, in cell cultures or experimental animals.
- the data obtained from these in-vitro and cell culture assays and animal studies can be used in formulating a range of dosage for use in human.
- the dosages vary depending upon the dosage form employed and the route of administration utilized, hi one embodiment, the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. [See e.g., Fingl, et al., (1975) "The Pharmacological Basis of Therapeutics", Ch. 1 p. I].
- dosing can be of a single or a plurality of administrations, with course of treatment lasting from several days to several weeks or until cure is effected or diminution of the disease state is achieved.
- compositions including the preparation of the present invention formulated in a compatible pharmaceutical carrier are also be prepared, placed in an appropriate container, and labeled for treatment of an indicated condition.
- a coagulation factor as described herein is administered via systemic administration.
- a coagulation factor as described herein is administered by intravenous, intramuscular or subcutaneous injection.
- a coagulation factor as described herein is lyophilized (i.e., freeze-dried) preparation in combination with complex organic excipients and stabilizers such as nonionic surface active agents (i.e., surfactants), various sugars, organic polyols and/or human serum albumin.
- a pharmaceutical composition comprises a lyophilized coagulation factor as described in sterile water for injection.
- a pharmaceutical composition comprises a lyophilized coagulation factor as described in sterile PBS for injection.
- a pharmaceutical composition comprises a lyophilized coagulation factor as described in sterile 0.9% NaCl for injection.
- the pharmaceutical composition comprises a coagulation factor as described herein and complex carriers such as human serum albumin, polyols, sugars, and anionic surface active stabilizing agents. See, for example, WO 89/10756 (Hara et al.- containing polyol and p-hydroxybenzoate).
- the pharmaceutical composition comprises a coagulation factor as described herein and lactobionic acid and an acetate/glycine buffer.
- the pharmaceutical composition comprises a coagulation factor as described herein and amino acids, such as arginine or glutamate that increase the solubility of interferon compositions in water.
- the pharmaceutical composition comprises a lyophilized coagulation factor as described herein and glycine or human serum albumin (HSA), a buffer (e g. acetate) and an isotonic agent (e.g NaCl).
- the pharmaceutical composition comprises a lyophilized coagulation factor as described herein and phosphate buffer, glycine and HSA.
- the pharmaceutical composition comprising a coagulation factor as described herein is stabilized when placed in buffered solutions having a pH between about 4 and 7.2.
- the pharmaceutical composition comprising a coagulation factor as described herein is stabilized with an amino acid as a stabilizing agent and in some cases a salt (if the amino acid does not contain a charged side chain).
- the pharmaceutical composition comprising a coagulation factor as described herein is a liquid composition comprising a stabilizing agent at between about 0.3% and 5% by weight which is an amino acid.
- the pharmaceutical composition comprising a coagulation factor as described herein provides dosing accuracy and product safety.
- the pharmaceutical composition comprising a coagulation factor as described herein provides a biologically active, stable liquid formulation for use in injectable applications.
- the pharmaceutical composition comprises a non- lyophilized coagulation factor as described herein.
- the pharmaceutical composition comprising a coagulation factor as described herein provides a liquid formulation permitting storage for a long period of time in a liquid state facilitating storage and shipping prior to administration.
- the pharmaceutical composition comprising a coagulation factor as described herein comprises solid lipids as matrix material.
- the injectable pharmaceutical composition comprising a coagulation factor as described herein comprises solid lipids as matrix material.
- the production of lipid microparticles by spray congealing was described by Lucasr (Speiser and al., Pharm. Res. 8 (1991) 47-54) followed by lipid nanopellets for peroral administration (Speiser EP 0167825 (1990)).
- lipids, which are used, are well tolerated by the body (e. g. glycerides composed of fatty acids which are present in the emulsions for parenteral nutrition).
- the pharmaceutical composition comprising a coagulation factor as described herein is in the form of liposomes (J. E. Diederichs and al., Pharm./nd. 56 (1994) 267- 275).
- the pharmaceutical composition comprising a coagulation factor as described herein comprises polymeric microparticles.
- the injectable pharmaceutical composition comprising a coagulation factor as described herein comprises polymeric microparticles.
- the pharmaceutical composition comprising a coagulation factor as described herein comprises nanoparticles.
- the pharmaceutical composition comprising a coagulation factor as described herein ⁇ comprises liposomes
- the pharmaceutical composition comprising a coagulation factor as described herein comprises lipid emulsion.
- the pharmaceutical composition comprising a coagulation factor as described herein comprises microspheres.
- the pharmaceutical composition comprising a coagulation factor as described herein comprises lipid nanoparticles.
- the pharmaceutical composition comprising a coagulation factor as described herein comprises lipid nanoparticles comprising amphiphilic lipids
- the pharmaceutical composition comprising a coagulation factor as described herein comprises lipid nanoparticles comprising a drug, a lipid matrix and a surfactant.
- compositions of the present invention are presented in a pack or dispenser device, such as an FDA approved kit, which contain one or more unit dosage forms containing the active ingredient.
- the pack for example, comprise metal or plastic foil, such as a blister pack.
- the pack or dispenser device is accompanied by instructions for administration.
- the pack or dispenser is accommodated by a notice associated with the container in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals, which notice is reflective of approval by the agency of the form of the compositions or human or veterinary administration.
- Factor IX is a 415 Amino acid (55KDa) glycoprotein; it belongs to a group of vitamin K dependent glycoproteins associated with the coagulation system. FIX has a similar domain organization as factor FVII, factor X, protein C and prothrombin that are synthesized as precursors with N-terminal propeptide followed by a mature amino acid sequence.
- FIX is secreted as a single chain molecule that undergoes complex post transcriptional modifications many which are critical to its biochemical and pharmacokinetic properties.
- post transcriptional modifications 12 glutamic acid residues near the amino terminus of FIX that are gamma carboxylated by the vitamin K dependent gamma carboxylase are the most crucial ones.
- Carboxylation is required for the interaction of FIX with the phospholipids surfaces and for optimal FIX activity.
- the amino terminus propeptide serves as a recognition site for the gamma carboxylase and thus following the gamma carboxylation it is cleaved off by the Golgi apparatus serine protease known as Paired basic Amino acid Cleave Enzyme (PACE/Furin).
- PACE/Furin Paired basic Amino acid Cleave Enzyme
- FIX circulates in the plasma (average concentration of 5 ⁇ g/ml) as a single chain inactive zymogen.
- the activation peptide is removed converting FIX to a fully active enzyme consisting a light and heavy chain held together by a single disulfide bond.
- the N-terminal light chain contains the non catalytic gamma carboxglutamic acid (GIa) and two Epidrmal growth factor like domains while the C- terminal heavy chain contains the trypsin like catalytic domain of the molecule.
- GIa non catalytic gamma carboxglutamic acid
- GIa non catalytic gamma carboxglutamic acid
- C- terminal heavy chain contains the trypsin like catalytic domain of the molecule.
- FIXa alone is characterized by poor catalytic activity. However when complexed with FVIII, its proteolytic activity increase by 4-5 orders of magnitudes towards its natural substrate FX..
- Hemophilia B is an X linked bleeding disorder caused by a mutation in the Factor IX
- FIX procoagulant activity gene
- Hemophilia B patients have spontaneous soft tissue hemorrhages and recurrent hemarthroses that often lead to a crippling Arthoathy.
- Current treatment for these patients includes an intravenous administration of recombinant FIX.
- issues of cost and relatively rapid clearance of FIX from the circulation makes developing a long acting FIX a challenging task.
- recombinant rFIX molecule extending half life of recombinant rFIX molecule was performed by fusion of at least one human CTP to FIX.
- the recombinant FIX-CTP was expressed in mammalian cells and characterized in- vitro and in vivo. It was demonstrated that the in -vitro activity of rFIX-
- FIX molecule Cloning and expression of recombinant FIX molecule: Dg44 cells were plated in 100mm tissue culture dishes and grown to 50-60% confluence. A total of 2 ⁇ g (microgram) of FIX cDNA was used for the transfection of one 100mm plate using the FuGene reagent (Roche) in protein free medium (Invitrogene CD Dg44). The media was removed 48 hours after transfection and replaced with a protein free medium (Invitrogene CD Dg44) without nucleosides and in the presence of 800 ⁇ g/ml of G418 (Neomycin).
- the transfected cell population was transferred into T25 tissue culture flasks and selection continued for additional 10-14 days until the cells began to grow as stable clones. High expressing clones were selected. Approximately 2x10 7 cells were used to inoculate 300ml of growth medium in a 1700cm 2 roller bottle (Corning, Corning NY) supplemented with 5ng/ml of Vitamin K3 (menadione sodium bisulfate; Sigma). The production medium (harvest) was collected after a rapid decrease in cells viability to about 70%.
- FIX antigen level FIX-CTP harvests antigen levels were determined using AssayMax Human FIX ELISA kit (AssayPro- EF 1009-1), the calculated protein concentration is the average of three different dilutions in two independent runs (Fig 3A).
