WO2010090523A1 - Truncated cystine-knot proteins - Google Patents
Truncated cystine-knot proteins Download PDFInfo
- Publication number
- WO2010090523A1 WO2010090523A1 PCT/NL2010/050053 NL2010050053W WO2010090523A1 WO 2010090523 A1 WO2010090523 A1 WO 2010090523A1 NL 2010050053 W NL2010050053 W NL 2010050053W WO 2010090523 A1 WO2010090523 A1 WO 2010090523A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- acid sequence
- proteinmimic
- length
- cystine
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/18—Feminine contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the invention relates to the fields of protein chemistry, biology and medicine. More specifically, it relates to the design and preparation of proteinmimics of members of the cystine-knot growth factor superfamily. Further the invention relates to the use of these proteinmimics as a medicament or prophylactic agent.
- the cystine-knot three-dimensional structure is found in many extracellular molecules and is conserved among divergent species (ref 4 K
- the cystine-knot structure is formed by the arrangement of six cysteines which, through their disulfide bonds form a knot.
- a typical consensus motif for a cystine-knot structure is: X0-C1-X1-C2-X2-C3-X3-C4-X4-C5-X5- C6-X6, wherein cysteines 2, 3, 5 and 6 form a ring that includes X2 and X3, by disulfide bonding of cysteines 2 and 5, and cysteines 3 and 6.
- the third disulfide bond between cysteines 1 and 4 penetrates the ring, thus forming a knot (ref 2 > 3) .
- Figure 11 represents a schematic representation of a protein comprising a cystine-knot structure.
- This cystine-knot folding leads to the formation of three distinct domains, with two distorted beta- hairpin (beta-1 and beta- 3) loops protruding from one side of the knot, and a single (beta-2) hairpin loop protruding from the other side of the knot.
- the beta-1 hairpin loop is formed by the stretch of amino acids between Cl and C2 and is designated "Xl" in the above mentioned consensus motif; the beta-2 (“X3") and beta-3 (“X4") hairpin loops are formed by the amino acid stretch between C3 and C4, and between C4 and C5, respectively.
- Growth factors represent a large group of polypeptides that share the property of inducing cell multiplication both in vivo and in vitro. Although the level of sequence similarity between growth factors is low, they can be classified into subfamilies based on their structural and functional similarities.
- the following growth factor subfamilies all show the cystine-knot conformation described above: glycoprotein hormone-beta (GLHB) subfamily, the platelet derived growth factor (PDGF) subfamily, the transforming growth factor beta (TGF-beta) subfamily, the nerve growth factor (NGF) subfamily, the glycoprotein hormone-alpha (GLHA) subfamily, CTCK subfamily, Noggin-like subfamily, Coagulin subfamily, Mucin-like subfamily, Mucin-like BMP- antagonist subfamily, Mucin-like hemolectin subfamily, Slit-like subfamily, and Jagged-like subfamily.
- GLHB glycoprotein hormone-beta
- PDGF platelet derived growth factor
- TGF-beta transforming growth factor beta
- NGF nerve growth factor
- GLHA glycoprotein hormone-alpha subfamily
- CTCK subfamily Noggin-like subfamily
- Coagulin subfamily Mucin-like subfamily
- Mucin-like BMP- antagonist subfamily
- the different sub-families have for instance different consensus lengths for Xl, X2, X3, X4 and/or X5. Further, the different subfamilies have quite different functions and target organs. For instance, the GLHA and GLHB subfamilies are important for physiologic processes involved in reproduction, whereas members of the NGF subfamily exert their function mainly on nerve cells, and members of the PDGF subfamily mainly on endothelial cells.
- cysteines involved in cystine-knot formation can be present in a cystine-knot protein, which are normally used to create further disulfide bonds within the cystine-knot, within the protruding domains, or between two proteins, for instance during dimerization.
- VEGF vascular endothelial growth factor
- AvastinTM Bevacizumab
- FDA Food and Drug Administration
- FSH follicle stimulating hormone
- a goal of the present invention is to provide proteinmimics of members of the cystine-knot growth factor superfamily, which are preferably capable of inducing an immune response against said members.
- Another goal of the present invention is to provide alternative means and methods for treatment and/or prophylaxis of cystine-knot protein-related conditions.
- the invention provides proteinmimics of members of the cystine- knot growth factor superfamily, preferably for use in immunogenic and/or therapeutic compositions.
- cystine-knot proteins have a complex conformation comprising a ring that is constituted of at least two amino acid stretches and two disulfide bonds connecting said amino acid stretches. A third disulfide bond penetrates the ring, forming a knot. All members of the cystine-knot growth factor superfamily further have in common that the amino acid stretches between the first and the second cysteine and the fourth and fifth cysteine form beta-hairpin loops that protrude in one direction, whereas another amino acid stretch, which is situated between cysteines three and four, protrudes from the opposite site of the molecule. ( Figure 11).
- the invention provides a proteinmimic of a member of the cystine-knot growth factor superfamily, said proteinmimic having the motif X0-C1-X1-C2-X2-C3-X3-C4-X4-C5-X5-C6- X6, wherein Cl to C6 are cysteine residues which form a cystine-knot structure in which Cl is linked to C4, C2 is linked to C5 and C3 is linked to C6, and wherein XO and X6 represent, independently from each other, an amino acid sequence with a length of 0 to 10 amino acids, preferably 0 to 5 amino acids, more preferably 0 to 3 amino acids, more preferably 0 to 2 amino acids, even more preferably 0 or 1 amino acids, most preferable 0 amino acids, X2 represents an amino acid sequence with a length of 2 to 24 amino acid residues with at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to the amino acid sequence
- C2, C3, C5 and C6 form a ring by a bond between C2 and C5, and between C3 and C6, wherein the third bond between Cl and C4 penetrates the ring, thus forming a cystine-knot.
- a peptidomimetic according to the invention is provided, for which the total number of amino acids equals 130 or less, preferably 110 or less, more preferably 100 or less, even more preferably 90 or less, most preferably 80 or less.
- a proteinmimic according to the invention wherein Xl, X2, X3 and X4 each represent an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to an amino acid sequence of the same member of the cystine-knot growth factor superfamily.
- the invention provides a proteinmimic of a member of the cystine-knot growth factor superfamily, said proteinmimic having the motif X0-C1-X1-C2-X2-C3-X3-C4-X4-C5-X5-C6- X6, wherein Cl to C6 are cysteine residues which form a cystine-knot structure in which Cl is linked to C4, C2 is linked to C5 and C3 is linked to C6, and wherein XO and X6 represent, independently from each other, an amino acid sequence with a length of 0 to 10 amino acids, preferably 0 to 5 amino acids, more preferably 0 to 3 amino acids, more preferably 0 to 2 amino acids, more preferably 0 or 1 amino acids, most preferably 0 amino acids, X2 represents an amino acid sequence with a length of 2 to 24 amino acid residues with at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to the amino acid sequence located between C
- C2, C3, C5 and C6 form a ring by a bond between C2 and C5, and between C3 and C6, wherein the third bond between Cl and C4 penetrates the ring, thus forming a cystine-knot.
- a peptidomimetic according to the invention is provided, for which the total number of amino acids equals 130 or less, preferably 110 or less, more preferably 100 or less, even more preferably 90 or less, most preferably 80 or less.
- a member of the cystine-knot growth factor superfamily is herein defined as any protein that forms a typical cystine-knot three-dimensional structure as described above, thus with at least six cysteines that form a cystine-knot and three hairpin loops protruding from the knot, wherein cysteines 2, 3, 5 and 6 form a ring by a bond between cysteines 2 and 5, as well as between cysteines 3 and 6, and wherein the third bond between cysteines 1 and 4 penetrates the ring, thus forming the knot.
- a person skilled in the art is able, for instance by a combination of pattern search and pair wise alignments, to identify structural motifs, present in members of the cystine-knot growth factor superfamily.
- a person skilled in the art may be guided in his search for instance by known cystine-knot proteins belonging to the cystine-knot growth factor superfamily, for instance by the non-limiting examples provided in Figure 10.
- truncated cystine-knot proteins are especially useful for treating or preventing cystine-knot protein-related disorders. They have for instance shown that a truncated VEGF according to the invention shows negligible hormonal activity, whereas its immunological properties are excellent.
- One of the advantages of the negligible hormonal activity of truncated VEGF according to the invention is for instance, that a significant amount of truncated VEGF can be administered to an animal, without the hormonal side effects of the whole protein.
- Another advantage of truncated VEGF in comparison to the native protein or smaller fragments thereof, is that truncated VEGF is immunogenic per se.
- truncated VEGF is large enough to be immunogenic without being coupled to a carrier protein and, in contrast to the native protein, is "non-native" enough to be seen as non-self by the immune system.
- non-self is meant that the immune system does not consider the protein or parts of the protein as a self- protein and therefore mounts an immune response towards said protein.
- a truncated protein according to the invention is seen as "non-self is explained for instance by the concept of "cryptic peptides”.
- Cryptic peptides are defined as peptides that are part of a (self-)protein, but under normal conditions are not presented to the immune system.
- the immune system is "ignorant" of these cryptic peptides. Proteins taken up by antigen presenting cells are processed, i.e. cut in small peptide fragments. Under normal conditions, these small peptide fragments of a given protein are more or less identical after each processing. These are so-called dominant peptides. Each time a given protein is processed it produces for instance peptides x, y and z in sufficient amounts to be effectively presented to the immune system. The immune system, constantly being exposed to peptides x, y and z of self proteins, ignores these dominant peptides of self proteins, whereas dominant peptides of non-self proteins, which are occasionally present, are reacted to.
- a self protein is for instance truncated according to the invention
- the peptide fragments after processing in antigen presenting cells differ from those of the whole native protein.
- so-called "cryptic peptides” peptides that are not normally presented, are being generated and presented to the immune system in sufficient amounts.
- peptides x, z and w are generated and presented to the immune system.
- the immune system regards peptide w as non-self, and initiates an immune reaction. Without being bound to theory, this phenomenon may explain the enhanced immunogenicity of the truncated protein according to the invention as compared to the native protein.
- cystine-knot structure is important for the immunological properties of the protein. This is especially true, if the native protein is to be immunologically mimicked.
- the inventors have for instance shown that a truncated VEGF protein in which the cysteines were blocked, disabling cystine-knot formation, is not recognized by the therapeutic VEGF monoclonal antibody Bevacizumab, whereas a truncated VEGF in which a cystine-knot is presented is recognized by said antibody. It is clear that what is said above for VEGF is equally well true for other members of the cystine-knot growth factor superfamily.
- a proteinmimic of FSH it is preferred that the biological or hormonal activity is negligible, whereas the proteinmimic is preferably able to induce antibodies, preferably neutralizing antibodies that are capable of cross-reacting with the native protein.
- the proteinmimic is preferably able to induce antibodies, preferably neutralizing antibodies that are capable of cross-reacting with the native protein.
- a "truncated cystine-knot protein” is defined herein as a cystine- knot protein, in which at least part of the native amino acid sequence has been deleted, preferably N-terminal and/or C-terminal of the cystine-knot sequence. More preferably, the amino acid sequences N-terminal of Cl and C-terminal of C6 have been completely deleted.
- the invention provides a proteinmimic according to the invention, wherein said proteinmimic has the motif C1-X1-C2-X2-C3- X3-C4-X4-C5-X5-C6.
- C2, C3, C5 and C6 form a ring by a bond between C2 and C5, and between C3 and C6, and a third bond between Cl and C4 penetrates the ring, thus forming a cystine-knot.
- a peptidomimetic according to the invention is provided, for which the total number of amino acids equals 130 or less, preferably 110 or less, more preferably 100 or less, even more preferably 90 or less, most preferably 80 or less so that biological activity, e.g. hormonal side effects, are significantly reduced.
- a proteinmimic according to the invention wherein Xl represents an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to an amino acid sequence of a member of the cystine knot- growth factor superfamily and wherein X2, X3 and/or X4 represent an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to an amino acid sequence of at least one other member of the cystine knot growth factor superfamily.
