WO2007138538A2 - Probiotic strain and antimicrobial peptide derived therefrom - Google Patents
Probiotic strain and antimicrobial peptide derived therefrom Download PDFInfo
- Publication number
- WO2007138538A2 WO2007138538A2 PCT/IB2007/051982 IB2007051982W WO2007138538A2 WO 2007138538 A2 WO2007138538 A2 WO 2007138538A2 IB 2007051982 W IB2007051982 W IB 2007051982W WO 2007138538 A2 WO2007138538 A2 WO 2007138538A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- peptide
- st4sa
- strain
- seq
- concentration
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/20—Bacteria; Culture media therefor
- C12N1/205—Bacterial isolates
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N63/00—Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
- A01N63/50—Isolated enzymes; Isolated proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
- A61K35/741—Probiotics
- A61K35/744—Lactic acid bacteria, e.g. enterococci, pediococci, lactococci, streptococci or leuconostocs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/02—Local antiseptics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/20—Bacteria; Culture media therefor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
- C12R2001/46—Streptococcus ; Enterococcus; Lactococcus
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- THIS INVENTION relates to a peptide obtained from a strain of
- the invention relates to a peptide obtained from a strain of Enterococcus mundtii, the gene coding for the peptide and various applications of the strain which produces the peptide and the peptide itseif.
- Lactic acid bacteria play an important role in maintaining the balance of normal gastro-intestinal microflora. Diet, stress, microbial infection and intestinal diseases disturb the microbial balance, which often leads to a decrease in the number of viable lactic acid bacteria (especially lactobacilli and bifidobacteria) in the intestinal tract. The subsequent uncontrolled proliferation of pathogenic bacteria then leads to diarrhoea and other clinical disorders such as cancer, inflammatory disease and ulcerative colitis.
- probiotic lactic acid bacteria One of the key properties of probiotic lactic acid bacteria is the adhesion of celis to epithelial cells or intestinal mucus. This requires strong interaction between receptor molecules on epithelial cells and bacterial surfaces. Adhesion of probiotic cells prevent the adhesion of pathogens and stimulate the immune system. The latter is achieved by interacting with mucosal membranes, which in turn sensitises the lymphoids. Another important characteristic of probiotics is survival at low pH and high bile salts.
- bacteriocins active against Gram-negative bacteria
- bacteriocins are produced by lactic acid bacteria normally present in the intestinal tract, viz. the Lactobacillus acidophilus-group, Lactobacillus reuteri, Lactobacillus easel, Lactobacillus fermentum, Lactobacillus plantarum, Lactobacillus pentosus, Lactobacillus paracasei subsp. paracasei and Enterococcus faecalis.
- the invention describes a strain of Enterococcus mundtii that resists intestinal stress conditions (e.g. low pH, bile salts, salts, pancreatic enzymes) and produces a broad-spectrum antibacterial peptide (peptide ST4SA).
- intestinal stress conditions e.g. low pH, bile salts, salts, pancreatic enzymes
- peptide ST4SA broad-spectrum antibacterial peptide
- an isolated peptide from the bacterium Enterococcus mundtii having the following amino acid sequence:
- MSQWGGKYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWKS SEQ. ID. NO. 12
- a fragment thereof having antimicrobial activity muteins and derivatives thereof having antimicrobial activity; covalently bound bridge constructs thereof having antimicrobial activity; or sequences having more than about 95% homology, preferably more than 85% homology, most preferably more than about 75% homology to said amino acid sequence, having antimicrobial activity.
- an isolated nucleotide sequence which codes for peptide ST4SA of the bacterium Enterococcus mundtii.
- the isolated nucleotide sequence may comprise the following nucleotide sequence:
- ATGTCACAAGTAGTAGGTGGAAAATACTACGGTAATGGAGTCTCATGTAA TAAAAAAGGGTGCAGTGTTGATTGGGGAAAAGCTATTGGCATTATTGGAAATAA TTCTGCTGCGAATTTAGCTACTGGTGGAGCAGCTGGTTGGAAAAGT SEQ. ID. NO. 11
- the complement thereof a fragment thereof capable of producing, following expression thereof, a peptide having antimicrobial activity; or nucleotide sequences which hybridize under strict hybridization conditions thereto.