- FIX SDS-PAGE - immune blot FIX-CTP harvests or purified rhFIX (American Diagnostics), lOOng of protein, were loaded on 12% Tris -Glycine gel using Precision plus dual color protein marker (Bio-Rad). The SDS-PAGE analysis was performed by western immuneblot using anti human FIX polyclonal Ab and anti human gamma carboxylation monoclonal antibody (American Diagnostics). As previously reported rhFIX migrated at 55KDa, while FIX fused to two CTPs migrated at 75KDa. Both variants of FIX-CTP proteins were shown to be gamma carboxylated (Fig 3B).
- FIX chromogenic activity A comparative assessment of the in vitro potency of FIX-CTP harvests versus rhFIX- protein (American Diagnostics) was performed using a commercially available chromogenic activity test kit, BIOPHEN (Hyphen BioMed 221802). In the present of thrombin, phospholipids, calcium, excess amounts of FXIa activates sampled FIX into FIXa. FIXa forms an enzymatic complex with thrombin, activated FVIILC (supplied in an excess amounts) phospholipids and calcium and activates factor X , present in the assay system, into FXa. The activity directly correlates to the amount of FIX, which is the limiting factor.
- the generated FXa is then measured by its specific activity on FXa chromogenic substrate (pNA).
- the amount of pNA generated is directly proportional to FIXa activity.
- rhFIX and FIX-CTP harvests were serially diluted and the potency was assessed by comparing a dose response curve of the FIX harvests to a reference preparation consisting rhFIX or human plasma.
- the average EC50 of FIX was 21ng/ml while FIX-(CTP) 2 harvest calculated EC50 was 382ng/ml, FIX-CTP harvest calculated EC50 was 1644ng/ml. Approximately 15 fold decrease in the enzymatic activity Of FIX-(CTP) 2 harvest was observed (Fig 4).
- FIX Clotting activity (aPTT): The activated partial thromboplastin time (aPTT) is a measure of the integrity of the intrinsic and common pathways of the coagulation cascade.
- the aPTT is the time, in seconds, for plasma to clot following the addition of an intrinsic pathway activator, phospholipid and calcium.
- the aPTT reagent is called a partial thromboplastin because tissue factor is not included with the phospholipid as it is with the protime (PT) reagent.
- the activator initiates the system, then, the remaining steps of the intrinsic pathway take place in the presence of phospholipid.
- Reference aPTT range varies from laboratory to laboratory, but is usually in the range of 27 - 34 seconds.
- the principal of the assay was to quantitate the ability of FIX-CTP harvests to restore the clotting activity of FIX depleted human plasma by the addition of rhFIX.
- 300 ⁇ l of FIX deficient human plasma was mixed with lOO ⁇ l of rhFIX or FIX-CTP harvests and serially diluted.
- clotting time in seconds was determined (performed by American Medical Laboratories).
- the potency was assessed by comparing a dose response curve of the FIX harvests to a reference preparation consisting rhFIX or human plasma, one unit of FIX activity is the needed FIX concentration that equals the activity of one ml human normal plasma;
- the presented aPTT results indicate that FIX-(CTP) 2 exhibit a 5.7 fold reduction in its specific coagulation activity compared to rhFIX.
- the aPTT results together with the chromogenic activity in vitro assay suggest that FFX-(CTP) 2 harvest has an improved enzymatic activity vs. FIX-CTP harvest (Fig 5).
- An improved activity of FIX-CTP proteins will be obtained following optimization of the expression system (i.e. co-transfection with Furin and optimization of Vit K3 medium concentration).
- FIX-CTP harvests exhibit an improved Tl/2p values compared to rhFIX (2 and 5- fold increase respectively). Since in FIX dosing collection animals serum concentrations at 24hr were below limit of quantitation (BLQ), additional PK parameters were not calculated.
- MOD3012 is a FIX modified with 2 CTP units in tandem in its carboxy-terminal.
- MOD3012 was purified using matrix bound monoclonal antibody against ⁇ carboxyglutamyl (GIa) residues present in the N-terminal region of FIX (American Diagnostics Cat# 3570MX). The Monoclonal Ab was bound to Sepharose CL-4B.
- MOD3012 harvest in a concentration of 88 ⁇ g/ml was dialyzed against 2OmM Tris, 150Mm NaCl and 1OmM EDTA at PH 7.4.
- the loading rate was 0.5ml/min, elution was performed using 20Mm Tris-HCl, 35OmM NaCl and 5OmM CaCl and the unbound fraction was recycled five times. Finally, the elution fraction was dialyzed with PBS, pulled and concentrated.
- FIX-CTP and FIX-(CTP) 2 were determined using the Human FIX ELISA kit (Affinity Biologicals; cat# FIX-AG RUO), the calculated protein concentration ( ⁇ g/ml) is the average of two independent runs (Fig 7).
- MOD-3012 was quantitated by Bradford assay. The calculated concentration was 202 ⁇ g/ml, which is similar to the concentration obtained by human FIX ELISA.
- MOD-3012 purified protein was separated by 12% Tris -Glycine SDS-PAGE and subsequently electro-blotted to PVDF membrane. The band of interest was cut out and put on a purified Biobrene treated glass fiber filter.
- the N-terminal sequence analysis was carried out by Edmann degradation using a pulsed liquid protein sequencer equipped with a 140 C HPLC micro-gradient system. N-terminal sequencing revealed the MOD3012 is a mixture of uncomplete and complete pro peptide cleaved proteins. Inadequately pro peptide cleavage was shown to reduce FIX coagulation activity. By co-transfection with Furin an improved pro peptide cleavage process can be obtained. Determination of FIX chromogenic activity
- the generated FXa was measured by its specific activity on FXa chromogenic substrate (pNA). The amount of pNA generated was directly proportional to FIXa activity.
- rhFIX, human plasma and MOD-3012 were serially diluted and potency was assessed by comparing a dose response curve (Fig. 9). The average EC 50 of rhFIX was 68.74ng/ml while MOD-3012 calculated EC 50 was 505ng/ml. Approximately 7 fold decrease in the enzymatic activity of MOD-3012 was observed vs. recombinant FIX and 16.5 fold decrease versus normal human pulled plasma. This reduced activity could be explained by inadequate cleavage of N-terminal pro-peptide, which was identified by N-terminal analysis.
- FIX Clotting activity (aPTT) [0207]
- the activated partial thromboplastin time (aPTT) is a measure of the integrity of the intrinsic and common pathways of the coagulation cascade.
- the aPTT is the time (measured in seconds) it takes plasma to clot following the addition of an intrinsic pathway activator, phospholipid and calcium.
- the assay quantitated the ability of MOD-3012 protein to restore the clotting activity of FIX depleted human plasma by the addition of rhFIX.
- FIX deficient human plasma 300 ⁇ l was mixed with lOO ⁇ l of rhFIX, MOD- 3012 (FIX-CTP-CTP (the CTP are in tandem in the C-terminal)), or normal pool human plasma which was further diluted. Following 60 seconds incubation at 37 0 C. Tissue Factor (TF), CaCl 2 , and phospholipids were added to the mixture. Clotting time in seconds was determined. Potency was assessed by comparing a dose response curve of the MOD3012 to a reference preparation consisting rhFIX or human plasma. One unit of FIX was defined as the amount of FIX which equals to the activity of ImI human normal plasma.
- MOD-3012 harvest demonstrated an improved PK profile compared to MOD3011 harvest. Furthermore, Purified MOD-3012 exhibit 3-fold increase in Tl/2p value and 4.5 fold increase in AUC compared to rhFIX.
- MOD-3012 comparative PK study in rats demonstrated that fusion of two tandem CTPs to the C-terminal of FIX, generated a FIX with extended half life. Comparing the PK properties of MOD-3012 to FIX-FC or FIX-FP (competitive recombinant proteins; table 5 below) indicates that MOD3012 has an improved Tl/2 compared to FIX-FP but reduced Tl/2 compared to FIX-FC.
- Ratio long lasting / rhFIX or BeneFIX FIX depleted mouse model
- FIX knockout mice were obtained and a breeding colony was established. lO ⁇ g of either commercial recombinant hFIX (Benefix) or rFIX-(CTP) 2 (MOD-3012) are injected into the tail vein of an anaesthetized FIX knockout mouse (22-28g). The amount of injected protein equals to the required concentration of FLX in normal plasma (5 ⁇ g/ml). Blood samples are taken from the clipped tail into heparinized capillary tubes at specific time points. Plasma samples are assessed for FIX levels by ELISA and efficacy is measured by aPTT coagulation assay.
- FIX cDNA 3' end of human FIX cDNA.
- the corresponding rFIX and Furin expressing constructs were co-transfected into Dg44 cells; a human rFIX cDNA was also co-transfected with the Furin plasmid as a control.
- Secretion of high level of FIX leads to secretion of a mixture of pro- factor and a mature factor FIX, due to limited amount of the Furin protease in the cell.
- Co - transfection. of a Furin expressing vector with a pro-factor expressing vector increases the recovery and result in the secretion of fully processed FIX in to the medium.
- Tris -Glycine gel using Precision plus dual color protein marker Bio-Rad.
- the SDS-PAGE analysis is performed by western immuneblot using anti human FIX polyclonal Ab (American
- FIX-CTP has a similar therapeutic efficacy to rFEK in hemophilia B patients and required less frequent dosing. It also may appeal- that a single injection of FIX-CTP is sufficient to control bleeding episodes and reduce the number of injections that are needed ⁇ during surgical intervention in hemophilic B patients.