- a chimeric proteinmimic contains amino acid sequences with at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to sequences of at least two different members of the cystine-knot growth factor superfamily.
- Such a chimeric proteinmimic according to the invention preferably comprises loops, at least one of which representing a loop from another member of the cystine-knot growth factor superfamily than the other loops.
- each of said loops represents another member of the cystine-knot growth factor superfamily.
- the invention provides a proteinmimic according to the invention, wherein said proteinmimic comprises the motif C1-X1-C2-X2- C3-X3-C4-X4-C5-X5-C6, wherein each of said Xl, X2, X3, X4 and X5 represents an amino acid sequence that has at least 80%, preferably at least 85%, more preferably at least 90%, most preferably at least 95% sequence identity with the corresponding part of a sequence selected from any of the sequences 1 to 145 of Figure 10.
- each of said Xl, X2, X3, X4 and X5 represents an amino acid sequence that is identical to the corresponding part of a sequence selected from sequences 1 to 145 of Figure 10.
- the invention provides a proteinmimic according to the invention, wherein X3 represents an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to an amino acid sequence of a member of the cystine knot-growth factor superfamily and wherein Xl, X2 and/or X4 represent an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to an amino acid sequence of at least one other member of the cystine knot growth factor superfamily, preferably wherein said at least one other member of the cystine knot growth factor superfamily is a member of the TGF-beta subfamily, more preferably TGFB2.
- Xl, X2 and X4 each represent an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to an amino acid sequence of the corresponding part of the same cystine-knot growth factor superfamily
- X3 represents an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to an amino acid sequence of the corresponding part of another member of the cystine-knot growth factor superfamily.
- Xl, X2 and X4 represent an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to an amino acid sequence of a member of the TGF-beta subfamily, more preferably to an amino acid sequence of TGFB2.
- the chimeric proteinmimic consists of the amino acid sequence:
- TGF2B2 is a member of the TGF-beta subfamily. It is a secreted protein (cytokine) that performs many cellular functions and has a vital role during embryonic development.
- G-TSF Glioblastoma- derived T-cell suppressor factor
- BSC-I cell growth inhibitor BSC-I cell growth inhibitor
- Polyergin BSC-I cell growth inhibitor
- Cetermin Cetermin
- the invention provides a proteinmimic according to the invention, wherein XO represents acetyl and/or X6 represents amide.
- XO represents acetyl and X6 represents amide.
- Acetylation of the N-terminus and/or amidation of the C-terminus has several advantages, for instance the acetylated and amidated peptide ends are uncharged so they mimic natural peptides, stability toward digestions by aminopeptidases is enhanced and peptide ends are blocked against synthetase activities.
- the invention provides a proteinmimic of a member of the cystine-knot growth factor superfamily, said proteinmimic having an identical sequence as said member, with the exception that the protein is truncated at position 0 to 10, preferably at position 0 to 5, more preferably at position 0 to 3, even more preferably at position 0 to 2, most preferably at position 0 or 1 N-terminal of Cl and at position 0 to 10, preferably at position 0 to 5, more preferably at position 0 to 3, even more preferably at position 0 to 2, more preferably at position 0 or 1, most preferably at position 0 C-terminal of C6.
- consensus sequences of a subfamily can be used for designing a proteinmimic useful in the invention.
- X2 consists of 2 or 3 amino acids which can be defined as X2a-G-X2b, wherein X2a is any amino acid or none, G is glycine, and X2b is any amino acid.
- X2 has the amino acid sequence X2a-G-X2b, wherein X2a is any amino acid or none, G is glycine, and X2b is any amino acid.
- a proteinmimic according to the invention which comprises at least one of the following consensus sequences:
- X means any amino acid
- [GSRE] means G or S or R or E ;
- [KRL] means K or R or L;
- [LIVT] means L or I or V or T;
- [DE] means D or E ;
- [YW] means Y or W;
- [PSR] means P or S or R
- [GSTA] means G or S or T or A
- [LIVM] means L or I or V or M
- [FY] means F or Y ;
- [STAGM] means S or T or A or G or M;
- [HFYL] means H or F or Y or L;
- [DEY] means D or E or Y; [GN] means G or N ; [RQS] means R or Q or S; (X) 13 means a sequence of 13 amino acids; (X)2 means a sequence of 2 amino acids; (X) 12 means a sequence of 13 amino acids and (X)2,4 means a sequence of 2, 3 or 4 amino acids.
- a proteinmimic which shows a considerable % sequence identity with a native amino acid sequence of said cystine-knot protein, in order to produce antibodies and/or T cells that are capable of cross-reacting towards the native protein.
- considerably % sequence identity is meant: at least 70%, preferably at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity with the native amino acid sequence of said cystine-knot protein.
- the T-cells and/or antibodies that are raised against the proteinmimic are especially useful if they are able to cross-react with a native cystine-knot protein. However, in another embodiment, it can be especially useful to not generate antibodies against the native protein, for instance if the proteinmimic is to be used as an antagonist of a cystine- knot protein.
- a proteinmimic according to the invention with a lower sequence identity with the native protein is designed, preferably between 70% and 90%, more preferably between 70% and 80%, most preferably between 70% and 75% sequence identity with the native amino acid sequence of said cystine-knot protein.
- % sequence identity is defined herein as the percentage of residues in a candidate amino acid sequence that is identical with the residues in a reference sequence after aligning the two sequences and introducing gaps, if necessary, to achieve the maximum percent identity. Methods and computer programs for the alignment are well known in the art. One computer program which may be used or adapted for purposes of determining whether a candidate sequence falls within this definition is "Align 2", authored by Genentech, Inc., which was filed with user documentation in the United States Copyright Office, Washington, D. C. 20559, on Dec. 10, 1991.
- a proteinmimic according to the invention wherein the proteinmimic has an amino acid sequence with at least 70% sequence identity, preferably at least 80%, more preferably at least 85%, most preferably at least 90% sequence identity to the corresponding native amino acid sequence of said member of the cystine-knot growth factor superfamily.
- the invention provides a proteinmimic according to the invention, wherein said member of the cystine-knot growth factor superfamily is a member selected from the group consisting of the GLHB subfamily, the PDGF subfamily, the TGF-beta subfamily, the NGF subfamily, the GLHA subfamily, the CTCK subfamily, the Noggin-like subfamily, the Mucin-like subfamily, the Mucin-like BMP antagonist subfamily, the Mucin-like hemolectin subfamily, the Slit-like subfamily, and the Jagged-like subfamily.
- said member of the cystine-knot growth factor superfamily is a member selected from the group consisting of the GLHB subfamily, the PDGF subfamily, the TGF-beta subfamily, the NGF subfamily, the GLHA subfamily, the CTCK subfamily, the Noggin-like subfamily, the Mucin-like subfamily, the Mucin-like BMP antagonist subfamily, the Mucin-like hemolectin subfamily, the
- a proteinmimic according to the invention wherein the proteinmimic has an amino acid sequence with between 70% and 90%, more preferably between 70% and 80%, most preferably between 70% and 75% sequence identity to the corresponding native amino acid sequence of said member of the cystine- knot growth factor superfamily.
- the invention provides a proteinmimic according to the invention, wherein said member of the cystine-knot growth factor superfamily is a member selected from the group consisting of the GLHB subfamily, the PDGF subfamily, the TGF-beta subfamily, the NGF subfamily, the GLHA subfamily, the CTCK subfamily, the Noggin-like subfamily, the Mucin-like subfamily, the Mucin-like BMP antagonist subfamily, Mucin-like hemolectin subfamily, the Slit-like subfamily, and the Jagged-like subfamily.
- said member of the cystine-knot growth factor superfamily is a member selected from the group consisting of the GLHB subfamily, the PDGF subfamily, the TGF-beta subfamily, the NGF subfamily, the GLHA subfamily, the CTCK subfamily, the Noggin-like subfamily, the Mucin-like subfamily, the Mucin-like BMP antagonist subfamily, Mucin-like hemolectin subfamily, the Slit
- a proteinmimic with at least 70% sequence identity, preferably at least 80%, more preferably at least 85%, most preferably at least 90% sequence identity to the corresponding native amino acid sequence of said member of the cystine-knot growth factor superfamily, wherein at least one of the amino acid sequences represented by Xl, X3, or X4 is at least partly deleted and/or modified.
- said amino acid sequence comprises an immunodominant peptide, or if said amino acid sequence has no function, for instance if said sequence it is not part of the immunogenic determinant of said member.
- the invention provides a proteinmimic according to the invention, wherein at least one of the amino acid sequences represented by Xl, X3, or X4 is at least partly deleted and/or modified.
- PDGF plays a role in embryonic development, cell proliferation, cell migration, and angiogenesis.
- PDGF has also been linked to several diseases such as atherosclerosis, fibrosis and malignant diseases.
- VEGF vascular endothelial growth factor
- a sub-subfamily of the PDGF subfamily has been linked to angiogenesis related to tumor growth and metastasis.
- the invention provides a proteinmimic according to the invention, wherein said member is a member of the PDGF subfamily, and wherein X2 represents an amino acid sequence with a length of 3 amino acids, X5 represents an amino acid sequence with a length of 1 amino acid, Xl represents an amino acid sequence with a length of 29 to 32 amino acids, X3 represents an amino acid sequence with a length of 6 to 12 amino acids, and X4 represents an amino acid sequence with a length of 32 to 41 amino acids.
- a proteinmimic according to the invention wherein said member is human Vascular Endothelial Growth Factor (hVEGF), and wherein XO comprises amino acid sequence KFMDVYQRSY, Xl comprises amino acid sequence HPIETLVDIFQEYDPEIEYIFKPSAVPLMR, X2 comprises GGA, X3 comprises NDEGLE, X4 comprises
- a proteinmimic which has at least 70% sequence identity to XO- X6 of hVEGF, wherein X0-X6 are the respective hVEGF amino acid sequences depicted in Figure 10.
- said proteinmimic has at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to X0-X6 of hVEGF.
- a proteinmimic according to the invention wherein said member is human Vascular Endothelial Growth Factor (hVEGF), and wherein said proteinmimic consists of the amino acid sequence C1HPIETLVDIFQEYDPEIEYIFKPSAVPLMRC2GGAC3NDEGLEC4VPT EESNITMQIMRIKPHQGQHIGEMSFLQHNKC ⁇ ECe, optionally comprising flanking sequences with a length of at most 5 amino acids.
- the flanking sequences have a length of at most 2 amino acids, preferably at most 1 amino acid.
- the proteinmimic does not comprise flanking sequences.
- Placental growth factor is a member of the PDGF subfamily (subfamily 4) and a key molecule in angiogenesis and vasculogenesis, in particular during embryogenesis.
- the main source of PLGF during pregnancy is the placental trophoblast.
- PLGF is also expressed in many other tissues, including the villous trophoblast. PLGF expression within human atherosclerotic lesions is associated with plaque inflammation and neovascular growth.
- Serum levels of PLGF and sFlt-1 are altered in women with preeclampsia.
- sFlt-1 soluble fms-like tyrosine kinase- 1, also known as soluble VEGF receptor- 1
- serum levels of sFlt- 1 are higher and PLGF lower in women presenting with preeclampsia.
- placental sFlt-1 levels were significantly increased and PLGF decreased in women with preeclampsia as compared to those with uncomplicated pregnancies. This suggests that placental concentrations of sFlt-1 and PLGF mirror the maternal serum changes.
- a proteinmimic according to the invention wherein said member is human Placental Growth Factor (hPLGF), and wherein XO comprises amino acid sequence PFQEVWGRSY, Xl comprises amino acid sequence RALERLVDWSEYPSEVEHMFSPSAVSLLR, X2 comprises TGA, X3 comprises GDENLH, X4 comprises
- a proteinmimic which has at least 70% sequence identity to XO- X6 of PLGF, wherein X0-X6 are the respective PLGF amino acid sequences depicted in Figure 10.
- said proteinmimic has at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to X0-X6 of PLGF.