- Strict hybridization conditions correspond to a wash of 2 x SSC, 0.1 % SDS, at 50 0 C.
- the nucleotide sequence may be included in a vector, such as an expression vector or transfer vector in the form of a plasm id.
- the vector may include nucleic acid sequences encoding selection attributes, such as antibiotic resistance selection attributes, or other marker genes. Accordingly, the invention extends to a recombinant piasmid adapted for transformation of a microbial host cell, said plasm id comprising a piasmid vector into which a nucleotide sequence which codes for the antimicrobial peptide of the invention has been inserted.
- the ceil may be a prokaryotic or a eukaryotic cell, such as a bacterial ceil or yeast cell.
- the nucleotide sequence may be incorporated transiently or constitutively into the genome of the cell. Accordingly, the invention extends to a transformed microbial cell which includes a recombinant piasmid, said piasmid comprising a piasmid vector into which a nucleotide sequence which codes for the antimicrobial peptide of the invention has been inserted.
- an isolated peptide from the bacterium Enterococcus mundtii the peptide having antimicrobial activity.
- strain ST4SA The specific strain of the bacterium Enterococcus mundtii that produces the isolated peptide identified above has been designated as strain ST4SA. Accordingly, the invention extends to a substantially pure culture of Enterococcus mundtii strain
- ST4SA deposited with the ATCC under the assigned number PTA-7278, said culture capable of producing peptide ST4SA in a recoverable quantity upon fermentation in a nutrient medium containing assimilable sources of carbon, nitrogen, and inorganic substances.
- Another aspect of the invention relates to a process for the production of a peptide of the invention which comprises cultivating Enterococcus mundtii strain ST4SA in a nutrient medium under micro-aerophilic conditions at a temperature of between
- the cultivation occurs at a temperature of about 37°C.
- the nutrient medium may be selected from any one or more of the group including: corn steep liquor; cheese whey powder; MRS broth; yeast extract; and molasses.
- the nutrient medium is MRS broth at pH 6 to 6.5.
- the isolated peptide of the invention may be used as an antimicrobial agent in a liquid formulation or a gel formulation as a topical treatment for, for example, ear infections, such as mid-ear infections, and also throat, eye, or skin infections.
- the liquid formulation may also be for use as a liquid suppiement to meals.
- the peptide may also further be used as an antimicrobial agent in a spray for treatment of, for example, sinus infections, sinusitis, tonsillitis, throat infections or rhinitis.
- the peptide may also be in the form of a lyophilized powder.
- the isolated peptide may also be used as an antimicrobial agent foliowing encapsulation in a polymer.
- the invention extends, according to another aspect thereof, to a polymer having incorporated therein an antimicrobial amount of peptide ST4SA.
- This polymer may then be used in a formulation for topical treatment of infections such as, for example, skin infections, or may be used for incorporation in implants or medical devices such as, for example, ear grommets, catheters, ostomy tubes and pouches, stents, suture material, hygiene products such as feminine hygiene products, contact lenses, contact lens solution, or for incorporation in wound dressings.
- the encapsulation of the antimicrobial peptide in the polymer leads to a slow release of the antimicrobial peptide and an extended period of treatment of a microbial infection.
- the isolated peptide may be included in a concentration of 100 000 AU/ml (Arbitrary Units) to 300 000 AU/ml of polymer, preferably about 200 000 AU/ml of polymer.
- the peptide further may be used as an antimicrobial agent by being incorporated into ointment, lotion, or cream formulations. These ointment, lotion, or cream formulations may be used to treat infections.
- the peptide may also further be used as an antimicrobial agent by being incorporated into liquid formulations such as, for example, contact lens rinsing fluid, or it may be incorporated into the contact lenses themselves. Accordingly, the invention provides, as another aspect thereof, an antimicrobial ointment, lotion, or cream containing an antimicrobial peptide of the invention.
- the peptide may be used as an antimicrobial agent by being incorporated into packaging material such as, for example, plastic, for use in the manufacture of aseptic packaging.
- the peptide may be used as part of a broad-spectrum probiotic of the bacterium Enterococcus mundtii in a tablet form or in a capsule form or it may be in an edible form such as, for example, a sweet or chewing gum.