- Recombinant coagulation factor Vila NovoSeven
- FVIIa Recombinant coagulation factor Vila (NovoSeven) (FVIIa) was commercially available and was approved in 1996 for treatment of bleeding episodes in hemophilia patients with inhibitors.
- rFVIIa had a major disadvantage- rFVIIa was rapidly cleared with a terminal half life of 2.5 hours.
- patients generally required multiple, frequent infusions (2-3 doses given in 2-3 hours interval) to achieve adequate homeostasis following a mild to moderate bleed.
- FVIIa-CTP the generation of a recombinant FVIIa-CTP molecule with an extended half life based on fusion of FVII to a human CTP, as described.
- the recombinant FVIIa-CTP was expressed in mammalian cells and characterized In-vitro and In vivo. It was demonstrated that rFVII-CTP activity was comparable to rFVII, Pharmacokinetic and efficacy studies in rats demonstrated improved properties of the rFVII-CTP. The results of this study demonstrated that it is feasible to develop a half life extended rFVIIa molecule with very similar haemostatic properties to the wild type enzyme.
- Primer 67 5'CTCGAGGACATGGTCTCCCAGGCCC3 I (contains the 5' end of Factor VII DNA and the restriction site of Xhol ) (SEQ ID NO: 5);
- Primer 68 R 5' TCTAGAATAGGTATTTTTCCACATGS ' (contains the restriction site of Xbal) (SEQ ID NO: 6);
- Primer 69 5' TCTAGAAAAAAGAAATGCCAGCS' (contains the restriction site of Xbal) (SEQ ID NO: 7); and Primer 70 R :
- Cloning was performed in two sets of PCR reaction. The first reaction was conducted with primer 67 and primer 68 R and cDNA plasmid with Factor VII sequence (OB-MHS4426) was used as a template; as a result of the PCR amplification , a ⁇ 534 bp product was formed, isolated and ligated into TA cloning vector (Invitrogen, catalog K2000-01) . Xhol -Xbal fragment containing the amino terminus of factor VII sequence was isolated.
- OB-MHS4426 cDNA plasmid with Factor VII sequence
- the second reaction was conducted with primer 69 and primer 70 R and again cDNA plasmid with Factor VII sequence (OB-MHS4426) was used as a template; as a result of the PCR amplification, a ⁇ 813 bp product was formed and ligated into TA cloning vector (Invitrogen, catalog K2000- 01) .
- TA cloning vector Invitrogen, catalog K2000- 01
- Xbal-NotI fragment containing the Carboxy terminus of Factor VII sequence was isolated. The two fragments were inserted into our eukaryotic expression vector pCI-dhfr (triple ligation) to yield 501-0-pl36-l clone.
- Plasmid 501 -pi 36-1 (Factor VII in pCI-dhfr vector) was digested with restriction enzymes Xhol and KpnI. A fragment of -1186 bp was isolated. A partial Factor VII clone (1180 bp-1322 bp) followed by CTP sequence, termination sequence and Notl sequence that was synthesized by GeneArt (0721543) was digested with restriction enzymes KpnI and Notl. A fragment of ⁇ 253 bp was isolated. The two fragments were inserted into our eukaryotic expression vector pCI-dhfr (triple ligation) to yield 501-l-pl37-2 clone. pCI-dhfr-701-2-p24- 2 was digested with restriction enzymes Xhol and Apal and the large fragment (vector) was isolated.
- pCI-dhfr-501-2-pl37-2 (Factor VII-ctp xl) was digested with restriction enzymes Xhol and Apal and ⁇ 1200 bp insert was isolated. The vector and insert were ligated to yield 501-2-pl39-2.
- Dg44 cells were plated in 100mm tissue culture dishes and grown to confluence of 50-60% .A total of 2ug of DNA was used for transfection of one 100mm plate using the FuGene reagent (Roche) in protein free medium (Invitrogen CD Dg44). The media was removed 48 hours post transfection and replaced with a protein free medium (Invitrogen CD Dg44) without nucleosides.
- the cDNA coding the CTP peptide was fused to the 3' end of the cDNA coding human FVII.
- the corresponding rFVII construct was transfected into Dg44 cells.
- a human rFVII cDNA was utilized.
- the production medium (harvest) was collected, concentrated and the secreted recombinant FVII was further evaluated.
- rFVII , rFVII-CTP and rFVII- CTP-CTP antigen levels were determined by AssayMax Human FVII ELISA kit (AssayPro) (Fig. 2A). There was no significant difference in the secretion level of rFVII-CTP and rFVII-(CTP) 2 compared to native rFVII.
- SDS-PAGE blots [0230] SDS-PAGE analysis was done by loading 50ng of either harvest, purified or activated rFVII protein. Samples were loaded on 12% Tris -Glycine gel using Precision plus dual color protein marker (Bio-Rad). The SDS-PAGE analysis was done by performing a western immunoblot using an anti human FVII monoclonal Ab (R&D systems) or anti-CTP polyclonal antibody generated in Rabbit. [0231] The level of rFVII antigen correlated to the detected protein level in a SDS-PAGE immunoblotted with anti FVII Ab.
- rFVII- CTP migrated as a single band while the corresponding molecular weight of the FVII control was approximately 52KDa, both proteins reacted with antibodies specific for FVII on immunoblots.
- the rFVII-CTP also reacted with antibodies specific for CTP.
- rFVII was secreted in its zymogene form with no trace of activated protein
- rFVII , rFVII-CTP and rFVII-(CTP) 2 harvests activity was determined using a commercially available chromogenic test kit (AssaySense Human FVII chromogenic Activity assay kit (AssayPro).
- AssayPro AssaySense Human FVII chromogenic Activity assay kit
- concentrated rFVII-CTP harvesteds
- the addition of the CTP peptide at the C-terminal of the rFVII protein didn't impair its serine protease activity (Fig. 2B, C).
- Prothrombin time measures the extrinsic pathway of coagulation.
- the PT is the time (measured in seconds) it takes plasma to clot following the addition of an extrinsic pathway activator, phospholipid and calcium. It is used to determine the clotting tendency of blood, specifically in the measure of warfarin dosage, liver damage, and vitamin K status.
- the reference range for prothrombin time is usually around 12-15 seconds.
- the assay quantitated the ability of FVII-CTP and FVII-(CTP) 2 harvest to restore the clotting activity of FVII depleted human plasma by the addition of rhFVII.
- FVII deficient human plasma 300 ⁇ l was mixed with lOO ⁇ l of FVII, FVII-CTP and FVII-(CTP) 2 harvets at specific concentrations, or normal pool human plasma and were further diluted. Following 60 seconds incubation at 37 0 C, Tissue Factor (TF), CaCl 2 , and phospholipids were added to the mixture. Clotting time in seconds was determined. Potency was assessed by comparing a dose response curve of FVII-CTP and FVII-(CTP) 2 harvests to a reference preparation consisting rhFVII or human pool plasma.
- TF Tissue Factor
- One unit of active FVII was defined as the amount of FVII which equals to the activity of one ml human normal plasma.
- the PT Clotting activity of rFVII and rFVII - CTP was measured on a coagulometer (Instrumentation Laboratory).
- rFVII, rFVII-CTP, and rFVII-(CTP) 2 harvests were administered intravenously to Spargue Dawley rats (six rats per substance) with a dose of lOO ⁇ g/kg body weight.
- the amount of the respective protein was determined on the basis of FVII Elisa kit.
- the injected amount was calculated by taking into account the differences in the molecular weight of rFVII verses rFVII-CTP which leads to different molar concentration.
- FVII is cleaved at Rl 52 resulting in a heavy and a light chain domains that are held together by a single disulfide bridge.
- TFVIIa-(CTP) 2 is purified and activated by ion exchange columns purification process.
- the protein is loaded on SDS-PAGE under reducing conditions to commercial FVIIa (Novoseven®). The heavy and the light chain domains are separated and migrate as separated bands of molecular weights 55 and 25 KDa.
- FVIIa protein concentration is determined by FVIIa specific Elisa kit.
- rFVII -CTP-CTP in activated or zymogene purified proteins is separated by SDS- PAGE (on 12% Tris -Glycine) and subsequently electroblotted to PVDF membrane. The bands of interest are cut out and put on a purified Biobrene treated glass fiber filter.
- the N- terminal sequence analysis is carried out by Edmann degradation using a pulsed liquid protein sequencer equipped with a 140 C HPLC microgradient system. The identity of the recombinant protein and proper pro peptide cleavage is further verified by N-terminal sequencing.
- activated partial thromboplastin time assay (aPTT) is performed,.
- FVIII deficient plasma sample is substituted with rFVIIa (NovoSeven) or rFVIIa-(CTP) 2, 300 ⁇ l of FVII deficient human plasma is mixed with lOO ⁇ l of FVIIa or rFVIIa-(CTP) 2 at specific concentrations, or normal pull human plasma which is further diluted.
- Tissue Factor (TF), CaCl 2 , and phospholipids are added to the mixture. Clotting time in seconds is determined.
- TFVIIa-(CTP) 2 Potency is assessed by comparing a dose response curve of TFVIIa-(CTP) 2 to a reference preparation consisting rhFVIIa or human pool normal plasma.
- One unit of FVIIa is defined as the amount of FVIIa which equals to the activity of ImI human normal plasma.