- a proteinmimic according to the invention is provided, wherein said member is human Placental Growth Factor (hPLGF), and wherein said proteinmimic consists of the amino acid sequence
- flanking sequences optionally comprising flanking sequences with a length of at most 5 amino acids.
- the flanking sequences have a length of at most 2 amino acids, preferably at most 1 amino acid.
- the proteinmimic does not comprise flanking sequences.
- a proteinmimic according to the invention wherein said member is human Platelet Derived Growth Factor A (hPDGF-A), and wherein XO comprises amino acid sequence SIEEAVPAV, Xl comprises amino acid sequence KTRTVIYEIPRSQVDPTSANFLIWPPCVEVKR, X2 comprises TGC, X3 comprises NTSSVK, X4 comprises QPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLE, X5 comprises A, and X6 comprises ATSLNPDYRE.
- hPDGF-A Human Platelet Derived Growth Factor A
- a proteinmimic which has at least 70% sequence identity to X0-X6 of hPDGF-A, wherein X0-X6 are the respective hPDGF-A amino acid sequences depicted in Figure 10.
- said proteinmimic has at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to X0-X6 of hPDGF-A.
- a proteinmimic according to the invention wherein said member is human Platelet Derived Growth Factor A (hPDGF-C), and wherein XO comprises amino acid sequence LLTEEVRL YS, Xl comprises amino acid sequence TPRNFSVSIREELKRTDTIFWPGCLLVKR, X2 comprises GGN, X3 comprises ACCLHNCNECQ, X4 comprises
- a proteinmimic which has at least 70% sequence identity to X0-X6 of hPDGF-C, wherein X0-X6 are the respective hPDGF-C amino acid sequences depicted in Figure 10.
- said proteinmimic has at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to X0-X6 of hPDGF-C.
- a proteinmimic according to the invention wherein said member is human Vascular Endothelial Growth Factor C (hVEGF-C), and wherein XO comprises amino acid sequence SIDNEWRKTQ, Xl comprises amino acid sequence MPREVAIDVGKEFGVATNTFFKPPCVSVYR, X2 comprises GGC, X3 comprises PDDGLE, X4 comprises VPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQ, X5 comprises E, and X6 comprises RPKKKDSA VK.
- hVEGF-C Vascular Endothelial Growth Factor C
- a proteinmimic which has at least 70% sequence identity to XO- X6 of hVEGF-C, wherein X0-X6 are the respective hVEGF-C amino acid sequences depicted in Figure 10.
- X0-X6 are the respective hVEGF-C amino acid sequences depicted in Figure 10.
- said proteinmimic has at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to X0-X6 of hVEGF-C.
- Other subfamilies of the cystine-knot growth factor superfamily include the GLHA and GLHB subfamily.
- LH luteinizing hormone
- TSH thyroid stimulating hormone
- CG chorionic gonadotropin
- FSH follicle stimulating hormone
- TSH is important for Sertoli cell maturation and ovulatory function.
- the present invention also provides proteinmimics of this GLHB subfamily.
- said member of the cystine- knot growth factor superfamily is a member of the GLHB subfamily
- X2 represents an amino acid sequence with a length of 3 amino acids
- X5 represents an amino acid sequence with a length of 1 amino acid
- Xl represents an amino acid sequence with a length of 23 to 28 amino acids
- X3 represents an amino acid sequence with a length of 18 to 20 amino acids
- X4 represents an amino acid sequence with a length of 30 to 33 amino acids.
- a proteinmimic according to the invention wherein said member is human Follicle Stimulating Hormone (hFSH), and wherein XO comprises amino acid sequence NS, Xl comprises amino acid sequence ELTNITIAIEKEECRFCISINTTW, X2 comprises AGY, X3 comprises YTRDLVYKD PARPKIQKT, X4 comprises TFKELVYETVRVPGCAHHADSLYTYPVATQ, X5 comprises H, and X6 comprises KCDSDSTDCT.
- hFSH human Follicle Stimulating Hormone
- a proteinmimic which has at least 70% sequence identity to XO- X6 of FSH, wherein X0-X6 are the respective FSH amino acid sequences depicted in Figure 10.
- said proteinmimic has at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to X0-X6 of FSH.
- a proteinmimic according to the invention wherein said member is human Choriogonadotropin (hCG), and wherein XO comprises amino acid sequence SKEPLRPR, Xl comprises amino acid sequence RPINATLAVEKEGCPVCITVNTTI, X2 comprises AGY, X3 comprises PTMTRVLQGVLPALPQW, X4 comprises NYRDVRFESIRLPGCPRGVNPWSYAVALS, X5 comprises Q, and X6 comprises ALCRRSTTDC.
- a proteinmimic which has at least 70% sequence identity to XO- X6 of hCG, wherein X0-X6 are the respective hCG amino acid sequences depicted in Figure 10.
- said proteinmimic has at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to X0-X6 of hCG.
- the invention provides a proteinmimic according to the invention, wherein said member of the cystine-knot growth factor superfamily is a member of the glycoprotein hormone-alpha (GLHA) subfamily, and wherein X2 represents an amino acid sequence with a length of 3 amino acids, X5 represents an amino acid sequence with a length of 1 amino acid, Xl represents an amino acid sequence with a length of 13 to 17 amino acids, X3 represents an amino acid sequence with a length of 27 amino acids, and X4 represents an amino acid sequence with a length of 20 to 21 amino acids.
- GLHA glycoprotein hormone-alpha
- a proteinmimic according to the invention wherein said member of the cystine-knot growth factor superfamily is a member of the nerve growth factor (NGF) subfamily, and wherein X2 represents an amino acid sequence with a length of 9 to 24 amino acids, X5 represents an amino acid sequence with a length of 1 amino acid, Xl represents an amino acid sequence with a length of 41 to 44 amino acids, X3 represents an amino acid sequence with a length of 11 amino acids, and X4 represents an amino acid sequence with a length of 27 or 28 amino acids.
- NGF nerve growth factor
- a proteinmimic according to the invention wherein said member is human Nerve Growth Factor (hNGF), and wherein XO comprises amino acid sequence PIFHRGEFSV, Xl comprises amino acid sequence DSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETK, X2 comprises RDPNPVDSG, X3 comprises RGIDSKHWNSY, X4 comprises TTTHTFVKALTMDGKQAAWRFIRIDTA, X5 comprises V, and X6 comprises VLSRKAVRRA.
- hNGF Human Nerve Growth Factor
- a proteinmimic which has at least 70% sequence identity to XO- X6 of hNGF, wherein X0-X6 are the respective hNGF amino acid sequences depicted in Figure 10.
- said proteinmimic has at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to X0-X6 of hNGF.
- NGF neurotrophic factor receptor 1
- NGF neurotrophic factor receptor 1
- NGF plays a role in the repair, regeneration, and protection of neurons, and a proteinmimic of a member of the NGF subfamily according to the invention is thus especially useful for treating or preventing a neurodegenerative disorder.
- TGF-beta Yet another subfamily of the cystine-knot growth factor superfamily is the TGF-beta subfamily. TGF-beta controls proliferation, cellular differentiation, and other functions in most cells. It plays a role in immunity, cancer, heart disease and in Marfan syndrome, a genetic disorder of the connective tissue.
- the invention provides a proteinmimic according to the invention, wherein said member of the cystine-knot growth factor superfamily is a member of the transforming growth factor beta (TGF-beta) subfamily, and wherein X2 represents an amino acid sequence with a length of 3 amino acids, X5 represents an amino acid sequence with a length of 1 amino acid, Xl represents an amino acid sequence with a length of 23 to 41 amino acids, X3 represents an amino acid sequence with a length of 18 to 36 amino acids, and X4 represents an amino acid sequence with a length of 27 to 34 amino acids.
- TGF-beta transforming growth factor beta
- a proteinmimic according to the invention wherein said member is human Transforming Growth Factor beta2 (hTGF-beta2), and wherein XO comprises amino acid sequence AYCFRNVQDN, Xl comprises amino acid sequence CLRPLYIDFKRDLGWKWIHEPKGYNANF, X2 comprises AGA, X3 comprises PYLWSSDTQHSRVLSLYNTINPEASASPC, X4 comprises VSQDLEPLTILYYIGKTPKIEQLSNMIVKS, X5 comprises K, and X6 comprises S.
- hTGF-beta2 human Transforming Growth Factor beta2
- XO comprises amino acid sequence AYCFRNVQDN
- Xl comprises amino acid sequence CLRPLYIDFKRDLGWKWIHEPKGYNANF
- X2 comprises AGA
- X3 comprises PYLWSSDTQHSRVLSLYNTINPEASASPC
- X4 comprises VSQDLEPLTILYYIGKTPKI
- a proteinmimic which has at least 70% sequence identity to X0-X6 of hTGF- beta2, wherein X0-X6 are the respective hTGF-beta2 amino acid sequences depicted in Figure 10.
- said proteinmimic has at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to X0-X6 of hTGF-beta2.
- C-terminal cystine-knot C-terminal cystine-knot
- vWF von Willebrand factor
- the invention provides a proteinmimic according to the invention, wherein said member of the cystine-knot growth factor superfamily is a member of the CTCK subfamily, and wherein X2 represents an amino acid sequence with a length of 2 to 3 amino acids, X5 represents an amino acid sequence with a length of 1 amino acid, Xl represents an amino acid sequence with a length of 22 to 35 amino acids, X3 represents an amino acid sequence with a length of 4 to 28 amino acids, and X4 represents an amino acid sequence with a length of 29 to 41 amino acids.
- Sclerostin is a also a member of the CTCK- subfamily of the cystine-knot growth factor super family. Sclerostin, the product of the SOST gene, was originally believed to be a non-classical Bone morphogenetic protein (BMP) antagonist. More recently, Sclerostin has been identified as binding to LRP5/6 receptors and inhibiting the Wnt- signalling pathway. Wnt- activation under these circumstances is antagonistic to bone formation. More recently, it has been revealed that the antagonism of BMP-induced bone formation by sclerostin is mediated by Wnt signalling, but not BMP signalling pathways.
- BMP Bone morphogenetic protein
- SOST67-144 in one of the examples serves to demonstrate that truncated cystine-knot proteins/peptides with an additional SS-bridge between C71 (loop-1; Xl) and C125 (loop-3; X4) perfectly form the correctly folded cystine-knot structure in presence of the additional disulfide bond.
- a proteinmimic according to the invention wherein said member is sclerostin, and wherein XO comprises amino acid sequence FETKDVSEYS, wherein Xl comprises amino acid sequence RELHFTRYVTDGPCRSAKPVTELV, X2 comprises SGQ, X3 comprises GPARLLPNAIGRGKWWRPSGPDFR, X4 comprises IPDRYRAQRVQLLCPGGEAPRARKVRLVAS, X5 comprises K, and X6 comprises KRLTRFHNQS.
- XO comprises amino acid sequence FETKDVSEYS
- Xl comprises amino acid sequence RELHFTRYVTDGPCRSAKPVTELV
- X2 comprises SGQ
- X3 comprises GPARLLPNAIGRGKWWRPSGPDFR
- X4 comprises IPDRYRAQRVQLLCPGGEAPRARKVRLVAS
- X5 comprises K
- X6 comprises KRLTRFHNQS.
- a proteinmimic which has at least 70% sequence identity to XO- X6 of sclerostin, wherein X0-X6 are the respective sclerostin amino acid sequences depicted in Figure 10.
- said proteinmimic has at least 80%, more preferably at least 90%, most preferably at least 95% sequence identity to X0-X6 of sclerostin.
- a proteinmimic according to the invention is provided, wherein said member is sclerostin, and wherein said proteinmimic consists of the amino acid sequence
- flanking sequences optionally comprising flanking sequences with a length of at most 5 amino acids.
- the flanking sequences have a length of at most 2 amino acids, preferably at most 1 amino acid.
- the proteinmimic does not comprise flanking sequences.
- Noggin-like subfamily are for instance known to inhibit TGF-beta signal transduction by binding to TGF-beta family ligands and preventing them from binding to their corresponding receptors.
- Noggin plays a key role in neural induction by inhibiting BMP4.