- a probiotic composition including a biologically pure culture comprising a therapeutically effective concentration of Enterococcus mundtii strain ST4SA.
- the strain may be included in a concentration of about 10 6 to 10 9 , preferably about 10 8 viable cells (cfu) per ml of probiotic composition.
- the probiotic composition may be used to reduce pathogenic bacteria in an animal or a human.
- the probiotic composition may be used to reduce pathogenic viruses in an animal or a human.
- the probiotic composition may be in the form of a powder, a liquid, a gel, a tablet, or may be incorporated into a foodstuff.
- the probiotic composition in a liquid form may be used as a liquid supplement to meals.
- the strain may be included in a concentration of about 10 6 to 10 9 , preferably about 10 s viable cells (cfu) per ml of liquid supplement.
- the probiotic composition may be administered to an animal or human at a final concentration of between 10 3 and 10 6 cfu/ml, preferably between 10 5 and 10 6 cfu/ml, most preferably about 3x 10 5 cfu/ml.
- a method of treating a bacterial infection condition in an animal or human including the step of exposing an infected area of the animal or human to a substance or composition selected from the group comprising any one or more of: a pharmaceutically effective amount of the Enterococcus mundtii strain of the invention; and a pharmaceutically effective amount of the antimicrobial peptide of the invention.
- the invention extends also to use of a therapeutically effective amount of the Enterococcus mundtii strain of the invention in the manufacture of a medicament for use in a method of treating a bacteria! infection in an anima! or human.
- the method may include the step of exposing bacterial species to the antimicrobial peptide of the invention at a concentration of 100 000 to 300 000 AU/ml, preferably about 200 000 AU/ml.
- the invention extends also to use of a therapeutically effective amount of the antimicrobial peptide of the invention in the manufacture of a medicament for use in a method of treating a bacterial infection in an animal or human.
- the invention further provides a substance or composition for use in a method of treating a bacterial infection in an animal or human, said substance or composition comprising the Enterococcus mundtii strain of the invention, and said method comprising administering a therapeutically effective amount of the substance or composition to the animal or human.
- the invention further provides a substance or composition for use in a method of treating a bacterial infection in an animal or human, said substance or composition comprising the antimicrobial peptide of the invention, and said method comprising administering a therapeutically effective amount of the substance or composition to the animal or human.
- the bacterial infection may be an infection caused by any one or more of: Acinetobacter baumanii; Bacillus cereus; Clostridium tyrobutyricum; Enterobacter cloacae; Escherichia coli; Klebsiella pneumoniae; Listeria innocua; Pseudomonas aruginosa; Staphylococcus aureus; Staphylococcus camosus; Streptococcus cap ⁇ nus;
- Streptococcus Enterococcus faecalis; or Streptococcus pneumoniae.
- a method of inhibiting growth of bacterial species including the step of exposing bacteria! species to an effective amount of the antimicrobial peptide of the invention.
- the bacterial species may be seiected from the group including:
- Acinetobacter baumanii Bacillus cereus; Clostridium tyrobutyricum;
- Enterobacter cloacae Enterobacter cloacae; Escherichia coli; Klebsiella pneumoniae; Listeria innocua;
- Streptococcus pneumoniae Pseudomonas aruginosa; Staphylococcus aureus; Staphylococcus carnosus; Streptococcus caprinus; Streptococcus (Enterococcus) faecalis; and Streptococcus pneumoniae.
- the method may include the step of exposing bacterial species to the antimicrobial peptide of the invention at a concentration of 100 000 to 300 000 AU/ml, preferably about 200 000 AU/ml.
- an isolated transporter peptide from the bacterium Enterococcus mundtii said peptide having the amino acid sequence of SEQ. ID. NO. 14: a fragment thereof; muteins and derivatives thereof; or sequences having more than about 90% homology, preferably more than
- an isolated nucleotide sequence which codes for ST4SA transporter peptide of the bacterium Enterococcus mundtii.
- the isolated nucleotide sequence may comprise the nucleotide sequence of SEQ. ID. NO. 13; the complement thereof; a fragment thereof; or nucleotide sequences which hybridize under strict hybridization conditions thereto.