- the aPTT Clotting activity of rFVII and TFVIIa-(CTP) 2 is measured on a coagulometer (Instrumentation Laboratory).
- the aPTT Clotting activity of rFVIIa and rF VIIa-(CTP) 2 is similar. Pharmacokinetics studies in rats:
- FVII knockout mice are obtained and a breeding colony is established. lO ⁇ g of either commercial recombinant hFVIIa (Novoseven) or rF VIIa-(CTP) 2 are injected into the tail vein of an anaesthetized FVIII knockout mouse (22-28g). The amount of injected protein equals to the required concentration of FVIII in normal plasma (5 ⁇ g/ml). Blood samples are taken from the clipped tail into heparinized capillary tubes at specific time points. Plasma samples are assessed for FVIIa levels by ELISA and efficacy is measured by a PTT coagulation assay.
- rFVIIa-(CTP) 2 has a similar therapeutic efficacy to rFVIIa in hemophilia patients. Moreover, this technology requires less frequent dosing. It appears that a single injection of rF VIIa-(CTP) 2 is sufficient to control bleeding episodes and reduce the number of injections that are needed during surgical intervention. This recombinant protein may be used as a long term prophylactic treatment.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Endocrinology (AREA)
- Hematology (AREA)
- Reproductive Health (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Diabetes (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Glass Compositions (AREA)
Priority Applications (23)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| LTEP10796803.4T LT2451473T (lt) | 2009-07-09 | 2010-07-01 | Ilgai veikiantys krešėjimo faktoriai ir jų gavimo būdai |
| KR1020127003469A KR101802919B1 (ko) | 2009-07-09 | 2010-07-01 | 장기-작용성 응고 인자 및 이의 제조 방법 |
| JP2012519119A JP5823960B2 (ja) | 2009-07-09 | 2010-07-01 | 長期作用性凝固因子およびそれを製造する方法 |
| CN201510572447.0A CN105153314B (zh) | 2009-07-09 | 2010-07-01 | 长效凝固因子及产生其的方法 |
| CN201080040296.XA CN102639144B (zh) | 2009-07-09 | 2010-07-01 | 长效凝固因子及产生其的方法 |
| HRP20170051TT HRP20170051T1 (hr) | 2009-07-09 | 2010-07-01 | Dugodjelujući faktori koagulacije i postupci za njihovu proizvodnju |
| MX2014010834A MX346920B (es) | 2009-07-09 | 2010-07-01 | Factores de coagulacion de accion prolongada y metodos de produccion de los mismos. |
| CA2767503A CA2767503C (en) | 2009-07-09 | 2010-07-01 | Long-acting coagulation factors and methods of producing same |
| DK10796803.4T DK2451473T3 (en) | 2009-07-09 | 2010-07-01 | LONG-TERM EFFECTING COAGULATION FACTORS AND PROCEDURES FOR PRODUCING THEREOF |
| EP10796803.4A EP2451473B1 (en) | 2009-07-09 | 2010-07-01 | Long-acting coagulation factors and methods of producing same |
| KR1020177033906A KR101950961B1 (ko) | 2009-07-09 | 2010-07-01 | 장기-작용성 응고 인자 및 이의 제조 방법 |
| SI201031374A SI2451473T1 (sl) | 2009-07-09 | 2010-07-01 | Dolgotrajno učinkujoči koagulacijski faktorji in postopki za njihovo proizvodnjo |
| MX2017002687A MX386807B (es) | 2009-07-09 | 2010-07-01 | Factores de coagulación de acción prolongada y métodos de producción de los mismos. |
| MX2012000469A MX2012000469A (es) | 2009-07-09 | 2010-07-01 | Factores de coagulacion de accion prolongada y metodos de produccion de los mismos. |
| ES10796803.4T ES2618209T3 (es) | 2009-07-09 | 2010-07-01 | Factores de coagulación de acción prolongada y métodos para producir los mismos |
| AU2010269884A AU2010269884B2 (en) | 2009-07-09 | 2010-07-01 | Long-acting coagulation factors and methods of producing same |
| KR1020197004563A KR102014844B1 (ko) | 2009-07-09 | 2010-07-01 | 장기-작용성 응고 인자 및 이의 제조 방법 |
| IL217403A IL217403A (en) | 2009-07-09 | 2012-01-05 | Use of long-acting anticoagulants with modification of the carboxylic end of the chorionic gonadotropin peptide |
| IL235377A IL235377A (en) | 2009-07-09 | 2014-10-28 | Coagulation factors with prolonged activity and methods for their preparation |
| AU2015201906A AU2015201906B2 (en) | 2009-07-09 | 2015-04-15 | Long-acting coagulation factors and methods of producing same |
| IL242368A IL242368B (en) | 2009-07-09 | 2015-10-29 | Anticoagulants with long-term activity, with a modification of the addition of the carboxyl end of the chorionic gonadotropin peptide, their composition and methods of their use |
| CY20171100062T CY1118733T1 (el) | 2009-07-09 | 2017-01-17 | Παραγοντες πηξης μακρας διαρκειας και μεθοδοι παραγωγης των ιδιων |
| AU2017201513A AU2017201513B2 (en) | 2009-07-09 | 2017-03-06 | Long-acting coagulation factors and methods of producing same |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US22436609P | 2009-07-09 | 2009-07-09 | |
| US61/224,366 | 2009-07-09 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2011004361A2 true WO2011004361A2 (en) | 2011-01-13 |
| WO2011004361A3 WO2011004361A3 (en) | 2011-06-03 |
Family
ID=43429620
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IL2010/000532 Ceased WO2011004361A2 (en) | 2009-07-09 | 2010-07-01 | Long-acting coagulation factors and methods of producing same |
Country Status (19)
| Country | Link |
|---|---|
| US (1) | US8476234B2 (OSRAM) |
| EP (2) | EP2451473B1 (OSRAM) |
| JP (3) | JP5823960B2 (OSRAM) |
| KR (3) | KR101950961B1 (OSRAM) |
| CN (2) | CN102639144B (OSRAM) |
| AU (1) | AU2010269884B2 (OSRAM) |
| CA (1) | CA2767503C (OSRAM) |
| CY (1) | CY1118733T1 (OSRAM) |
| DK (1) | DK2451473T3 (OSRAM) |
| ES (1) | ES2618209T3 (OSRAM) |
| HR (1) | HRP20170051T1 (OSRAM) |
| HU (1) | HUE032973T2 (OSRAM) |
| IL (2) | IL235377A (OSRAM) |
| LT (1) | LT2451473T (OSRAM) |
| MX (4) | MX386807B (OSRAM) |
| PL (1) | PL2451473T3 (OSRAM) |
| PT (1) | PT2451473T (OSRAM) |
| SI (1) | SI2451473T1 (OSRAM) |
| WO (1) | WO2011004361A2 (OSRAM) |
Cited By (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014159813A1 (en) | 2013-03-13 | 2014-10-02 | Moderna Therapeutics, Inc. | Long-lived polynucleotide molecules |
| JP2014530018A (ja) * | 2011-10-06 | 2014-11-17 | ハンミ サイエンス カンパニー リミテッドHanmi Scienceco.,Ltd. | 血液凝固因子VII及びVIIa誘導体、それらを含む結合体及び複合体、並びにそれらの使用 |
| KR20140134673A (ko) * | 2012-02-14 | 2014-11-24 | 옵코 바이오로직스 리미티드 | 장기 작용 응고 인자들 및 이를 생산하는 방법들 |
| JP2015520128A (ja) * | 2012-04-19 | 2015-07-16 | オプコ バイオロジクス リミテッド | 長時間作用性オキシントモジュリン変異体とその作製方法 |
| JP2016505544A (ja) * | 2012-12-03 | 2016-02-25 | メルク・シャープ・アンド・ドーム・コーポレーションMerck Sharp & Dohme Corp. | O−グリコシル化カルボキシ末端部分(ctp)ペプチド系のインスリンおよびインスリン類似体 |
| EP3130346A1 (en) | 2009-07-09 | 2017-02-15 | OPKO Biologics Ltd. | Long-acting factor vii coagulation factors |
| US9663778B2 (en) | 2009-07-09 | 2017-05-30 | OPKO Biologies Ltd. | Long-acting coagulation factors and methods of producing same |
| US9808534B2 (en) | 2012-11-20 | 2017-11-07 | Opko Biologics Ltd. | Method of increasing the hydrodynamic volume of polypeptides by attaching to gonadotrophin carboxy terminal peptides |
| US9828417B2 (en) | 2006-02-03 | 2017-11-28 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| CN107438623A (zh) * | 2014-12-10 | 2017-12-05 | Opko生物科学有限公司 | 长效的ctp修饰的生长激素多肽的制备方法 |
| US9884901B2 (en) | 2006-02-03 | 2018-02-06 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US9896494B2 (en) | 2006-02-03 | 2018-02-20 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing same |
| US10119132B2 (en) | 2006-02-03 | 2018-11-06 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US10221228B2 (en) | 2006-02-03 | 2019-03-05 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US10351615B2 (en) | 2006-02-03 | 2019-07-16 | Opko Biologics Ltd. | Methods of treatment with long-acting growth hormone |
| WO2020187969A1 (en) | 2019-03-19 | 2020-09-24 | CSL Behring Lengnau AG | Factor ix variants and uses thereof in therapy |
| EP2956477B1 (en) | 2013-02-15 | 2020-11-18 | Bioverativ Therapeutics Inc. | Optimized factor viii gene |