- a proteinmimic of a member of the Noggin-like subfamily is thus especially useful for regulating TGF-beta and/or BMP4 activity.
- the invention provides a proteinmimic according to the invention, wherein said member of the cystine-knot growth factor superfamily is a member of the Noggin-like subfamily, and wherein X2 represents an amino acid sequence with a length of 4 to 6 amino acids, X5 represents an amino acid sequence with a length of 1 amino acid, Xl represents an amino acid sequence with a length of 22 amino acids, X3 represents an amino acid sequence with a length of 7 to 9 amino acids, and X4 represents an amino acid sequence with a length of 35 to 98 amino acids.
- a proteinmimic of a member of the Coagulin-like subfamily is for instance especially useful for treating coagulation disorders. Clinical trials have been started for instance with gene-therapy based coagulin B supplementiation for hemophilia B. However, a proteinmimic of a member of the coagulin-like subfamily as provided herewith is suitable for inhibiting coagulin B, for instance to reduce blood-clothing, thereby preventing thrombosis.
- the invention provides a proteinmimic according to the invention, wherein said member of the cystine-knot growth factor superfamily is a member of the Coagulin-like subfamily, and wherein X2 represents an amino acid sequence with a length of 7 amino acids, X5 represents an amino acid sequence with a length of 1 amino acid, Xl represents an amino acid sequence with a length of 38 amino acids, X3 represents an amino acid sequence with a length of 5 amino acids, and X4 represents an amino acid sequence with a length of 29 amino acids.
- Members of the jagged-like subfamily are for instance ligands of the
- Notch family of receptors The Notch signaling pathway plays a crucial role during embryonic pattern formation, controls many conserved cell determination events and defines a fundamental mechanism controlling cell fate. It is involved in lineage cell decisions in a variety of tissues. It plays a role in hematopoiesis, vascular development and angiogenesis, myogenesis, neurogenesis, somitogenesis, in kidney, eye, ear, and tooth development etc. Proteinmimics based on jagged-like members are especially useful for controlling the before mentioned biological processes.
- the invention provides a proteinmimic according to the invention, wherein said member of the cystine-knot growth factor superfamily is a member of the Jagged-like subfamily, and wherein X2 represents an amino acid sequence with a length of 3 amino acids, X5 represents an amino acid sequence with a length of 1 amino acid, Xl represents an amino acid sequence with a length of 32 amino acids, X3 represents an amino acid sequence with a length of 25 amino acids, and X4 represents an amino acid sequence with a length of 26 amino acids.
- Figure 10 depicts non-limiting examples of truncated proteins belonging to several cystine-knot growth factor subfamilies.
- a proteinmimic according to the invention wherein said Xl represents an amino acid sequence with at least 80%, preferably at least 85%, more preferably at least 90%, most preferably at least 95% sequence identity with any one of the sequences identified as a Xl in Figure 10, and/or wherein said X3 represents an amino acid sequence with at least 80%, preferably at least 85%, more preferably at least 90%, most preferably at least 95% sequence identity with any one of the sequences identified as X3 in Figure 10, and/or wherein said X4 represents an amino acid sequence with at least 80%, preferably at least 85%, more preferably at least 90%, most preferably at least 95% sequence identity with any one of the sequences identified as X4 in Figure 10, wherein Xl,
- At least one cysteine in any of the sequences represented by Xl, X2, X3, X4, and X6, is replaced by another amino acid, preferably alanine.
- said Xl represents an amino acid sequence which is identical with any one of the sequences identified as Xl in Figure 10
- X3 represents an amino acid sequence which is identical with any one of the sequences identified as X3 in Figure
- X4 represents an amino acid sequence which is identical with any one of the sequences identified as X4 in Figure 10, wherein Xl, X3 and X4 are taken from a single amino acid sequence of Figure 10.
- a proteinmimic according to the invention wherein said X2 represents an amino acid sequence with at least 80%, preferably at least 85%, more preferably at least 90%, most preferably at least 95% sequence identity with any of the sequences identified as X2 in Figure 10, and/or wherein X5 represents an amino acid sequence which is identical to any of the sequences identified as X5 in Figure 10, wherein X2 and X5 are taken from a single amino acid sequence of Figure 10.
- at least one cysteine in any of the sequences represented by Xl, X2, X3, X4, and X6, is replaced by another amino acid, preferably alanine.
- said X2 represents an amino acid sequence which is identical with a sequence identified as X2 in Figure 10, wherein X2 and X5 are taken from a single amino acid sequence of Figure 10.
- the invention provides a proteinmimic according to the invention, wherein said proteinmimic comprises the motif C1-X1-C2-X2-C3-X3-C4-X4-C5-X5-C6, wherein said sequence has at least 80%, preferably at least 85%, more preferably at least 90%, most preferably at least 95% sequence identity with a sequence selected from sequences 1 to 145 of Figure 10.
- said proteinmimic sequence is identical to a sequence selected from sequences 1 to 145 of Figure 10.
- Such a proteinmimic is especially useful for induction of a cross-reactive, preferably a neutralizing antibody response, because the proteinmimic is identical to a part of the native protein.
- a proteinmimic according to the invention wherein said Cl is linked to C4 through a disulfide bond and/or C2 is linked to C5 through a disulfide bond, and/or C3 is linked to C6 through a disulfide bond.
- Cl is linked to C4 through a disulfide bond and C2 is linked to C5 through a disulfide bond, and C3 is linked to C6 through a disulfide bond.
- an immunogenic composition comprising a proteinmimic according to the invention.
- Said immunogenic composition preferably further comprises a therapeutically acceptable carrier, adjuvant, diluent and/or excipient.
- immunogenic composition is defined herein in its broad sense to refer to any type of biological agent in an administrable form capable of inducing and/or stimulating an immune response in an animal.
- an immunogenic composition according to the invention at least comprises a proteinmimic according to the invention and a pharmaceutically acceptable adjuvant.
- an immunogenic composition according to the invention wherein said proteinmimic is coupled to an immunogenic carrier, preferably diphtheria toxin (DT) and/or keyhole limpet haemocyanin (KLH).
- an immunogenic carrier preferably diphtheria toxin (DT) and/or keyhole limpet haemocyanin (KLH).
- the invention further provides a pharmaceutical composition
- a pharmaceutical composition comprising a proteinmimic according to the invention and a pharmaceutically acceptable carrier, diluent and/or excipient.
- Suitable carriers, diluents, excipients and the like are commonly known in the art of pharmaceutical formulation and may be readily found and applied by the skilled artisan, references for instance Remmington's Pharmaceutical Sciences, Mace Publishing Company, Philadelphia PA, 17th ed. 1985.
- the invention provides a use of a proteinmimic according to the invention for the preparation of a medicament and/or prophylactic agent for the treatment and/or prevention of a disorder associated with a member of the cystine-knot growth factor superfamily.
- the invention thus provides use of a proteinmimic in an immunogenic composition.
- Such immunogenic composition comprising a proteinmimic according to the invention is suitable for inducing an immune reaction in an animal, preferably a human.
- a proteinmimic of the invention is used to induce antibodies, which are preferably able to cross-react with the native protein.
- said antibodies are neutralizing antibodies, i.e. the function and/or activity of the native cystine-knot protein is diminished, inhibited, or at least reduced after binding of the native cystine-knot protein to said neutralizing antibody. It is possible to induce said antibodies in an individual in need thereof, for instance by administering a vaccine comprising a proteinmimic according to the invention to said individual.
- the invention provides a use of a proteinmimic according to the invention, or an immunogenic compound comprising a proteinmimic according to the invention, as a partial or full antagonist of a member of the cystine-knot growth factor superfamily.
- a method for treating or preventing a disorder associated with a member of the cystine-knot growth factor superfamily comprising administering a therapeutically effective amount of a proteinmimic according to the invention to a subject suffering from, or at risk of suffering from, said disorder.
- VEGF vascular endothelial growth factors
- VEGFs act through a family of cognate receptor tyrosine kinases in endothelial cells to stimulate blood-vessel formation. Proteinmimics of, and/or antibodies specific for VEGF are thus especially useful for treating a disorder related to vascularization.
- a disorder related to vascularization is age-related macula degeneration (AMD), which causes rapid and severe visual loss. This loss is due to development of choroidal neovascularisation under the macula. Inhibition of VEGF is therefore especially useful for the treatment and/or prevention of AMD.
- AMD age-related macula degeneration
- Tumors need neovascularization in order to grow.
- AvastinTM a monoclonal antibody
- Bevacizumab Genentech
- FDA Food and Drug Administration
- Bevacizumab was approved in 2004 by the Food and Drug Administration (FDA) for the treatment of colorectal cancer when used with standard chemotherapy.
- FDA Food and Drug Administration
- the FDA approved Bevacizumab for the treatment of lungcancer in combination with standard first line combination therapy.
- Bevacizumab such as the high production costs and the relative large amounts needed for treatment, sometimes low tumor penetration and frequent administration are reduced when a proteinmimic or an immunogenic composition of the invention is used.
- an immunogenic composition comprising a proteinmimic of the invention is administered in a dose of a few mg, preferably 0.1 to 10 mg per subject in order to induce an immune response.
- Such an administration is generally repeated two or three times, in order to induce a proper protective response.
- the invention provides use of a proteinmimic according to the invention for the preparation of a medicament and/or prophylactic agent for the treatment and/or prevention of a tumor related disease and/or age-related macular degeneration (AMD), wherein said member of the cystine-knot growth factor superfamily is a member of the VEGF subfamily or the TGF-beta subfamily.
- AMD age-related macular degeneration
- Another cystine-knot growth factor subfamily, TGF-beta is also related to cancer. In normal cells, TGF-beta, acting through its signaling pathway, stops the cell cycle at the Gl stage to stop proliferation, induce differentiation, or promote apoptosis.
- TGF-beta When a cell is transformed into a cancer cell, parts of the TGF-beta signaling pathway are mutated, and TGF-beta no longer controls the cell. These cancer cells proliferate. The surrounding stromal cells (fibroblasts) also proliferate. Both cells increase their production of TGF-beta.
- This TGF-beta acts on the surrounding stromal cells, immune cells, endothelial and smooth-muscle cells. It causes immunosuppression and angiogenesis, which makes the cancer more invasive.
- - TGF-beta also converts effector T-cells, which normally attack cancer with an inflammatory (immune) reaction, into regulatory (suppressor) T-cells, which turn off the inflammatory reaction.
- TGF-beta for instance with an antogonistic proteinmimic according to the invention and/or an antibody of the invention or functional part and/or functional equivalent thereof of the invention, wherein said member belongs to the TGF-beta subfamily, is thus especially useful for the treatment of cancer.
- a method according to the invention wherein said disorder comprises a tumor-related disease and/or age-related macular degeneration (AMD), and wherein said member of the cystine-knot growth factor superfamily is a member of the VEGF subfamily or the TGF-beta subfamily.
- said tumor-related disease is colorectal cancer or non small cell lung cancer (NSCLC).
- a method according to the invention wherein said disorder comprises a connective tissue disorder, preferably Marfan syndrome.
- Marfan syndrome is carried by a gene called FBNl, which encodes a connective protein called fibrillin- 1.
- FBNl a connective gene that encodes a connective protein called fibrillin- 1.
- FBNl connective protein that forms the structural support for tissues outside the cell
- fibrillin- 1 binds to another protein, TGF-beta. TGF-beta can cause inflammation.
- TGF-beta a proteinmimic of TGF-beta is thus especially useful for treatment of Marfan syndrome.
- neovascularization is especially useful for the treatment of ischemic disease including but not limited to arteriosclerotic occlusion of the lower limbs, angina pectoris/myocardial infarction or cerebral infarction in order to rescue the ischemic tissue by developing collateral circulation.
- said disorder comprises an ischemic disorder, preferably said ischemic disorder is taken from the group consisting of arteriosclerotic occlusion of the lower limbs, angina pectoris, myocardial infarction and cerebral infarction, wherein said member of the cystine-knot growth factor superfamily is a member of the VEGF subfamily.