- an isolated immunity peptide from the bacterium Enterococcus mundtii said peptide having the amino acid sequence of SEQ. ID. NO. 16: a fragment thereof; muteins and derivatives thereof; or sequences having more than about 90% homology, preferably more than 80% homology, most preferably more than about 70% homology to said amino acid sequence, having antimicrobial activity.
- an isolated nucleotide sequence which codes for ST4SA immunity/adhesion peptide of the bacterium Enterococcus mundtii.
- the isolated nucleotide sequence may comprise the nucleotide sequence of SEQ. ID. NO. 15; the complement thereof; a fragment thereof; or nucleotide sequences which hybridize under strict hybridization conditions thereto.
- the invention extends, according to another aspect thereof, to a primer selected from the group consisting of SEQ. ID. NO. 1 to SEQ. ID. NO. 10. Accordingly, the invention extends also to a primer pair selected from the following group: primer pair comprising SEQ. ID. NO. 1 and SEQ. ID. NO. 2; primer pair comprising SEQ. ID. NO. 3 and SEQ. ID. NO. 4; primer pair comprising SEQ. ID. NO. 5 and SEQ. ID. NO. 6; primer pair comprising SEQ. ID. NO. 7 and SEQ. ID. NO. 8; and primer pair comprising SEQ. ID. NO. 9 and SEQ. ID. NO. 10.
- the invention extends also to the use of the primer pair of SEQ. ID. NO. 1 and SEQ. ID. NO. 2 in the identification of Enterococcus mundtii.
- Figure 1 is an image of cell morphology of Enterococcus mundtii strain ST4SA as observed by SEM (scanning electron microscopy);
- Figure 2 is a photograph of an agarose gel showing a PCR product (DNA fragment) obtained by using genus-specific primers, A genus-specific DNA band of 112 kb, specific for Enterococcus, was obtained;
- Figure 3 is a photograph of an agarose gel showing a PCR product (DNA fragment) obtained by using species-specific primers. A species-specific DNA band of 306 bp, specific for Enterococcus mundtii, was obtained;
- Figure 4 is a graphic representation of peptide ST4SA separated by gel filtration (AKTA-purifier);
- Figure 5 is a photograph of a SDS-polyacrylamide gel showing the position of peptide ST4SA
- Figure 6A is a photograph of an agarose gel showing the plasmid profile of E. mundtii ST4SA
- Figure 6B is a Southern blot showing the iocation of the structural gene on the chromosome (genome) of strain ST4SA;
- Figure 7 is a diagrammatic representation of the amino acid sequence of E. mundtii peptide ST4SA;
- Figure 8 is a DNA sequence of the peptide ST4SA structural gene (A), transporter gene (B) and immunity gene (C);
- Figures 9A and 9B show the influence of growth medium components on peptide ST4 production
- Figure 10 is a graphic presentation of the production of peptide ST4SA in MRS broth
- Figure 11 is a photograph of an agarose gel showing a DNA fragment which may contain the putative adhesion gene
- Figure 12 is a graph showing the stability of peptide ST4SA (crude extract suspended in sterile distilled water) at different temperatures;
- Figure 13 is a photograph of inhibition zones recorded against Pseudomonas sp. on an agar plate
- Figure 14 is a photograph of Streptococcus pneumoniae treated with peptide ST4SA (409 600 AU/m!) and leakage of the cytoplasm is indicated by the arrows;
- Figure 15 is a graph showing the growth inhibition of Streptococcus pneumoniae (pathogen 27);
- Figure 16 is a graph showing the growth inhibition of Streptococcus pneumoniae (pathogen 29);
- Figure 17 is a graph showing the growth inhibition of Klebsiella pneumoniae (pathogen 30);
- Figure 18 is a graph showing the growth inhibition of middle ear isolate
- Figure 19 is a graph showing the growth inhibition of middle ear isolate (pathogen BW).
- Figure 20 is a graph showing the growth inhibition of middle ear isolate (pathogen E);
- Figure 22 is a graph showing the growth inhibition of middle ear isolate (pathogen GW).