| US10960058B2 (en) | 2015-06-19 | 2021-03-30 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US11197915B2 (en) | 2013-10-21 | 2021-12-14 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US11753461B2 (en) | 2016-02-01 | 2023-09-12 | Bioverativ Therapeutics Inc. | Optimized factor VIII genes |
| US11976106B2 (en) | 2016-07-11 | 2024-05-07 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US12173307B2 (en) | 2020-06-24 | 2024-12-24 | Bioverativ Therapeutics Inc. | Methods for the purification of viral vectors |
| US12203113B2 (en) | 2009-07-09 | 2025-01-21 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US12275970B2 (en) | 2014-06-30 | 2025-04-15 | Bioverativ Therapeutics Inc. | Optimized factor IX gene |
| US12403164B2 (en) | 2019-09-30 | 2025-09-02 | Bioverativ Therapeutics Inc. | Lentiviral vector formulations |
Families Citing this family (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8759292B2 (en) | 2006-02-03 | 2014-06-24 | Prolor Biotech, Llc | Long-acting coagulation factors and methods of producing same |
| US8450269B2 (en) | 2006-02-03 | 2013-05-28 | Prolor Biotech Ltd. | Long-acting growth hormone and methods of producing same |
| US9458444B2 (en) | 2006-02-03 | 2016-10-04 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US8304386B2 (en) * | 2006-02-03 | 2012-11-06 | Prolor Biotech, Inc. | Long-acting growth hormone and methods of producing same |
| US8946155B2 (en) | 2006-02-03 | 2015-02-03 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| WO2007092252A2 (en) | 2006-02-03 | 2007-08-16 | Modigene Inc | Long-acting polypeptides and methods of producing same |
| AU2010202125B1 (en) | 2010-05-26 | 2010-09-02 | Takeda Pharmaceutical Company Limited | A method to produce an immunoglobulin preparation with improved yield |
| WO2011150284A2 (en) | 2010-05-26 | 2011-12-01 | Baxter International Inc. | Removal of serine proteases by treatment with finely divided silicon dioxide |
| US8822663B2 (en) | 2010-08-06 | 2014-09-02 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| RS63430B1 (sr) | 2010-10-01 | 2022-08-31 | Modernatx Inc | Ribonukleinske kiseline koje sadrže n1-metil-pseudouracile i njihove primene |
| EP2691101A2 (en) | 2011-03-31 | 2014-02-05 | Moderna Therapeutics, Inc. | Delivery and formulation of engineered nucleic acids |
| US9464124B2 (en) | 2011-09-12 | 2016-10-11 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| DK3682905T3 (da) | 2011-10-03 | 2022-02-28 | Modernatx Inc | Modificerede nukleosider, nukleotider og nukleinsyrer og anvendelser deraf |
| DE12858350T1 (de) | 2011-12-16 | 2021-10-07 | Modernatx, Inc. | Modifizierte mrna zusammensetzungen |
| US9572897B2 (en) | 2012-04-02 | 2017-02-21 | Modernatx, Inc. | Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins |
| US9283287B2 (en) | 2012-04-02 | 2016-03-15 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of nuclear proteins |
| HK1206601A1 (en) | 2012-04-02 | 2016-01-15 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of biologics and proteins associated with human disease |
| US9878056B2 (en) | 2012-04-02 | 2018-01-30 | Modernatx, Inc. | Modified polynucleotides for the production of cosmetic proteins and peptides |
| EP3970738A1 (en) * | 2012-07-25 | 2022-03-23 | Bioverativ Therapeutics Inc. | Blood factor monitoring assay and uses thereof |
| HRP20220607T1 (hr) | 2012-11-26 | 2022-06-24 | Modernatx, Inc. | Terminalno modificirana rna |
| US8980864B2 (en) | 2013-03-15 | 2015-03-17 | Moderna Therapeutics, Inc. | Compositions and methods of altering cholesterol levels |
| WO2015051214A1 (en) | 2013-10-03 | 2015-04-09 | Moderna Therapeutics, Inc. | Polynucleotides encoding low density lipoprotein receptor |
| KR20240110069A (ko) * | 2013-10-21 | 2024-07-12 | 옵코 바이오로직스 리미티드 | 장시간-작용하는 폴리펩티드, 그의 생산 방법, 및 그의 투여 방법 |
| CN106397571A (zh) * | 2015-07-31 | 2017-02-15 | 李金松 | 一种新型羧基末端肽及长效白介素7 |
| CN106397570B (zh) * | 2015-07-31 | 2019-11-15 | 袁武梅 | 一种羧基末端肽及长效干扰素 |
| WO2017070167A1 (en) | 2015-10-20 | 2017-04-27 | The University Of North Carolina At Chapel Hill | Methods and compositions for modified factor ix fusion proteins |
| CN106279437B (zh) | 2016-08-19 | 2017-10-31 | 安源医药科技(上海)有限公司 | 高糖基化人凝血因子viii融合蛋白及其制备方法与用途 |
| CN106317226B (zh) * | 2016-08-19 | 2017-09-05 | 安源医药科技(上海)有限公司 | 用于构建融合蛋白的连接肽 |
| CN106279436B (zh) * | 2016-08-19 | 2017-10-31 | 安源医药科技(上海)有限公司 | 活化的人凝血因子vii融合蛋白及其制备方法与用途 |
| CN110438022A (zh) * | 2018-10-10 | 2019-11-12 | 福建师范大学 | 一种前体蛋白Kex2过表达毕赤酵母菌株及其构建方法 |
| CN112175088B (zh) * | 2019-07-02 | 2023-03-28 | 江苏晟斯生物制药有限公司 | 改进的fix融合蛋白、缀合物及其应用 |
Citations (28)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3791932A (en) | 1971-02-10 | 1974-02-12 | Akzona Inc | Process for the demonstration and determination of reaction components having specific binding affinity for each other |
| US3839153A (en) | 1970-12-28 | 1974-10-01 | Akzona Inc | Process for the detection and determination of specific binding proteins and their corresponding bindable substances |
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3850578A (en) | 1973-03-12 | 1974-11-26 | H Mcconnell | Process for assaying for biologically active molecules |
| US3853987A (en) | 1971-09-01 | 1974-12-10 | W Dreyer | Immunological reagent and radioimmuno assay |
| US3867517A (en) | 1971-12-21 | 1975-02-18 | Abbott Lab | Direct radioimmunoassay for antigens and their antibodies |
| US3879262A (en) | 1972-05-11 | 1975-04-22 | Akzona Inc | Detection and determination of haptens |
| US3901654A (en) | 1971-06-21 | 1975-08-26 | Biological Developments | Receptor assays of biologically active compounds employing biologically specific receptors |
| US3935074A (en) | 1973-12-17 | 1976-01-27 | Syva Company | Antibody steric hindrance immunoassay with two antibodies |
| US3984533A (en) | 1975-11-13 | 1976-10-05 | General Electric Company | Electrophoretic method of detecting antigen-antibody reaction |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4034074A (en) | 1974-09-19 | 1977-07-05 | The Board Of Trustees Of Leland Stanford Junior University | Universal reagent 2-site immunoradiometric assay using labelled anti (IgG) |
| US4098876A (en) | 1976-10-26 | 1978-07-04 | Corning Glass Works | Reverse sandwich immunoassay |
| EP0167825A2 (de) | 1984-06-08 | 1986-01-15 | Dr. Rentschler Arzneimittel GmbH & Co. | Lipidnanopellets als Trägersystem für Arzneimittel zur peroralen Anwendung |
| US4666828A (en) | 1984-08-15 | 1987-05-19 | The General Hospital Corporation | Test for Huntington's disease |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| EP0264166A1 (en) | 1986-04-09 | 1988-04-20 | Genzyme Corporation | Transgenic animals secreting desired proteins into milk |
| US4801531A (en) | 1985-04-17 | 1989-01-31 | Biotechnology Research Partners, Ltd. | Apo AI/CIII genomic polymorphisms predictive of atherosclerosis |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| US4879219A (en) | 1980-09-19 | 1989-11-07 | General Hospital Corporation | Immunoassay utilizing monoclonal high affinity IgM antibodies |
| WO1989010756A1 (fr) | 1988-05-06 | 1989-11-16 | Toray Industries, Inc. | COMPOSITION D'INTERFERON beta STABLE |
| US5011771A (en) | 1984-04-12 | 1991-04-30 | The General Hospital Corporation | Multiepitopic immunometric assay |
| US5192659A (en) | 1989-08-25 | 1993-03-09 | Genetype Ag | Intron sequence analysis method for detection of adjacent and remote locus alleles as haplotypes |
| US5272057A (en) | 1988-10-14 | 1993-12-21 | Georgetown University | Method of detecting a predisposition to cancer by the use of restriction fragment length polymorphism of the gene for human poly (ADP-ribose) polymerase |