- NGF neurotrophic factor receptor 1
- NGF neurotrophic factor receptor 1
- NGF-specific antibodies are considered especially useful for the treatment of breast-tumors, as NGF is known to be a strong stimulator of breast cancer cell proliferation.
- a method according to the invention wherein said disorder comprises a disorder selected from the group consisting of a neurodegenerative disorder, preferably Alzheimer disease, a pain disorder, preferably a chronic and/or neuropathic pain disorder, and cancer, preferably breast cancer.
- a method is provided, wherein said member belongs to the NGF subfamily.
- a method for producing antibodies against a member of the cystine-knot growth factor superfamily comprising administering a proteinmimic according to the invention and or an immunogenic composition according to the invention to a non-human animal, and obtaining antibodies against a member of the cystine-knot growth factor superfamily, which antibodies are produced by said animal.
- a proteinmimic according to the invention in an ex vivo method for producing an antibody, or a functional part or functional equivalent of an antibody, which is specifically directed against a member of the cystine-knot growth factor superfamily.
- the skilled artisan is aware of the different methods for producing an antibody ex vivo, such as B-cell hybrodima techniques, antibody phage display technologies and the like.
- a functional part of an antibody is defined herewith as a part which has at least one same property as said antibody in kind, not necessarily in amount. Said functional part is preferably capable of binding the same antigen as said antibody, albeit not necessarily to the same extent.
- a functional part of an antibody preferably comprises a single domain antibody, a single chain antibody, a Fab fragment or a F(ab')2 fragment.
- a functional equivalent of an antibody is defined as an antibody which has been altered such that at least one property - preferably an antigen- binding property - of the resulting compound is essentially the same in kind, not necessarily in amount. An equivalent is provided in many ways, for instance through conservative amino acid substitution, whereby an amino acid residue is substituted by another residue with generally similar properties (size, hydrophobicity, etc), such that the overall functioning is likely not to be seriously affected.
- the glycoprotein hormone subfamily (GLH), a subfamily of the cystine-knot superfamily of growth factors, comprises the hormones: luteinizing hormone, (LH), thyroid stimulating hormone (TSH) and chorionic gonadotropin (CG) and follicle stimulating hormone (FSH). These hormones all comprise an alpha and a beta subunit (GLHA and GLHB, respectively) and they play a role in reproduction in mammals. For instance FSH stimulates testicular and ovarian functions through binding to a G-protein-coupled receptor on either Sertoli (male) or granulose (female) cells.
- a method for treating or preventing a disorder associated with the presence of a member of the cystine-knot growth factor superfamily according to the invention is provided, wherein said disorder is a reproductive disorder.
- a proteinmimic and/or an antibody or functional part or equivalent thereof according to the invention is also especially useful to prevent reproduction, i.e. prevent pregnancy.
- the invention thus provides a method for preventing pregnancy and/or reducing the chance of pregnancy in a female individual, comprising administering to said female or a sexual partner of said female an effective amount of a proteinmimic according to the invention, an immunogenic composition according to the invention, and/or an antibody obtainable by a method according to the invention or a functional part or functional equivalent of said antibody, wherein said member of the cystine-knot growth factor superfamily is a member of the GLHA or GLHB subfamily.
- a proteinmimic according to the invention an immunogenic composition according to the invention, and/or an antibody obtainable by a method according to the invention, or a functional part or functional equivalent thereof, for use as a male and/or female contraceptive.
- a method for binding and/or neutralizing an antibody directed to a member of the cystine-knot growth factor superfamily comprising administering a therapeutically effective amount of a proteinmimic according to any one of claims 1-17 to a subject comprising said antibody. Upon binding of the proteinmimic to said antibody, its activity is diminished.
- Antibodies that are specific for members of the cystine-knot protein are used in treatment protocols. One example thereof is AvastinTM specific for VEGF, which is used to treat metastatic cancer. Antibodies, once administered, have a half- life of several days, even up to several weeks.
- a proteinmimic of the intvention is especially useful to counteract the action of said antibody by binding and/or neutralizing said antibody.
- a proteinmimic of the invention is especially useful because the proteinmimic as such is not or to a lesser extent bioactive and therefore does not interfere with a condition for which the antibody was initially administered. It is of course undesirable to treat a patient receiving for instance antibodies against VEGF with bio-active VEGF to neutralize the antibody. Bio-active VEGF administered in excess of the antibody present would exert its biological effect and would undermine the antibody treatment thus far received.
- AvastinTM is a commercially available monoclonal antibody against VEGF, which is administered for instance to treat metastatic cancers. Treatment with AvastinTM, however, can lead to slow or incomplete wound healing (for example, when a surgical incision has trouble healing or staying closed). In some cases, this event resulted in fatality. It is therefore not recommended to start AvastinTM therapy for at least 28 days after surgery and until the surgical wound is fully healed. Of course, during AvastinTM therapy, surgery should be avoided.
- a truncated VEGF preferably VEGF26 104 is preferably administered to neutralize the circulating anti-VEGF antibodies without inducing much biological effect resembling the action of VEGF itself.
- the patient Shortly after administration of the truncated VEGF and neutralization of the anti-VEGF antibodies, the patient may undergo surgery without the above mentioned severe side effects which are normally observed after surgery during AvastinTM therapy.
- a method for binding and/or neutralizing an antibody directed to a member of the cystine-knot growth factor superfamily comprising administering a therapeutically effective amount of a proteinmimic according to the invention to a subject comprising said antibody is provided, wherein said antibody is AvastinTM and said proteinmimic is VEGF26-104.
- a proteinmimic according to the invention for the manufacture of a medicament for neutralizing an antibody directed to a member of the cystine-knot growth factor superfamily.
- said antibody is AvastinTM and said proteinmimic is VEGF26-104 as explained before.
- sclerostin Another member of the cystine-knot growth factor superfamily, belonging to the TGF-beta subfamily, is sclerostin, the secreted protein product of the SOST gene, which is an osteocyte- derived inhibitor of cultured osteoblasts.
- Sclerostin deficiency leads to sclerosteosis and van Buchem disease, two closely related, rare sclerosing disorders characterized by substantial increase in bone mass of good quality which is due to increased bone formation.
- osteoporosis a disorder in which the density and quality of bone are reduced, leading to weakness of the skeleton and increased risk of fracture, particularly of the spine, wrist, hip, pelvis and upper arm, is possibly caused by an excess production of sclerostin, inhibiting bone formation.
- an agonistic or antagonistic proteinmimic of sclerostin and/or an antibody specific for sclerostin is thus especially useful for treatment of a bone disorder.
- a method according to the invention is provided, wherein said disorder comprises a disorder associated with disturbed bone-regulation.
- said disorder comprises osteoporosis or sclerosteosis.
- FIG. 1 A) Inhibition of AvastinTM-binding to surface-immobilized humVEGFi-i65 (1 ⁇ g/mL; GDA-coupling) in ELISA for varying concentrations (125 ⁇ M to 2 pM) of oxid-humVEGF26-i04 ( ⁇ ), humVEGFi-i65 (A), and a backbone-cyclized peptide covering only the 65-turn-66 loop of humVEGF (humVEGF 74 -98) (x).
- FIG. 7 Inhibition of AvastinTM-binding to surface-immbolized humVEGFi-i65 with non-purified rat immune sera 50.49 and 50.67 at 1/5 and 1/25 dilution.
- Peptide serum 31.1 (elicited against double- constrained CLIPS/SS-peptide derived from the 63-loop sequence humFSHs6-79 of Follicle Stimulating
- Hormone serum has high neutralizing activity for FSH in cell- based assay
- serum 45.09 serum 45.09 (elicited against backbone- cyclized peptide derived from the 65-turn- 66 loop sequence 70- 102 of VEGF; serum has neutralizing activity for humVEGFi. 165 in BaF3-cell proliferation assay) were used as negative controls.
- Minimal concentration of AvastinTM ( ⁇ 10 ng/mL) was used (OD450nm ⁇ 0.4) in order to secure maximal sensitivity for the inhibition experiments.
- Figure 10 Full protein name, species from which the protein was isolated, and amino acid sequence for all proteins known to be part of the cystine-knot growth factor superfamily, subdivided in TGF- beta, GLH-beta, NGF, PDGF, GLHA, Noggin-like, Coagulin- like, and CTCK-like subfamilies. Defined consensus sequences per subfamily are projected on top of the listing of sequences for each member.
- Figure 11 Schematic representation of the general structure of the various members of the cystine-knot growth factor superfamily.
- FIG. 12 A) Increase of average tumor volume (mm3) per mice in treatment group 1:PBS (•), 2:anti-oxid-humVEGF26 i04 ( ⁇ ), and 3:AVASTINTM (V). In the PBS group 4/9 mice were euthanised (#) before the planned day, because the estimated volume of the tumors exceeded the (pre-set) maximum volume. B) Total average tumor weight (mgs) per mice in each different treatment group at the end of the experiment. C) Total tumor volume (mm3) of individual mice in each different treatment group at the end of the experiment (mouse 3 in PBS-group died before the start of the experiment). Figure 13 HPLCs (A/C) and ElectroSpray Ionization Mass Spectra (B/D) of red-ratVEGF 26 -io4 (A/B) and oxid-ratVEGF 26 -io4 (CfO).
- Figure 14 Plots of the binding in ELISA of anti-oxid-humVEGF26 i04 rat- sera 1+2 (black and — lines) and anti-oxid-ratVEGF26 i04 ratsera 3+4 (grey and — lines) to both A) oxid- ratVEGF 26 -io4 and B) oxid-humVEGF 26 -io4.
- FIG. 1 HPLCs (A/C) and ElectroSpray Ionization Mass Spectra (B/D) of red-humPLGF 3 4 ii2 (A/B) and oxid-humPLGF 3 4 ii2 (CfO).
- FIG. 16 Three-fragment condensation of humSOST57-i44 from fragment humSOST-Fl, humSOST-F2, and humSOST-F3 by Native Chemical Ligation.
- Step A Ligation of the thiaproline- protected humSOST-F2 to humSOST-F3, generating protected humSOST-F2/3.
- Step B Deprotection of humSOST-F2/3 with methoxyamine in at pH 4.0.
- Step C Ligation of deprotected humSOST-F2/3 to humSOST-Fl generating humSOST 5 7-i44 at pH 6.5.
- FIG. 17 Oxidative refolding of fully red-humSOSTs7 i44 after ion exchange chromatography.
- the peptide was folded in 0.4 M Arginine, 1.67mM Glutathione (red), 0.33 mM Glutathione (ox), 55 mM Tris-HCl, 21 mM sodium chloride, 0.88 mM potassium chloride, pH 8.0, yielding 10.2% of the desired product after 3.5 days at 4 0 C.
- FIG. 1 HPLCs (AJCfK) and ElectroSpray Ionization Mass Spectra (B/D/F) of fully red-humSOST 5 7-i44 (A/B), oxidatively refolded oxid-humSOST57 i44 (CfO), octa-acetamido derivatized humSOST 5 7-i44 (E/F).
- Figure 19 Binding data in ELISA for antibodies selected biotinylated oxid-humSOST57-i44 from a PDL-library. The positive binding to 1. Recombinant humSOST, 2. biotinylated oxid-humSOSTs7- 144 itself, and the absence of binding to 3. AA8-SOST57-144, 4.
- Bovine Serum Albumin illustrate the high- specificity of the antibody binding.
- FIG. 20 HPLCs (A/C) and ElectroSpray Ionization Mass Spectra (B/D) of red-humTGFB2i5-iii/ ⁇ 49-77-humVEGF 6 2-67 (AJB) and oxid- humTGFB2i5-i ⁇ / ⁇ 49-77-humVEGF 6 2-67 (C/D).
- FIG. 21 (A) Antibody titers in ELISA for 9wpv-ratsera (1 and 2 + pre- immune sera) that were elicited via immunization with oxid- humTGFB2i5-iii/ ⁇ 49-77-humVEGF62-67. Titers were defined as the -101og[conc] at which the OD in ELISA is equal to 4x the background signal.