- Figure 23 is a graph showing growth inhibition of middle ear isolate (pathogen HW);
- production of peptide ST4SA;
- Figure 25 is a schematic presentation of a gastro-intestinal model (GIM) developed for evaluation of probiotic strain ST4SA;
- Figure 26 is a schematic presentation showing blocking of the Lipid Il target site with vancomycin and its affect on the mode of action (antimicrobial activity) of peptide ST4SA.
- % Leakage refers to cytoplasmic leakage, as recorded by increased DNA and ⁇ -galactosidase activity levels.
- Figure 27 is a schematic representation of a disulfide bridge that was introduced into the peptide that covalently linked amino acids 9 (cysteine) and 14 (cysteine);
- Figure 28 shows a hydrophobicity plot of ST4SA
- Figure 29 shows the results of L monocytogenes challenge with ST4SA and survival in an in vitro G!T mode!;
- Figure 30 shows growth curves of E. mundtii ST4SA in MRS broth and CSL media;
- Figure 31 shows hemolysin and eosin stained sections of (A) Control Colon (B)
- Figure 32 shows a graph representing the daily weight measurements of each experimental group of rats.
- the arrow indicates the time of Listeria infection
- Figure 33 shows a graph representing daily measurements of feed intake of rats
- Figure 34 shows a graph representing the daily measurement of water consumed by each experimental group of rats
- Figure 35 shows a graph representing the faecai moisture content of each experimental groups of rats to which strain ST4, strain 423 and water controls had been administered.
- Figure 36 shows Listeria counts in faecal samples collected 1 day pre-infection and 2 days post-infection from each experimental group of rats.
- Table 1 shows phenotypic characteristics of strain ST4SA (sugar fermentation reactions).
- Table 2 shows differential characteristics of strain ST4SA
- Table 3 shows the effect of enzymes, temperature, pH and detergents on peptide ST4SA;
- Table 4 shows an activity spectrum of peptide ST4SA;
- Table 5 shows activity of peptide ST4SA on paper disks;
- Table 6 shows the comparison of the activity of peptide ST4SA to commonly used antibiotics
- Table 7 shows adhesion of peptide ST4SA to pathogens;
- Table 8 shows extracellular DNA recorded after treatment of pathogens with peptide ST4SA;
- Table 9 shows ⁇ -galactosidase activity recorded after the treatment of pathogens with peptide ST4SA;
- Table 10 shows operation of the GlM (computerized);
- Table 11 shows survival of strain -ST4-SA and production of peptide -ST4SA in the GIM - Listeria monocytogenes was used as target organism (pathogen). The values are an average of three trials. The nutrients used were NAN Pelargon (Nestle) and MRS (De Man Rogosa medium, Biolab), respectively.;
- Table 12 shows antibiotic resistance of strain ST4SA
- Table 13 shows growth of strain ST4SA in the presence of different concentrations of Trimethoprim-sulfamethoxazole (TMP-SMX) and Metronidazole;
- Table 14 shows virulence factors that were assayed;
- Table 15 shows the adhesion of strain ST4SA to Caco-2 cell lines by plate counting (control);
- Table 16 shows competitive exclusion of strain ST4SA and L. monocytogenes
- Table 17 shows weight figures for rats administered strain ST4SA, Lactovita or unsupplemented water;
- Table 18 shows ⁇ -glucuronidase activity in faecal samples of male Wistar rats during a (A) 107 day Lactovita study and (B) a 50 day strain ST4SA study. Values are mM p-nitrophenol released per 2 hours. Standard error values are shown in parenthesis;
- Table 19 shows the purification of peptide ST4SA in MRSf (MRS filtrate) medium
- Table 20 shows results for pure CSL, molasses and CWp tested as growth media for peptide ST4SA production
- Table 21 shows a full factorial design (FFD) with CSL and CWp as components to determine which media had the most significant effect on peptide ST4SA production;
- Table 22 shows the results of CSL supplemented with MRS components for
- Table 23 shows high and low concentrations of MRS components and CSL
- Table 24 shows the 2 10"5 FrFD design
- Table 25 shows an analysis of Variance Table for a 2 10"5 FrFD design
- Table 26 shows a 2 2 FFD with 3 centre points for determination of CSL and YE concentrations
- Table 27 shows the uptake of carbon during fermentation
- Table 28 shows the results of resistance testing of E. mundtii ST4 against antibiotics and anti-inflammatory drugs
- Table 29 shows the effect of antibiotics and anti-inflammatory medicaments on adhesion of ST4SA to Caco-2 ceils
- the invention describes a strain of the bacterium Enterococcus mundtii that resists intestinal stress conditions (e.g. low pH, bile salts, salts, pancreatic enzymes) and produces a broad-spectrum antibacterial peptide, namely peptide ST4SA.