| US5281521A (en) | 1992-07-20 | 1994-01-25 | The Trustees Of The University Of Pennsylvania | Modified avidin-biotin technique |
| US5464764A (en) | 1989-08-22 | 1995-11-07 | University Of Utah Research Foundation | Positive-negative selection methods and vectors |
| US5712122A (en) | 1989-02-21 | 1998-01-27 | Washington University | Carboxy terminal peptide-extended proteins |
| US5932447A (en) | 1994-05-17 | 1999-08-03 | Bristol-Myers Squibb Company | Cloning and expression of a gene encoding bryodin 1 from Bryonia dioica |
Family Cites Families (51)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US130060A (en) * | 1872-07-30 | Improvement in cotton-presses | ||
| US190611A (en) * | 1877-05-08 | Improvement in protractors | ||
| JPS5781447A (en) | 1980-11-11 | 1982-05-21 | Toyo Jozo Co Ltd | Human chorionic gonadotropic hormone c-terminal fragment |
| US4853332A (en) | 1982-10-19 | 1989-08-01 | Cetus Corporation | Structural genes, plasmids and transformed cells for producing cysteine depleted muteins of biologically active proteins |
| US5705478A (en) | 1989-02-21 | 1998-01-06 | Washington University | Covalently linked β subunits of the glycoprotein hormones as antagonists |
| US6225449B1 (en) | 1991-10-04 | 2001-05-01 | Washington University | Hormone analogs with multiple CTP extensions |
| US5338835A (en) | 1989-02-21 | 1994-08-16 | Washington University | CTP-extended form of FSH |
| US5792460A (en) * | 1989-02-21 | 1998-08-11 | Washington University | Modified glycoprotein hormones having a CTP at the amino terminus |
| US7217689B1 (en) | 1989-10-13 | 2007-05-15 | Amgen Inc. | Glycosylation analogs of erythropoietin |
| US5126324A (en) | 1990-06-07 | 1992-06-30 | Genentech, Inc. | Method of enhancing growth in patients using combination therapy |
| US6028177A (en) | 1991-10-04 | 2000-02-22 | Washington University | Methods of detecting single-chain forms of the glycoprotein hormone quartet |
| ATE187740T1 (de) | 1993-04-20 | 2000-01-15 | Univ Washington | Modifizierte proteine und peptide enthaltende pharmazeutische mittel |
| US6737515B2 (en) | 1993-11-19 | 2004-05-18 | Washington University | Follicle stimulating hormone-glycosylation analogs |
| US6238890B1 (en) | 1994-02-18 | 2001-05-29 | Washington University | Single chain forms of the glycoprotein hormone quartet |
| US5935924A (en) | 1994-04-15 | 1999-08-10 | Genentech, Inc. | Treatment of congestive heart failure |
| BR9506313A (pt) | 1994-08-12 | 1997-08-05 | Univ Washington | Formas de cadeia simples do quarteto de hormônio de glicoproteína |
| US6083725A (en) | 1996-09-13 | 2000-07-04 | Transkaryotic Therapies, Inc. | Tranfected human cells expressing human α-galactosidase A protein |
| US20050032211A1 (en) | 1996-09-26 | 2005-02-10 | Metabogal Ltd. | Cell/tissue culturing device, system and method |
| US6310183B1 (en) | 1997-09-10 | 2001-10-30 | Novo Nordisk A/S | Coagulation factor VIIa composition |
| DK1121382T3 (da) | 1998-10-16 | 2006-11-13 | Biogen Idec Inc | Interferon-beta-fusionsproteiner og deres anvendelser |
| US6514729B1 (en) | 1999-05-12 | 2003-02-04 | Xencor, Inc. | Recombinant interferon-beta muteins |
| PE20010288A1 (es) | 1999-07-02 | 2001-03-07 | Hoffmann La Roche | Derivados de eritropoyetina |
| US20020127652A1 (en) * | 2000-02-11 | 2002-09-12 | Schambye Hans Thalsgard | Follicle stimulating hormones |
| US7094566B2 (en) | 2000-03-16 | 2006-08-22 | Amgen Inc., | IL-17 receptor like molecules and uses thereof |
| ATE416784T1 (de) | 2000-12-01 | 2008-12-15 | Takeda Pharmaceutical | Verfahren zur herstellung einer zubereitung mit einer bioaktiven substanz |
| JP4409135B2 (ja) | 2000-12-01 | 2010-02-03 | 武田薬品工業株式会社 | 生理活性物質含有製剤の製造法 |
| MXPA03005036A (es) | 2000-12-07 | 2003-09-05 | Lilly Co Eli | Proteinas de fusion glp-1. |
| KR101229995B1 (ko) | 2000-12-11 | 2013-02-06 | 씨제이 주식회사 | 생체내 에리스로포이에틴 활성이 증진된 융합단백질 |
| ATE320449T1 (de) | 2000-12-11 | 2006-04-15 | Cheil Jedang Corp | Fusionsprotein mit verbesserter in vivo erythropoietinwirkung |
| CA2433037C (en) | 2000-12-28 | 2010-12-21 | Takeda Chemical Industries, Ltd. | Sustained-release preparation |
| JP5160005B2 (ja) | 2000-12-28 | 2013-03-13 | 武田薬品工業株式会社 | 徐放性製剤 |
| US6887462B2 (en) | 2001-04-09 | 2005-05-03 | Chiron Corporation | HSA-free formulations of interferon-beta |
| GB0121709D0 (en) | 2001-09-07 | 2001-10-31 | Imp College Innovations Ltd | Food inhibition agent |
| EP2277910A1 (en) | 2001-12-21 | 2011-01-26 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US7173113B2 (en) | 2002-01-31 | 2007-02-06 | The Trustees Of Columbia University In The City Of New York | Long-acting hormone and growth factor compositions and uses thereof |
| US7081446B2 (en) | 2002-01-31 | 2006-07-25 | The Trustees Of Columbia University In The City Of New York | Long-acting follicle stimulating hormone analogues and uses thereof |
| GB0206048D0 (en) | 2002-03-14 | 2002-04-24 | Croda Int Plc | Use |
| US7459435B2 (en) | 2002-08-29 | 2008-12-02 | Hoffmann-La Roche Inc. | Treatment of disturbances of iron distribution |
| US7459436B2 (en) | 2002-11-22 | 2008-12-02 | Hoffmann-La Roche Inc. | Treatment of disturbances of iron distribution |
| JP4683319B2 (ja) | 2003-02-19 | 2011-05-18 | 武田薬品工業株式会社 | 徐放性製剤用の分散剤 |
| US20060088595A1 (en) | 2003-02-19 | 2006-04-27 | Naoki Asakawa | Dispersant for sustained release preparations |
| WO2005047319A2 (en) | 2003-11-12 | 2005-05-26 | The University Of Georgia Research Foundation, Inc. | Dna sequence and expressed recombinant glycoproteins related to feline thyrotropin |
| SI1696947T1 (sl) | 2003-12-19 | 2014-05-30 | F. Hoffmann-La Roche Ag | Uporaba eritropoetina pri zdravljenju motenj porazdelitve železa pri kroničnih vnetnih črevesnih boleznih |
| CA2557061C (en) | 2004-03-19 | 2013-08-20 | Baxter International Inc. | Factor ixa for the treatment of bleeding disorders |
| EP1781782B1 (en) | 2004-08-17 | 2010-05-26 | CSL Behring GmbH | Modified vitamin k dependent polypeptides |
| EP1728798A1 (en) | 2005-06-01 | 2006-12-06 | ZLB Behring GmbH | Coagulation factor X polypeptides with modified activation properties |
| US8048849B2 (en) | 2006-02-03 | 2011-11-01 | Modigene, Inc. | Long-acting polypeptides and methods of producing same |
| WO2007092252A2 (en) | 2006-02-03 | 2007-08-16 | Modigene Inc | Long-acting polypeptides and methods of producing same |
| US8476234B2 (en) * | 2006-02-03 | 2013-07-02 | Prolor Biotech Inc. | Long-acting coagulation factors and methods of producing same |
| US8304386B2 (en) | 2006-02-03 | 2012-11-06 | Prolor Biotech, Inc. | Long-acting growth hormone and methods of producing same |
| US8048848B2 (en) | 2006-02-03 | 2011-11-01 | Prolor Biotech Ltd. | Long-acting interferons and derivatives thereof and methods thereof |
-
2010
- 2010-06-30 US US12/826,754 patent/US8476234B2/en active Active
- 2010-07-01 PT PT107968034T patent/PT2451473T/pt unknown
- 2010-07-01 LT LTEP10796803.4T patent/LT2451473T/lt unknown
- 2010-07-01 KR KR1020177033906A patent/KR101950961B1/ko active Active
- 2010-07-01 EP EP10796803.4A patent/EP2451473B1/en active Active
- 2010-07-01 KR KR1020127003469A patent/KR101802919B1/ko active Active
- 2010-07-01 PL PL10796803T patent/PL2451473T3/pl unknown
- 2010-07-01 MX MX2017002687A patent/MX386807B/es unknown
- 2010-07-01 MX MX2014010834A patent/MX346920B/es unknown
- 2010-07-01 JP JP2012519119A patent/JP5823960B2/ja active Active
- 2010-07-01 ES ES10796803.4T patent/ES2618209T3/es active Active
- 2010-07-01 WO PCT/IL2010/000532 patent/WO2011004361A2/en not_active Ceased
- 2010-07-01 KR KR1020197004563A patent/KR102014844B1/ko active Active
- 2010-07-01 AU AU2010269884A patent/AU2010269884B2/en active Active