- humTGFB2trunc 1 acetyl- C IALRPLYIDFKRDLGWKWIHEP KGYNANFC2AGAC3NDEGLEC4VSQDLEPLTILYYIGKTPKI EQLSNMIVKS C5KC6-amide humTGFB2trunc 2: acetyl- C IALRPLYIDFKRDLGWKWIHEP
- EXAMPLE IA Synthesis of various forms of VEGF-truncated.
- humVEGF26-io4
- humVEGF25-io9
- Amino acids are indicated by the single-letter codes; “Ac” refers to N- terminal acetylation; “#” indicates C-terminal amidation; Cysteines (Cl- C6) in boldface indicate cysteines involved in formation of the cystine- knot fold; alanines in boldface indicate native cysteines that were replaced by Ala.
- NCL Native Chemical Ligation
- NCL Native Chemical Ligation
- a coupling protocol using a 5-fold excess of HBTU/HOBt/amino acid/DIPEA (1:1:1:2) in NMP with a 20 minute activation time using double couplings was employed for every amino acid coupling step.
- Acetylation (Ac) of the peptide was performed by reacting the resin with NMP/Ac 2 O/DIEA (10:1:0.1, v/v/v) for 30 min at room temperature.
- acetylated peptide was cleaved from the resin by reaction with TFA (40 mL/mmol resin) containing 13.3% (w) phenol, 5% (v) thioanisole, 2.5% (v) 1,2-ethanedithiol, and 5% (v) milliQ-H 2 0 for 2 hrs at room temperature, unless indicated otherwise.
- TFA 40 mL/mmol resin
- phenol 5%
- thioanisole 2.5%
- 1,2-ethanedithiol 1,2-ethanedithiol
- milliQ-H 2 0 milliQ-H 2 0 for 2 hrs at room temperature, unless indicated otherwise.
- Precipitation with ice-cold Et2 ⁇ + lyophilization of the precipitated material afforded the crude peptide.
- humVEGF26-io4 was synthesized in one step following this procedure (resin-loading 0.88 mmol/g) on a Symphony synthesizer (Pro
- a 4:1 (w/w) mixture of Ac-Cys(Trt)-OH and Fmoc-Cys(Trt)-OH was used.
- the acylated peptide was cleaved from the resin by reaction with a slightly different mixture: TFA (40 mL/mmol resin) containing 5% (v) TES, 2.5% (v) 1,2- ethanedithiol, and 2.5% (v) milliQ-lHbO.
- TFA 40 mL/mmol resin
- humVEGF ⁇ s iiw, humVEGF68 io7, and humVEGF ⁇ s- io9 were also synthesized following this procedure as described above for humVEGF26- 104 on a Rink-Made resin (loading 0.5 mmol/g) using a Liberty- synthesizer (CEM GmbH, Germany).
- the fragment peptides humVEGF25-67 and humVEGF2 ⁇ -67 (free C- terminus) were synthesized on a SASRIN-resin (loading 0.5 mmol/g; Bachem GmbH, Germany) following the general procedure for Fmoc- synthesis of peptides as described in procedure I.
- the peptide were cleaved from the resin by repetitive treatment (20 cycles) with 1% TFA (40 mL/mmol resin) in DCM.
- the combined fractions were neutralized with pyridine, whereafter DCM was removed by evaporation under reduced pressure.
- the peptides were precipitated by addition of excess of H2O, followed by centrifugation and lyophilization.
- Condensation of fragment peptides humVEGF ⁇ s-KM, humVEGF68 io7, or humVEGF68 io9 (A) with either fragment peptide thioesters humVEGF25-67 or humVEGF26-67 (B) by native chemical ligation was performed by mixing almost equimolar (1:1.2) solutions of A (10 mg/mL; ⁇ 2.0 mM) and B (10 mg/mL; -2.0 mM) in working buffer (6M guanHCl/20mM TCEP/200mM MPAA in 0.2M phosphate buffer pH 8.0; ) and overnight stirring at room temperature.
- humVEGF26-io4, humVEGF25-io7, or humVEGF25-io9 in reduced form were purified by RP/HPLC following the standard procedure. Oxidative Folding of red-humVEGF26-io4. red-humVEGF25-io7.
- red-humVEGF25-io9 Fully reduced red-humVEGF26-io4, red-humVEGF25-io7, or red- humVEGF25-io9 were dissolved in 0.1M Tris-buffer (pH 8.0), with or without IM guanidine.HCl, containing 1.0 mM cystine (SS-form) and 8.0 mM cysteine (SH-form) in a final concentration of 0.1 mg/mL and stirred at room temperature. Immediately, a sharp peak appears at a lower retention time (more polar) in addition to some broad peaks that correspond to incomplete or incorrectly folded peptide. When HPLC- analysis showed no further change in peak intensities (usually after ⁇ 4 hours), the mixture was loaded onto a preparative RP/Cis column and purified following our standard procedure (see below). Procedure III;
- Fragment peptides were prepared by manual solid phase peptide synthesis (SPPS) typically on a 0.25 mmol scale using the in situ neutralization/ HBTU activation procedure for Boc chemistry as previously described. Each synthetic cycle consisted of N ⁇ -Boc-removal by a 1-2 min treatment with neat TFA, a 1 min DMF-flow wash, a 10 to 20 min coupling time with 1.0 mmol preactivated Boc-amino acid in the presence of excess DIEA, followed by a second DMF-flow wash.
- SPPS solid phase peptide synthesis
- N ⁇ -Boc amino acids (1.1 mmol) were preactivated for 3 min with 1.0 mmol HBTU (0.5 M in DMF) in the presence of excess DIEA (3 mmol).
- a DCM flow wash was used before and after deprotection using TFA, to prevent possible high temperature (TF A/DMF) -catalyzed pyrrolidonecarboxylic acid formation.
- N ⁇ -acetylation of peptides was performed by treatment with acetic anhydride (0.1 M)/Pyridine (0.1 M) in DMF for 2 x 2 min). After chain assembly was completed, the peptides were deprotected and cleaved from the resin by treatment with anhydrous HF for 1 hr at 0 0 C with 4% p-cresol as a scavenger. In all cases, the imidazole side chain- dinitrophenyl (Dnp) protecting groups remained on His residues because the Dnp-removal procedure is incompatible with C- terminal thioester groups. However, Dnp is gradually removed by thiols during the ligation reaction yielding unprotected His.
- 1.1 mmol N ⁇ -Boc Leu was activated with 1 mmol HBTU in the presence of 3 mmol DIEA and coupled for 10 min to 0.25 mmol MBHA resin.
- 1.1 mmol S-trityl mercaptopropionic acid was activated with 1 mmol HBTU in the presence of 3 mmol DIEA and coupled for 30 min to Leu-MBHA resin.
- the resulting trityl- mercaptopropionic acid-leucine resin can be used as a starting resin for polypeptide chain assembly following removal of the trityl protecting group with 2 x 1 min treatments with 2.5% triisopropylsilane and 2.5% H2O in TFA.
- the thioester bond was formed with the desired amino acid using standard peptide coupling protocols.
- MPAL C-terminal activated mercaptopropionic acid-leucine
- - COSR C-terminal activated mercaptopropionic acid-leucine
- NCL Native Chemical Ligation
- Electrospray ionization mass spectrometry (ESI-MS) of HPLC samples was performed on an API- 150 single quadrupole mass spectrometer (Applied Biosystems). Peptide masses were calculated from the experimental mass to charge (m/z) ratios from all the observed protonation states of a peptide using Analysis software.
- EXAMPLE IB Inhibitory activity of oxid-humVEGF26-io4 in AvastinTM-binding to surface-immobilized oxid-humVEGFi-i65.
- the plates were incubated with the antibody at various different dilutions in horse serum (4% in PBS/l%Tween80/3%NaCl), starting with 1/10 dilution in the first well and 3-fold dilution steps in subsequent wells. Incubation was performed for 1 hour at 37 0 C, followed by washing with l%Tween-80 (3x).
- ELISA binding competition studies were carried out following largely the procedure as described for binding in ELISA (see above). Incubation with antibody was carried out at one fixed antibody- concentration (10 ng/mL of AvastinTM; OU405nm between 1.0-1.5) in the presence of decreasing amounts of oxid-humVEGF26-io4 (start at 5 ⁇ M; 1/5 dilution steps) and humVEGFi-i65 (positive control; start at 500 nM; 1/5 dilution steps).
- oxid-humVEGF 26-104 binds with less than 5-fold difference in affinity (as compared to humVEGF l-i ⁇ s) to AvastinTM, while the (cyclic) peptide -mimic derived from the beta3-loop of humVEGF is >10 000-fold less active in binding to AvastinTM.
- EXAMPLE 1C Use of oxid-humVEGF 2 6-io4 for generating VEGF- neutralizing antibodies and sera in rats and mice.
- Balb/C mice Immunization with oxid-humVEGF26-io4 was performed in female Balb/C mice, using 2 different formulations, i.e. with a CFA/IFA adjuvant (group 1: 2 anmials), and with a CoVaccine adjuvant (group 2: 3 animals).
- PBS Phosphate- Buffered Saline
- CFA Complete Freund's Adjuvance
- Anti-VEGF titers were determined as described as below.
- OD405nm is equal to 4xOD405nm that of a buffer solution (see "ELISA-bindin ⁇ studies, example IB").
- ELISA competition studies of rat antisera with AvastinTM were carried out following largely the procedure as described for binding in ELISA (see above). Incubation with antibody was carried out at a fixed AvastinTM-concentration (10 ng/mL; OD405nm between 1.0-1.5) in the presence of decreasing amounts of rat antisera (start at 1/5; further 1/3 dilution steps).
- the cells which are used in the assay are murine pre-B lymphocytes stable expressing human (h) humVEGF-Receptor 2 (Makinen et al., 2001). These recombinant cells survive/proliferate only in the presence of IL-3 (natural cytokine required for the survival of the parental cells) or humVEGF. For the experiment IL-3 has to be washed off the medium so that proliferation capability in dependence of humVEGF can be tested.
- Ba/F3 R2 cells were grown in DMEM (Gibco #31885) containing 10 % foetal bovine serum (Perbio #CH30160.03), 2 mM L-glutamine (Sigma #G7513), 2 ng/ml mIL-3 (Calbiochem #407631) and 500 ⁇ g/ml Zeocin (Invitrogen #450430). Cells were grown at 37°C in a humidified incubator with an atmosphere of 5% CO2/95% air.
- humVEGF Differently concentrated humVEGF (+ humVEGF) or medium (- humVEGF) was either added directly to the cells (to test the proliferation efficiency) or pre-incubated for 1 hour with different concentrations of AvastinTM (positive control), different concentrations of rat or mouse sera and then added to the cells (in case of inhibition experiments). Two days later cell proliferation was measured by adding WST-I (Roche #1644807). See Figure 9 for a graphical representation of the assay.
- the WST-I assay is based on the measurement of the mitochondrial succinate deshydrogenase activity. To function correctly this enzyme requires the integrity of this organelle and is a good indicator of the number of proliferating cells present in the culture.
- a tetrazolium salt (WST-I) is used as substrate since it generates a soluble dark metabolic (formazon) through the action of the enzyme, which then be quantified by measuring the absorbance (450 nm) in an ELISA reader. The higher is the absorbance measured in the assay, the stronger the proliferation. Absorbance is positively correlated with proliferation. Experiments were repeated three times in triplicate showing overall similar results.
- EXAMPLE ID oxid-humVEGF 2 6-io4 does not induce BaF3-cell proliferating by itself.
- oxid-humVEGF26-i04 the truncated form of humVEGFi-165
- BaF3-cell proliferation we measured cell proliferation in the presence of varying amounts of oxid-humVEGF26- 104 (0.01-20 ng/mL).
- EXAMPLE IE Passive immunization study with anti-humVEGF26- io4 rat-antisera in Swiss nu/nu mice inoculated with human LS174T tumor cells: in vivo proof of principle of the tumor- reducing potential of anti-humVEGF26-io4 antisera.