- intestinal stress conditions e.g. low pH, bile salts, salts, pancreatic enzymes
- the strain of Enterococcus mundtii which produces the peptide ST4SA has been deposited with the ATCC (American Type Culture Collection) and the assigned number is PTA-7278. Activity has been observed against a large number of Gram- positive and Gram-negative bacteria, most of these isolated from middie-ear infections and the intestine.
- bacteria inhibited are as follows: Acinetobacter baumanii, Bacillus cereus, Clostridium tyrobutyricum, Enterobacter cloacae, Escherichia coli, Klebsiella pneumoniae, Listeria innocua, Pseudomonas aruginosa, Staphylococcus aureus, Staphylococcus carnosus, Streptococcus caprinus, Streptococcus (Enterococcus) faecalis, Streptococcus pneumoniae, and a number of clinical strains of unidentified Gram-positive and Gram-negative bacteria isolated from infected middle- ear fluid samples. This is a large spectrum of activity, specifically against such a variety of human pathogens.
- Lactobacillus pentosus Lactobacillus pentosus, bacteriocin ST151 BR produced by Lactobacillus pentosus
- ST151 BR a bacteriocin produced by Lactobacillus paracasei subsp. paracasei n thermophylin produced by Streptococcus termophylus, peptide AS-48 produced by
- Enterococcus faecalis a bacteriocin produced by Lactococcus lactis KCA2386 and enterocin CRL35 produced by Enterococcus faecium.
- the activity spectrum of these peptides are much narrower than that recorded for peptide ST4SA, as may be seen from the species sensitive to peptide ST4SA listed above.
- the broad spectrum of activity, especially against pathogenic bacteria, renders peptide ST4SA idea! for the control of bacterial infections, especially middle-ear infections (since the peptide is active against a large variety of middle-ear pathogens), as well as pathogens involved in secondary wound infections (the peptide inhibits the growth of a number of these pathogens).
- Pathogens isolated from infected middle-ear fluid were Acinetobacter baumanii, Escherichia colt, Klebsiella pneumoniae, Pseudomonas aruginosa, Staphylococcus aureus, Staphylococcus carnosus, Streptococcus pneumoniae, and a number of unidentified Gram-positive and Gram-negative bacteria.
- Soy bean extract obtained from soy beans that have been immersed in sterile distilled water for 4h, was serially diluted and plated onto MRS Agar (Biolab), Biolab Diagnostics, Midrand, SA), supplemented with 50 mg/l Natamycin (Delvocid ® , Gist-brocades, B.V., Delft, The Netherlands) to prevent fungal growth.
- the plates were incubated at 3O 0 C and 37 0 C for two days.
- Colonies were at random selected from piates with between 50 and 300 cfu (colony forming units) and screened for antimicrobial activity by overlaying them with a second layer of MRS Agar, supplemented with Delvocid ® (50 mg/l). The plates were incubated at 30 0 C and 37°C for 48 h, in an anaerobic flask (Oxoid, New Hampshire, England) in the presence of a Gas Generation Kit (Oxoid). The colonies were covered with a third layer (ca. 10 ml) semi-solid (1.0 % agar, w/v) BHI medium (Merck, Darmstadt, Germany), supplemented with 1 ml active growing cells (ca.
- SEM scanning electron microscopy
- SEQ. ID. NO. 2 Reverse primer: GACG G G CG GTGTGTAC
- Antimicrobial activity was expressed as arbitrary units (AU) per mi cell-free supernatant.
- One AU is defined as the reciprocal of the highest dilution showing a clear zone of growth inhibition and is calculated as follows: a b x 100, where "a" represents the dilution factor and "b" the last dilution that produces an inhibition zone of at least 2 mm in diameter.