- 2010-07-01 SI SI201031374A patent/SI2451473T1/sl unknown
- 2010-07-01 HU HUE10796803A patent/HUE032973T2/en unknown
- 2010-07-01 CN CN201080040296.XA patent/CN102639144B/zh active Active
- 2010-07-01 CN CN201510572447.0A patent/CN105153314B/zh active Active
- 2010-07-01 EP EP16187710.5A patent/EP3130346A1/en not_active Ceased
- 2010-07-01 CA CA2767503A patent/CA2767503C/en active Active
- 2010-07-01 HR HRP20170051TT patent/HRP20170051T1/hr unknown
- 2010-07-01 MX MX2012000469A patent/MX2012000469A/es active IP Right Grant
- 2010-07-01 DK DK10796803.4T patent/DK2451473T3/en active
-
2012
- 2012-01-09 MX MX2021012106A patent/MX2021012106A/es unknown
-
2014
- 2014-10-28 IL IL235377A patent/IL235377A/en active IP Right Grant
-
2015
- 2015-10-08 JP JP2015199912A patent/JP6162769B2/ja active Active
- 2015-10-29 IL IL242368A patent/IL242368B/en active IP Right Grant
-
2017
- 2017-01-17 CY CY20171100062T patent/CY1118733T1/el unknown
- 2017-06-15 JP JP2017117769A patent/JP6430592B2/ja active Active
Patent Citations (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3839153A (en) | 1970-12-28 | 1974-10-01 | Akzona Inc | Process for the detection and determination of specific binding proteins and their corresponding bindable substances |
| US3791932A (en) | 1971-02-10 | 1974-02-12 | Akzona Inc | Process for the demonstration and determination of reaction components having specific binding affinity for each other |
| US3901654A (en) | 1971-06-21 | 1975-08-26 | Biological Developments | Receptor assays of biologically active compounds employing biologically specific receptors |
| US3853987A (en) | 1971-09-01 | 1974-12-10 | W Dreyer | Immunological reagent and radioimmuno assay |
| US3867517A (en) | 1971-12-21 | 1975-02-18 | Abbott Lab | Direct radioimmunoassay for antigens and their antibodies |
| US3879262A (en) | 1972-05-11 | 1975-04-22 | Akzona Inc | Detection and determination of haptens |
| US3850578A (en) | 1973-03-12 | 1974-11-26 | H Mcconnell | Process for assaying for biologically active molecules |
| US3935074A (en) | 1973-12-17 | 1976-01-27 | Syva Company | Antibody steric hindrance immunoassay with two antibodies |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4034074A (en) | 1974-09-19 | 1977-07-05 | The Board Of Trustees Of Leland Stanford Junior University | Universal reagent 2-site immunoradiometric assay using labelled anti (IgG) |
| US3984533A (en) | 1975-11-13 | 1976-10-05 | General Electric Company | Electrophoretic method of detecting antigen-antibody reaction |
| US4098876A (en) | 1976-10-26 | 1978-07-04 | Corning Glass Works | Reverse sandwich immunoassay |
| US4879219A (en) | 1980-09-19 | 1989-11-07 | General Hospital Corporation | Immunoassay utilizing monoclonal high affinity IgM antibodies |
| US5011771A (en) | 1984-04-12 | 1991-04-30 | The General Hospital Corporation | Multiepitopic immunometric assay |
| EP0167825A2 (de) | 1984-06-08 | 1986-01-15 | Dr. Rentschler Arzneimittel GmbH & Co. | Lipidnanopellets als Trägersystem für Arzneimittel zur peroralen Anwendung |
| US4666828A (en) | 1984-08-15 | 1987-05-19 | The General Hospital Corporation | Test for Huntington's disease |
| US4683202B1 (OSRAM) | 1985-03-28 | 1990-11-27 | Cetus Corp | |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4801531A (en) | 1985-04-17 | 1989-01-31 | Biotechnology Research Partners, Ltd. | Apo AI/CIII genomic polymorphisms predictive of atherosclerosis |
| EP0264166A1 (en) | 1986-04-09 | 1988-04-20 | Genzyme Corporation | Transgenic animals secreting desired proteins into milk |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| WO1989010756A1 (fr) | 1988-05-06 | 1989-11-16 | Toray Industries, Inc. | COMPOSITION D'INTERFERON beta STABLE |
| US5272057A (en) | 1988-10-14 | 1993-12-21 | Georgetown University | Method of detecting a predisposition to cancer by the use of restriction fragment length polymorphism of the gene for human poly (ADP-ribose) polymerase |
| US5712122A (en) | 1989-02-21 | 1998-01-27 | Washington University | Carboxy terminal peptide-extended proteins |
| US5464764A (en) | 1989-08-22 | 1995-11-07 | University Of Utah Research Foundation | Positive-negative selection methods and vectors |
| US5487992A (en) | 1989-08-22 | 1996-01-30 | University Of Utah Research Foundation | Cells and non-human organisms containing predetermined genomic modifications and positive-negative selection methods and vectors for making same |
| US5192659A (en) | 1989-08-25 | 1993-03-09 | Genetype Ag | Intron sequence analysis method for detection of adjacent and remote locus alleles as haplotypes |
| US5281521A (en) | 1992-07-20 | 1994-01-25 | The Trustees Of The University Of Pennsylvania | Modified avidin-biotin technique |
| US5932447A (en) | 1994-05-17 | 1999-08-03 | Bristol-Myers Squibb Company | Cloning and expression of a gene encoding bryodin 1 from Bryonia dioica |
Non-Patent Citations (55)
| Title |
|---|
| "Immobilized Cells and Enzymes", 1986, IRL PRESS |
| "LIPOSOMES IN THE THERAPY OF INFECTIOUS DISEASE AND CANCER", pages: 317 - 327 |
| "Methods in Enzymology", vol. 1-317, ACADEMIC PRESS |
| "PCR Protocols: A Guide To Methods And Applications", 1990, ACADEMIC PRESS |
| "Vectors: A Survey of Molecular Cloning Vectors and Their Uses", 1988, BUTTERWORTHS |
| AUSUBEL ET AL.,: "Current Protocols in Molecular Biology", 1992, JOHN WILEY & SONS |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1989, JOHN WILEY AND SONS |
| AUSUBEL, R. M.,: "Current Protocols in Molecular Biology", vol. I-III, 1994 |
| B. D., AND HIGGINS S. J.: "Nucleic Acid Hybridization", 1985 |
| BANERJI ET AL., CELL, vol. 33, 1983, pages 729 - 740 |
| BIRREN ET AL.: "Genome Analysis: A Laboratory Manual Series", vol. 1-4, 1998, COLD SPRING HARBOR LABORATORY PRESS |
| BITTER ET AL., METHODS IN ENZYMOL., vol. 153, 1987, pages 516 - 544 |
| BOOTH ET AL., IMMUNOL. LETT., vol. 19, 1988, pages 65 - 70 |
| BRISSON ET AL., NATURE, vol. 310, 1984, pages 511 - 514 |
| BROGLI ET AL., SCIENCE, vol. 224, 1984, pages 838 - 843 |
| BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 507 |
| BYRNE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 5473 - 5477 |
| C.A. RAMSDEN GD.,: "Quantitative Drug Design", 1992, PERGAMON PRESS, article "Chapter 17.2," |
| CALAME ET AL., ADV. IMMUNOL., vol. 43, 1988, pages 235 - 275 |
| CELLIS, J. E.,: "Cell Biology: A Laboratory Handbook", vol. I-III, 1994 |
| CHANG ET AL.: "Somatic Gene Therapy", 1995, CRC PRESS |
| COLIGAN J. E.: "Current Protocols in Immunology", vol. I-III, 1994 |
| CORUZZI ET AL., EMBO J., vol. 3, 1984, pages 1671 - 1680 |
| EDLUNCH ET AL., SCIENCE, vol. 230, 1985, pages 912 - 916 |
| FINGL ET AL.: "The Pharmacological Basis of Therapeutics", 1975, article "Ch. 1", pages: L |
| FRESHNEY, R. I.,: "Animal Cell Culture", 1986 |
| FRESHNEY: "Culture of Animal Cells - A Manual of Basic Technique", 1994, WILEY-LISS |
| GAIT, M. J.,: "Oligonucleotide Synthesis", 1984 |
| GARDELLA ET AL., J. BIOL. CHEM., vol. 265, 1990, pages 15854 - 15859 |
| GILBOA, BIOTECHNIQUES, vol. 4, no. 6, 1986, pages 504 - 512 |
| GOODSON, MEDICAL APPLICATIONS OF CONTROLLED RELEASE, vol. 2, 1984, pages 115 - 138 |
| GURLEY ET AL., MOL. CELL. BIOL., vol. 6, 1986, pages 559 - 565 |
| HAMES, B. D., AND HIGGINS S. J.,: "Transcription and Translation", 1984 |
| J. E. DIEDERICHS, HARM./ND., vol. 56, 1994, pages 267 - 275 |
| LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533 |
| MARSHAK ET AL.: "Strategies for Protein Purification and Characterization - A Laboratory Course Manual", 1996, CSHL PRESS |
| MISHELL AND SHIIGI: "Selected Methods in Cellular Immunology", 1980, W. H. FREEMAN AND CO. |