- mice On day 1 of the study, all 30 mice were injected subcutaneously (right flank) with 10 million human LS174T tumor cells suspended in a 100 ⁇ L solution. Tumor-take was ⁇ 100%. Subsequently, the mice were given on day 1, 8, and 15 i.p. injections (500 ⁇ l) with either A) PBS (group 1), B) anti-oxid-humVEGF26-io4 rat-antiserum (5x cone, rat-serum; group 2), and C) AVASTINTM (group 3).
- Anti-oxid-humVEGF26-io4 ratserum was obtained by immunizing a total number of 20 male Whistar rats in a separate experiment 4x with 250 microgram doses of humVEGF2 ⁇ i04 using CoVaccine adjuvant (inoculations at day 0, 14, 28, and 49; bleed on day 63).
- the resulting ratsera were purified by affinity chromatography (ProtG- column) and concentrated 5x.
- the 10 most potent antisera (based on in-vitro neutralization data in BaF3 assay; see previous Example) of these were pooled and used for inoculation of the 10 mice in treatment- group 2. Lengths and breadths of the tumors were measured every other day, starting on the first day after tumor cell inoculation. Tumor volumes were estimated using the formula (breadth2 x length) /2 (ref 6) . The data are shown in Figure 12.
- anti-oxid-humVEGF26-io4 antisera have the ability to strongly reduce tumor growth in mice. 2. in this experimental setting, the observed effect of treatment with anti-oxid-humVEGF26-io4 antisera was visibly more pronounced than that for AVASTINTM.
- ratVEGF26-io4 Solid-phase synthesis of ratVEGF26-io4.
- ratVEGF26-io4 was synthesized by normal solid-phase synthesis on a Rink-amide resin (downloaded to 0.1 mmol/g) following standard procedures as described for humVEGF26-io4 (see Example 1). Subsequent oxidative refolding was carried out exactly as described for humVEGF26-io4.
- Purification of both red-rat VEGF26-104 and oxid-ratVEGF26-io4 was carried out by preparative High Performance Liquid Chromatography (HPLC). Characterization of both peptides was carried out by analytical HPLC and ElectroSpray Ionization Mass Spectrometry (ESI-MS).
- red-ratVEGF2 ⁇ i04 The successful refolding of red-ratVEGF2 ⁇ i04 was evidenced by the characteristic shift to lower Rf-values (from 48.5% to 41.3% ACN, see Table below), normally observed when proteins or fragments thereof are oxidative refolded.
- the characteristic narrow shape of the new peak at lower Rf-value provides evidence that an intact cystine-knot structure is indeed formed upon oxidative refolding of red-ratVEGF26-io4.
- the ESI-MS spectrum undergoes a significant change upon oxidative refolding. First of all, the overall mass goes down by 6 mass units (formation of 3 disulfide bonds releases a total of 6H). Moreover, there is a very characteristic shift of MS-signals to higher m/z-values.
- red-rat VEGF26-104 gives the most intense signals for the M 9+ and M 10+ charged species, whereas these signals disappear and a much weaker signal at M 5+ remains (see Figure 13) that is much less intense. Also this shift is characteristic for folding of proteins into their oxidized native structure and shows that oxidative refolding of red- ratVEGF26-io4 has been successful. The reason is that the protein or protein fragment adopts a more condensed structure that is no longer able to pick up so many charges. In contrast to this, the flexible and extended structure of the reduced protein is able to accommodate many more charges.
- This example describes the results of an immunization study in male Whistar rats with both oxid-hum-VEGF26-io4 and oxid-ratVEGF26-io4 with an intact cystine-knot fold (oxid-form).
- the data unequivocally show that oxid-ratVEGF26-io4 is equally immunogenic and potent as compared to oxid-humVEGF26-io4 in generating antibodies in rats.
- the use of truncated VEGF as described in this patent can thus be used to bypass immune tolerance to "self proteins", like for example the full-length homodimeric VEGF protein in this particular case.
- a total of 4 Whistar rats (2x2) were immunized on day 0 with 250 microgram each of either oxid-ratVEGF26-io4 (2 rats) or oxid- humVEGF26-i04 (2 rats) using CoVaccine as adjuvant, followed by booster inoculations at day 14, 28, and 42.
- the rats were finally bled at day 56, and the sera were analyzed for antibody titers against ratVEGFi-i ⁇ s, humVEGFi-i65, oxid-ratVEGF26-io4, and oxid-humVEGF26-io4. (Part of) the antibody-binding data are shown in Table 1 and Figure 14.
- oxid-humVEGF26 i04 can be used to elicit anti-VEGF in humans, and that oxid-humVEGF26 i04 will not suffer from lack of immunogenicity as a result of immune tolerance to self proteins.
- Table 1 List of the binding of rat-antisera in ELISA to A) oxid-ratVEGF2 ⁇ -io4, B) oxid-humVEGF26-io4, C) humVEGFi-i ⁇ s homodimer (recombinant full-length humanVEGF), and D) ratVEGFnes homodimer (recombinant full-length ratVEGF).
- the binding data to the humanized anti-humVEGF mAb AVASTINTM are included.
- titer endblood rat 1 (a-oxid-ratVEGF26-104) 3404 3320 3449 2681 1305 548 280 158 4.6 rat 2 (a-oxid-ratVEGF26-104) 3245 3216 3672 2955 1588 955 301 166 4.7 rat 3 (a-oxid-humVEGF26-104) 3456 3406 3334 3078 1776 739 351 176 4.7 rat 4 (a-oxid-humVEGF26-104) 3758 3282 3604 3313 2508 1374 510 235 5.1
- EXAMPLE IG Synthesis of humPLGF 3 4-ii2 (humPLGFtrunc).
- Red-PLGF34-ii2 Solid-phase synthesis of red-PLGF34-ii2.
- Red-PLGF34-ii2 was synthesized by normal solid-phase synthesis on a Rink-amide resin (downloaded to 0.1 mmol/g) following standard procedures as described for red-humVEGF26-io4 (see Example IE). Subsequent oxidative refolding was carried out exactly as described for oxid-humVEGF26-io4.
- red-humPLGF34-ii2 The successful refolding of red-humPLGF34-ii2 was evidenced by the characteristic shift to lower Rf-values (from 49% to 38.3% ACN, see Table below) that is normally observed when proteins or fragments thereof are oxidative refolded.
- the characteristic narrow shape of the new peak at lower Rf-value provides evidence that an intact cystine-knot structure is indeed formed upon oxidative refolding of red-humPLGF34-ii2.
- the ESI-MS spectrum undergoes a significant change upon oxidative refolding. First of all, the overall mass goes down by 6 mass units (formation of 3 disulfide bonds releases a total of 6H). Moreover, there is a very characteristic shift of MS-signals to higher m/z-values.
- red-humPLGF34-ii2 gives clear signals for the M 6+ to M 10+ charged species, whereas these signals disappear and a much weaker signal at M 5+ remains (see Figure 15) that is much less intense. Also this shift is characteristic for folding of proteins into their oxidized native structure and shows that refolding of red-humPLGF34-ii2 was successful. The reason is that the protein or protein fragment adopts a more condensed structure that is no longer able to pick up so many charges. In contrast to this, the flexible and extended structure of the reduced protein is able to accommodate many more charges.
- humSOST-F2 and humSOST-F3 were dissolved (2 mg/ml) in NCL reaction mixture (6 M guanidine, 20 mM TCEP, 200 mM MPAA, 0.2 M disodium hydrogenphosphate, adjusted with 10 M sodium hydroxide to pH 6.5) in a 1.2:1 ratio, and reacted for 24 hours at room temperature.
- the thiaproline-protected humSOST-F2/3 was obtained in 66.5% yield after reversed phase HPLC purification.
- C_ cysteines involved in cystine-knot formation
- C cysteines forming SS-bond between loop-1 and loop-3 of humSOST
- red-humSOST57-i44 was natively refolded by dissolving the peptide (2 mg/ml) in a pH 8.0 buffer solution, containing 55 niM Tris-HCl, 21 niM sodium chloride, 0.88 niM potassium chloride, 0.48 L-arginine, 20 mM Glutathion-SH, and 4 mM Glutathion-SS.
- the peptide was oxidized over time and yielded 10.2% of oxid-humSOST57-i44 after 3.5 days at 4 0 C (see Figure 17).
- the MS- spectrum for the red-humSOST57-i44 gives clear signals for the M 8+ to M 12+ charged species, whereas these signals disappear and a much weaker signal at M 6+ and M 7+ remains (see Figure 18D) that is much less intense. Also this shift is characteristic for folding of proteins into their oxidized native structure and shows that refolding of red-humSOSTs7-i44 was successful. The reason is that the protein or protein fragment adopts a more condensed structure that is no longer able to pick up so many charges. In contrast to this, the flexible and extended structure of the reduced protein is able to accommodate many more charges.
- oxid-humSOST57-i44 adopts a native cystine-knot fold
- oxid-humSOST57-i44 can be used instead of full length humSOST/sclerostin to select antibodies from phage-display libraries (PDLs), that show full selectivity and specificity to full length humSOST/sclerostin with respect to non-related proteins , and that oxid-humSOST57-i44 can therefore be used as an "easy- available" protein mimic of full length humSOST/sclerostin for purposes of antibody generation and selection.
- PDLs phage-display libraries
- X4 VSQDLEPLTILYYIGKTPKIEQLSNMIVKS
- Red-huniTGFB2i5-iii/ ⁇ 49-77-humVEGF62-67 was synthesized by normal solid-phase synthesis on a Rink-amide resin (downloaded to 0.1 mmol/g) following standard procedures as described for humVEGF26-io4 (see Example 1). Subsequent oxidative refolding was carried out exactly as described for humVEGF26-io4. Purification of both red- and oxid- humTGFB2i5-iii/ ⁇ 49-77-humVEGF62-67 was carried out by preparative High Performance Liquid Chromatography (HPLC). Characterization of both the red- and oxid-humTGFB2i5-iii/ ⁇ 49-77-humVEGF62-67 was carried out by analytical HPLC and ElectroSpray Ionization Mass Spectrometry (ESI-MS).
- HPLC High Performance Liquid Chromatography
- the MS-spectrum for the red-humTGFB2i5-in/ ⁇ 49-77- humVEGF62-67 gives clear signals for the M 6+ to M 11+ charged species, whereas these signals completely disappear and a much weaker signal at M 5+ remains (see Figure 20) that is much less intense. Also this shift is characteristic for folding of proteins into their oxidized native structure and shows that refolding of humTGFB2i5-iii/ ⁇ 49-77-humVEGF62-67 was successful. The reason is that the protein or protein fragment adopts a more condensed structure that is no longer able to pick up so many charges. In contrast to this, the flexible and extended structure of red humTGFB2i5-iii/ ⁇ 49-77-humVEGF62-67 is able to accommodate many more charges.
- oxid-humTGFB2i5-iii/ ⁇ 49-77-humVEGF62-67 can be used to generate anti-TGF-B2 antibodies via immunization
- immunization experiment in 2 rats.
- Each animal received 4 inoculations (0, 2, 4, and 7.5 wks) with 2x450 + 2x130 microgram of oxid- humTGFB2i5-m/ ⁇ 49-77-humVEGF62-67.
- oxid-humTGFB2i5-iii/ ⁇ 49-77-humVEGF62-67 can be used as a substitute for TGF-B2 for eliciting anti-humTGFB2 antibodies that are fully crossreactive with the native protein humTGF- B2.