- Activity is expressed per ml by multiplication with 100. Lactobacillus casei LHS was used as indicator strain.
- Strain ST4SA was cultured in MRS broth (Biolab) for 24 and 48 h at 30 0 C. The cells were harvested (8 000 x g, 4 0 C, 15 min) and the cell-free supernatants adjusted to pH 6.0 with 6M NaOH. One ml of each supernatant was treated with catalase (Boehringer Mannheim) at 0.1 mg/ml (final concentration), Proteinase K (Roche, Indianopoiis, IN, USA), pronase, papain, pepsin and trypsin (Boehringer Mannheim GmbH, Germany), at 1 mg/ml and 0.1 mg/ml (final concentration), respectively. After incubation the enzymes were heat-inactivated (3 min at 100 0 C) and tested for antimicrobial activity, as described before. The results are listed in Table 3.
- the precipitate was resuspended in one tenth volume 25 mM ammonium acetate (pH 6.5), desalted against distilled water by using a 1000 Da cut-off dialysis membrane (Spectrum Inc., CA, USA) and loaded on a SepPak C18 column (Water M ⁇ lipore, MA, USA). The column was washed with 20% (v/v) iso-propano! in 25 mM ammonium acetate (pH 6.5) and the bacteriocin eluted with 40% iso-propanol in 25 mM ammonium acetate (pH 6.5).
- Strain ST4SA was grown in MRS broth (Biolab) for20h at 30 0 C. The cells were harvested by centrifugation (8 000 x g, 10 min, 4°C) and peptide ST4SA precipitated from the cell-free supernatants with 80% saturated ammonium sulphate. The precipitate was resuspended in one tenth volume 25 mM ammonium acetate (pH 6.5), desalted against distilled water by using a 1000 Da cut-off dialysis membrane (Spectrum Inc., CA, USA) and separated by tricine-SDS-PAGE (Figure 5A). A low molecular weight marker with sizes ranging from 2.35 to 46 kDa ⁇ Amersham International, UK) was used. The gels were fixed and one half overlaid with L casei LHS (10 6 cfu/mL), embedded in Brain Heart infusion (BHI) agar (Biolab), to determine the position of the active bacteriocin (Figure 5B).
- the 50% cytotoxicity level (CC 50 ) was defined as the peptide concentration ( ⁇ g/ml) required to reduce cell viability by 50%. According to the CC 50 results (cytotoxicity level), no cytotoxicity was recorded, that is, the peptide has zero (0) CC50.
- Plasmid DNA was isolated, after which the DNA was further purified by CsCI density gradient centrifugation. The DNA was separated on an agarose gel ( Figure 6). Lambda DNA digested with EcoRI and H/ndlll (Promega, Madison, USA) was used as molecular weight marker.
- Colonies were selected at random and checked for production of peptide ST4SA and screened for plasmid content, as described before.
- a colony of conjugated cells of Ent. faecalis OGX1 which contained pST4SA was cultured and the cell-free supernatant was subjected to activity tests, as described before.
- NCBI National Center for Biotechnology Information
- SEQ. ID. NO. 3 SG-a: TGAGAGAAGGTTTAAGTTTTGAAGAA (forward)
- SEQ. ID. NO. 4 SEQ. ID. NO. 4: SG-b: TCCACTGAAATCCATGAATGA (reverse) ABC transporter primers:
- SEQ. ID. NO. 7 ABC2-a: GTCATTGTTGTGGGGATTAT (forward)
- SEQ. ID. NO. 8 ABC2-b: TCTAGATACGTATCAAGTCC (reverse)
- SEQ. ID. NO. 9 Immun-a: TTCCTGATGAACAAGAACTC (forward)
- SEQ. ID. NO. 10 Immun-b: GTC CCCACAAC CAATAACTA (reverse) Production of peptide ST4SA in different growth media and at different initial growth pH values
- Strain ST4SA was grown in 10 ml MRS broth for 18 h at 30 0 C, the cells harvested by centrifugation (8000 x g, 10 min, 4 0 C), and the pellet resuspended in 10 ml sterile peptone water.