| PERBAL, B.: "A Practical Guide to Molecular Cloning", 1984 |
| PERBAL: "A Practical Guide to Molecular Cloning", 1988, JOHN WILEY & SONS |
| PINKERT ET AL., GENES DEV., vol. 1, 1987, pages 268 - 277 |
| PLASMID, vol. 501, pages 136 - 1 |
| SAMBROOK ET AL.: "Molecular Cloning: A laboratory Manual", 1989 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRINGS HARBOR LABORATORY |
| SAUDEK ET AL., N. ENGL. J. MED., vol. 321, 1989, pages 574 |
| SEFTON, CRC CRIT. REF. BIOMED. ENG., vol. 14, 1987, pages 201 |
| SPEISER, PHARM. RES., vol. 8, 1991, pages 47 - 54 |
| SROUR, M.A. ET AL., THROMB. HAEMOST., vol. 90, 2003, pages 398 - 405 |
| STITES ET AL.: "Basic and Clinical Immunology(8th Edition),", 1994, APPLETON & LANGE |
| STUDIER ET AL., METHODS IN ENZYMOL., vol. 185, 1990, pages 60 - 89 |
| TAKAMATSU ET AL., EMBO J., vol. 6, 1987, pages 307 - 311 |
| TREAT ET AL.: "Liposomes in the Therapy of Infectious Disease and Cancer", 1989, LISS, pages: 353 - 365 |
| VEGA ET AL.: "Gene Targeting", 1995, CRC PRESS |
| WATSON ET AL.: "Recombinant DNA", SCIENTIFIC AMERICAN BOOKS |
| WEISSBACH; WEISSBACH: "Methods for Plant Molecular Biology", 1988, ACADEMIC PRESS, article "Section VIII,", pages: 421 - 463 |
| WINOTO ET AL., EMBO J., vol. 8, 1989, pages 729 - 733 |
Cited By (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10351615B2 (en) | 2006-02-03 | 2019-07-16 | Opko Biologics Ltd. | Methods of treatment with long-acting growth hormone |
| US10221228B2 (en) | 2006-02-03 | 2019-03-05 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US9896494B2 (en) | 2006-02-03 | 2018-02-20 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing same |
| US11066658B2 (en) | 2006-02-03 | 2021-07-20 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US10640758B2 (en) | 2006-02-03 | 2020-05-05 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US9884901B2 (en) | 2006-02-03 | 2018-02-06 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US10119132B2 (en) | 2006-02-03 | 2018-11-06 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US9828417B2 (en) | 2006-02-03 | 2017-11-28 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US10030060B2 (en) | 2006-02-03 | 2018-07-24 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing same |
| US9663778B2 (en) | 2009-07-09 | 2017-05-30 | OPKO Biologies Ltd. | Long-acting coagulation factors and methods of producing same |
| EP3130346A1 (en) | 2009-07-09 | 2017-02-15 | OPKO Biologics Ltd. | Long-acting factor vii coagulation factors |
| US10538755B2 (en) | 2009-07-09 | 2020-01-21 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US12203113B2 (en) | 2009-07-09 | 2025-01-21 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US9597378B2 (en) | 2011-10-06 | 2017-03-21 | Hanmi Science Co., Ltd. | Blood coagulation factor VII and VIIa derivatives, conjugates and complexes comprising the same, and use thereof |
| JP2014530018A (ja) * | 2011-10-06 | 2014-11-17 | ハンミ サイエンス カンパニー リミテッドHanmi Scienceco.,Ltd. | 血液凝固因子VII及びVIIa誘導体、それらを含む結合体及び複合体、並びにそれらの使用 |
| KR20210125595A (ko) * | 2012-02-14 | 2021-10-18 | 옵코 바이오로직스 리미티드 | 장기 작용 응고 인자들 및 이를 생산하는 방법들 |
| KR20200063274A (ko) * | 2012-02-14 | 2020-06-04 | 옵코 바이오로직스 리미티드 | 장기 작용 응고 인자들 및 이를 생산하는 방법들 |
| KR20140134673A (ko) * | 2012-02-14 | 2014-11-24 | 옵코 바이오로직스 리미티드 | 장기 작용 응고 인자들 및 이를 생산하는 방법들 |
| KR102630953B1 (ko) * | 2012-02-14 | 2024-01-29 | 옵코 바이오로직스 리미티드 | 장기 작용 응고 인자들 및 이를 생산하는 방법들 |
| KR102310704B1 (ko) * | 2012-02-14 | 2021-10-08 | 옵코 바이오로직스 리미티드 | 장기 작용 응고 인자들 및 이를 생산하는 방법들 |
| JP2015508771A (ja) * | 2012-02-14 | 2015-03-23 | オプコ バイオロジクス リミテッド | 長時間作用型凝固因子およびその生成方法 |
| KR102118729B1 (ko) * | 2012-02-14 | 2020-06-05 | 옵코 바이오로직스 리미티드 | 장기 작용 응고 인자들 및 이를 생산하는 방법들 |
| JP2018065815A (ja) * | 2012-02-14 | 2018-04-26 | オプコ バイオロジクス リミテッド | 長時間作用型凝固因子およびその生成方法 |
| JP2015520128A (ja) * | 2012-04-19 | 2015-07-16 | オプコ バイオロジクス リミテッド | 長時間作用性オキシントモジュリン変異体とその作製方法 |
| US9522945B2 (en) | 2012-04-19 | 2016-12-20 | Opko Biologics Ltd. | Long-acting oxyntomodulin variants and methods of producing same |
| US9808534B2 (en) | 2012-11-20 | 2017-11-07 | Opko Biologics Ltd. | Method of increasing the hydrodynamic volume of polypeptides by attaching to gonadotrophin carboxy terminal peptides |
| JP2016505544A (ja) * | 2012-12-03 | 2016-02-25 | メルク・シャープ・アンド・ドーム・コーポレーションMerck Sharp & Dohme Corp. | O−グリコシル化カルボキシ末端部分(ctp)ペプチド系のインスリンおよびインスリン類似体 |
| JP2019108343A (ja) * | 2012-12-03 | 2019-07-04 | メルク・シャープ・アンド・ドーム・コーポレーションMerck Sharp & Dohme Corp. | O−グリコシル化カルボキシ末端部分(ctp)ペプチド系のインスリンおよびインスリン類似体 |
| EP2956477B1 (en) | 2013-02-15 | 2020-11-18 | Bioverativ Therapeutics Inc. | Optimized factor viii gene |
| EP2956477B2 (en) † | 2013-02-15 | 2024-01-24 | Bioverativ Therapeutics Inc. | Optimized factor viii gene |
| US11787851B2 (en) | 2013-02-15 | 2023-10-17 | Bioverativ Therapeutics Inc. | Optimized factor VIII gene |
| WO2014159813A1 (en) | 2013-03-13 | 2014-10-02 | Moderna Therapeutics, Inc. | Long-lived polynucleotide molecules |
| US11197915B2 (en) | 2013-10-21 | 2021-12-14 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US12029780B2 (en) | 2013-10-21 | 2024-07-09 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US12275970B2 (en) | 2014-06-30 | 2025-04-15 | Bioverativ Therapeutics Inc. | Optimized factor IX gene |
| CN107438623A (zh) * | 2014-12-10 | 2017-12-05 | Opko生物科学有限公司 | 长效的ctp修饰的生长激素多肽的制备方法 |
| US12459982B2 (en) | 2014-12-10 | 2025-11-04 | Opko Biologistics Ltd. | Methods of producing long acting CTP-modified growth hormone polypeptides |
| US10960058B2 (en) | 2015-06-19 | 2021-03-30 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US11753461B2 (en) | 2016-02-01 | 2023-09-12 | Bioverativ Therapeutics Inc. | Optimized factor VIII genes |
| US11976106B2 (en) | 2016-07-11 | 2024-05-07 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| WO2020187969A1 (en) | 2019-03-19 | 2020-09-24 | CSL Behring Lengnau AG | Factor ix variants and uses thereof in therapy |
| US12403164B2 (en) | 2019-09-30 | 2025-09-02 | Bioverativ Therapeutics Inc. | Lentiviral vector formulations |
| US12173307B2 (en) | 2020-06-24 | 2024-12-24 | Bioverativ Therapeutics Inc. | Methods for the purification of viral vectors |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2451473B1 (en) | Long-acting coagulation factors and methods of producing same | |
| US8759292B2 (en) | Long-acting coagulation factors and methods of producing same | |
| AU2016202829B2 (en) | Long-acting coagulation factors and methods of producing same | |
| AU2015201906B2 (en) | Long-acting coagulation factors and methods of producing same | |
| HK1234320A1 (en) | Long-acting factor vii coagulation factors | |
| HK40120325A (en) | Long-acting coagulation factors and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080040296.X Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10796803 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 217403 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012519119 Country of ref document: JP Ref document number: 2767503 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 65/MUMNP/2012 Country of ref document: IN Ref document number: MX/A/2012/000469 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010269884 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2010269884 Country of ref document: AU Date of ref document: 20100701 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2010796803 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010796803 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20127003469 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 242369 Country of ref document: IL Ref document number: 242368 Country of ref document: IL |