- Bork P "The modular architecture of a new family of growth regulators related to connective tissue growth factor” FEBS 1993, 327, 125-130
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Toxicology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Urology & Nephrology (AREA)
- Reproductive Health (AREA)
- Endocrinology (AREA)
- Gynecology & Obstetrics (AREA)
- Ophthalmology & Optometry (AREA)
- Heart & Thoracic Surgery (AREA)
- Vascular Medicine (AREA)
- Cardiology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP10705010.6A EP2393832B1 (en) | 2009-02-06 | 2010-02-05 | Truncated cystine-knot proteins |
| CA2751445A CA2751445C (en) | 2009-02-06 | 2010-02-05 | Truncated cystine-knot proteins |
| NZ594481A NZ594481A (en) | 2009-02-06 | 2010-02-05 | Truncated cystine-knot proteins |
| AU2010211438A AU2010211438B2 (en) | 2009-02-06 | 2010-02-05 | Truncated cystine-knot proteins |
| JP2011549107A JP2012517425A (ja) | 2009-02-06 | 2010-02-05 | 切断型シスチンノットタンパク質 |
| US13/138,372 US8772236B2 (en) | 2009-02-06 | 2010-02-05 | Truncated cystine-knot proteins |
| ES10705010.6T ES2545614T3 (es) | 2009-02-06 | 2010-02-05 | Proteínas truncadas con nudo de cistina |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP09152305 | 2009-02-06 | ||
| EP09152305.0 | 2009-02-06 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010090523A1 true WO2010090523A1 (en) | 2010-08-12 |
Family
ID=40834444
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/NL2010/050053 Ceased WO2010090523A1 (en) | 2009-02-06 | 2010-02-05 | Truncated cystine-knot proteins |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US8772236B2 (https=) |
| EP (1) | EP2393832B1 (https=) |
| JP (2) | JP2012517425A (https=) |
| AU (1) | AU2010211438B2 (https=) |
| CA (1) | CA2751445C (https=) |
| ES (1) | ES2545614T3 (https=) |
| NZ (1) | NZ594481A (https=) |
| WO (1) | WO2010090523A1 (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2550006A4 (en) * | 2010-03-24 | 2013-11-27 | Lifenet Health | BMP-4 PEPTIDES AND METHOD OF USE THEREOF |
| JP2014512369A (ja) * | 2011-04-11 | 2014-05-22 | イーライ リリー アンド カンパニー | ヒトgdnfの変異体 |
| US8772236B2 (en) | 2009-02-06 | 2014-07-08 | Pepscan Systems B.V. | Truncated cystine-knot proteins |
| US20150064163A1 (en) * | 2011-09-02 | 2015-03-05 | Lifenet Health | BMP Peptides & Methods of Use |
| US11078248B2 (en) | 2010-03-19 | 2021-08-03 | Lifenet Health | BMP peptides and methods of use |
| WO2021129898A3 (es) * | 2019-12-24 | 2022-03-24 | Centro De Ingenieria Genetica Y Biotecnologia | Polipéptidos que comprenden mutantes del vegf-a humano con re-arreglos de puentes disulfuro y composiciones que los contienen |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105085652B (zh) * | 2014-05-16 | 2021-06-22 | 中国人民解放军军事医学科学院生物工程研究所 | 血小板衍生生长因子b突变体、其制备方法及用途 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1991005565A1 (en) * | 1989-10-18 | 1991-05-02 | Creative Biomolecules, Inc. | BIOSYNTHETIC CONSTRUCTS OF TGF-$g(b) |
| WO2000020449A2 (en) * | 1998-10-07 | 2000-04-13 | Stryker Corporation | MODIFIED TGF-β SUPERFAMILY PROTEINS |
| WO2000027879A1 (en) * | 1998-11-10 | 2000-05-18 | Ludwig Institute For Cancer Research | Platelet-derived growth factor d, dna coding therefor, and uses thereof |
| WO2000037025A2 (en) * | 1998-12-21 | 2000-06-29 | Ludwig Institute For Cancer Research | Antibodies to truncated vegf-d and uses thereof |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7105481B2 (en) * | 1998-11-10 | 2006-09-12 | Ludwig Institute For Cancer Research | Method for stimulating connective tissue growth or wound healing |
| US20040009535A1 (en) * | 1998-11-27 | 2004-01-15 | Celltech R&D, Inc. | Compositions and methods for increasing bone mineralization |
| EP1125905A1 (en) | 2000-02-16 | 2001-08-22 | Pepscan Systems B.V. | Segment synthesis |
| EP1197755A1 (en) | 2000-10-11 | 2002-04-17 | Pepscan Systems B.V. | Identification of protein binding sites |
| EP1452868A2 (en) | 2003-02-27 | 2004-09-01 | Pepscan Systems B.V. | Method for selecting a candidate drug compound |
| US20080119396A1 (en) * | 2004-05-27 | 2008-05-22 | Acceleron Pharma Inc. | Tgf Derepressors and Uses Related Thereto |
| CA2659225A1 (en) | 2006-07-26 | 2008-01-31 | Pepscan Systems B.V. | Immunogenic compounds and protein mimics |
| GB0710457D0 (en) * | 2007-05-31 | 2007-07-11 | Ark Therapeutics Ltd | Vegf Mutants |
| CA2751445C (en) | 2009-02-06 | 2018-06-19 | Pepscan Systems B.V. | Truncated cystine-knot proteins |
-
2010
- 2010-02-05 CA CA2751445A patent/CA2751445C/en not_active Expired - Fee Related
- 2010-02-05 NZ NZ594481A patent/NZ594481A/xx not_active IP Right Cessation
- 2010-02-05 US US13/138,372 patent/US8772236B2/en not_active Expired - Fee Related
- 2010-02-05 AU AU2010211438A patent/AU2010211438B2/en not_active Ceased
- 2010-02-05 WO PCT/NL2010/050053 patent/WO2010090523A1/en not_active Ceased
- 2010-02-05 EP EP10705010.6A patent/EP2393832B1/en active Active
- 2010-02-05 JP JP2011549107A patent/JP2012517425A/ja active Pending
- 2010-02-05 ES ES10705010.6T patent/ES2545614T3/es active Active
-
2015
- 2015-07-30 JP JP2015150998A patent/JP6215879B2/ja not_active Expired - Fee Related
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1991005565A1 (en) * | 1989-10-18 | 1991-05-02 | Creative Biomolecules, Inc. | BIOSYNTHETIC CONSTRUCTS OF TGF-$g(b) |
| WO2000020449A2 (en) * | 1998-10-07 | 2000-04-13 | Stryker Corporation | MODIFIED TGF-β SUPERFAMILY PROTEINS |
| WO2000027879A1 (en) * | 1998-11-10 | 2000-05-18 | Ludwig Institute For Cancer Research | Platelet-derived growth factor d, dna coding therefor, and uses thereof |
| WO2000037025A2 (en) * | 1998-12-21 | 2000-06-29 | Ludwig Institute For Cancer Research | Antibodies to truncated vegf-d and uses thereof |
Non-Patent Citations (4)
| Title |
|---|
| A WILCZYNSKI ET AL.: "Structural characterization and pharmacology of a potent (Cys101-Cys119, Cys110-Cys117) bycyclic agouti-related protein (AGRP) melanocortin receptor antagonist", JOURNAL OF MEDICINAL CHEMISTRY., vol. 47, no. 23, 2004, AMERICAN CHEMICAL SOCIETY., pages 5662 - 5673, XP002536740 * |
| DATABASE CA [online] CHEMICAL ABSTRACTS SERVICE, COLUMBUS, OHIO, US; 1995, HUA, CHENGGE ET AL: "The combination of VEGF-C expressing vector and the detection of expression in Tca8113 cell", XP002536741, retrieved from STN Database accession no. 144:405137 * |
| S L BELL ET AL.: "N-linked oligosaccharides play a role in disulphide-dependent dimerization of intestinal mucin Muc2", BIOCHEMICAL JOURNAL., vol. 373, 2003, THE BIOCHEMICAL SOCIETY, pages 893 - 900, XP002536739 * |
| SICHUAN DAXUE XUEBAO, YIXUEBAN , 36(1), 1-4 CODEN: SDXYAY; ISSN: 1672-173X, 2005 * |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8772236B2 (en) | 2009-02-06 | 2014-07-08 | Pepscan Systems B.V. | Truncated cystine-knot proteins |
| US11078248B2 (en) | 2010-03-19 | 2021-08-03 | Lifenet Health | BMP peptides and methods of use |
| EP2550006A4 (en) * | 2010-03-24 | 2013-11-27 | Lifenet Health | BMP-4 PEPTIDES AND METHOD OF USE THEREOF |
| US9951112B2 (en) | 2010-03-24 | 2018-04-24 | Lifenet Health | BMP-4 peptides and methods of use |
| JP2014512369A (ja) * | 2011-04-11 | 2014-05-22 | イーライ リリー アンド カンパニー | ヒトgdnfの変異体 |
| US20150064163A1 (en) * | 2011-09-02 | 2015-03-05 | Lifenet Health | BMP Peptides & Methods of Use |
| US10106591B2 (en) | 2011-09-02 | 2018-10-23 | Lifenet Health | BMP peptides and methods of use |
| WO2021129898A3 (es) * | 2019-12-24 | 2022-03-24 | Centro De Ingenieria Genetica Y Biotecnologia | Polipéptidos que comprenden mutantes del vegf-a humano con re-arreglos de puentes disulfuro y composiciones que los contienen |
| CN115135338A (zh) * | 2019-12-24 | 2022-09-30 | 遗传工程与生物技术中心 | 包含具有二硫桥重排的人vegf-a突变体的多肽以及包含其的组合物 |
Also Published As
| Publication number | Publication date |
|---|---|
| US8772236B2 (en) | 2014-07-08 |
| JP2015193662A (ja) | 2015-11-05 |
| CA2751445A1 (en) | 2010-08-12 |
| US20120231000A1 (en) | 2012-09-13 |
| CA2751445C (en) | 2018-06-19 |
| EP2393832B1 (en) | 2015-07-08 |
| NZ594481A (en) | 2012-09-28 |
| AU2010211438B2 (en) | 2016-04-14 |
| JP6215879B2 (ja) | 2017-10-18 |
| AU2010211438A1 (en) | 2011-09-01 |
| JP2012517425A (ja) | 2012-08-02 |
| ES2545614T3 (es) | 2015-09-14 |
| EP2393832A1 (en) | 2011-12-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP6215879B2 (ja) | 切断型シスチンノットタンパク質 | |
| JP2008534628A (ja) | ペプチド誘導体の製造のための方法 | |
| WO2021068550A1 (en) | Active polypeptide compound | |
| NO311362B1 (no) | Analogifremgangsmåte for fremstilling av terapeutisk aktive polypeptider | |
| CN106164088A (zh) | 长效肾上腺髓质素衍生物 | |
| TW202116350A (zh) | Kv1.3阻斷劑 | |
| CA2757874C (en) | Short-chain peptides as parathyroid hormone (pth) receptor agonist | |
| US5182261A (en) | Modified transforming growth factor alpha oligopeptides and pharmaceutical compositions thereof | |
| JP2012517425A5 (https=) | ||
| TWI796339B (zh) | 一種肽類化合物、其應用及含其的組合物 | |
| DK162130B (da) | Grf-analoge peptider, fremgangsmaade til fremstilling deraf, grf-analoge peptider som terapeutiske midler, anvendelse af grf-analoge peptider, fremgangsmaade til fremstilling af farmaceutiske praeparater indeholdende grf-analoge peptider samt parenterale farmaceutiske praeparater indeholdende grf-analoge peptider | |
| CN114751962A (zh) | 订书肽、其制备方法及其制药用途 | |
| KR20230160321A (ko) | 면역조정제 | |
| JP2022161922A (ja) | 創傷治癒ペプチド | |
| TAM et al. | Mapping the receptor‐recognition site of human transforming growth factor‐α | |
| JP2005531527A (ja) | Vegfペプチドおよびその使用 | |
| JP2010150253A (ja) | 肝癌を治療するための薬剤 | |
| SK130094A3 (en) | Linear peptides, method of their production, pharmaceutical preparation on their base and method of their production | |
| EA047394B1 (ru) | Агонисты рецептора npy2 | |
| JPH07278191A (ja) | 新規ペプチドもしくは蛋白質及びそれを探索する方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10705010 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2751445 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011549107 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010211438 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 594481 Country of ref document: NZ |
|
| ENP | Entry into the national phase |
Ref document number: 2010211438 Country of ref document: AU Date of ref document: 20100205 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010705010 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13138372 Country of ref document: US |