- MRS broth (De Man, Rogosa and Sharpe) without glucose, supplemented with 20.0 g/l fructose, sucrose, iactose, mannose, and maltose, respectively; (d) MRS broth with 0.1 -40.0 g/l fructose as soie carbon source; (e) MRS broth (De Man, Rogosa and Sharpe) with 2.0 - 50.0 g/l K 2 HPO 4 or 2.0 - 50.0 g/l KH 2 PO 4 ; and (f) MRS broth (De Man, Rogosa and Sharpe) supplemented with 0 - 50.0 g/l glycerol.
- Strain ST4SA was identified as a strain of the genus Enterococcus, based on morphology, as shown in Figure 1 , non-motility, absence of pigment formation, and PCR with genus-specific primers (Figure 2) and species-specific primers ( Figure 3). Further identification to species level was by sugar fermentation patterns as shown in Table 1 and physiological characteristics as shown in Table 2 above.
- Peptide ST4SA was inactivated by treatment with proteolytic enzymes (Proteinase K, pepsin, pronase, papain and trypsin), Triton X-114 and after 20 min at 121 0 C, as can be seen in Table 3.
- proteolytic enzymes Proteinase K, pepsin, pronase, papain and trypsin
- Triton X-114 was inactivated by treatment with proteolytic enzymes (Proteinase K, pepsin, pronase, papain and trypsin), Triton X-114 and after 20 min at 121 0 C, as can be seen in Table 3.
- the peptide remained active after treatment for 90 min at 100 0 C and when treated with Tween 20, Tween 80, urea, EDTA and Triton X- 100 (Table 3). No activity was lost after incubation at pH values ranging from 2.0 to 12.0 (Table 3).
- Peptide ST4SA inhibited a large number of Gram-positive and Gram- negative bacteria as shown in Table 4.
- Peptide ST4SA was purified by gel filtration shown in Figure 4 and is in the range of 3400 Da, as seen from Figures 4 and 5.
- the peptide had no cytotoxicity when tested on Vero cells as described hereinbefore.
- Strain ST4SA has two plasmids as shown in Figure 6A. Curing the strain of these plasmtds did not result in loss of antimicrobial activity. Probing of the chromosome and plasmid DNA with a DNA fragment encoding the structural gene showed clear hybridization with the chromosome (genome) ( Figure 6B). This proved that the structural gene encoding peptide ST4SA is located on the genome. Furthermore, conjugation of these plasmids to E. faecalis (not shown) did not convert the strain to a peptide ST4SA producer, confirming that the genes encoding peptide ST4 production are located on the genome of strain ST4SA.
- sequence of peptide ST4SA is indicated in Figure 7 and the sequence listing and is indexed as SEQ. !D. NO. 12 for the purposes of this invention.
- sequence of the transporter and immunity peptides are indexed as SEQ. ID. NOs 14 and 16, respectively, for the purposes of this invention.
- FIGS 9A and 9B The influence of initial growth pH on peptide ST4SA production is indicated in Figure 9A. From these results, it is evident that peptide ST4SA is optimally produced in MRS broth at an initial pH of 6.0 and 6.5, and is stimulated by the presence of 10 - 20 g/l K 2 HPO 4 , 15.0-20.0 g/l fructose, or in the presence of vitamins C, Bi and DL-6,8-thioctic acid.
- a DNA fragment containing an adhesion/immunity gene is indicated in
- Figure 11 is indexed as SEQ. ID. NO. 15 for the purposes of this specification.
- Enterococcus mundtii ST4SA produces a broad-spectrum antimicrobial peptide (peptide ST4SA) with activity against a number of pathogens.
- the structural gene encoding the leader peptide and propeptide (collectively known as the prepeptide) is located on the genome of strain ST4SA (see Figure 6B). Only one such gene structure was detected, suggesting that only one peptide is responsible for the broad spectrum of antimicrobial activity.
- Efforts were made to cure strain ST4SA from its 50 kb and 100 kb plasmids ( Figure 1 ), but they failed. This suggests that the plasmid may play a major role in rendering immunity to peptide ST4SA, or harbours genes important in key metabolic reactions.
- ST4SA is a strain of Enterococcus mundtii was obtained by species-specific PCR (polymerase chain reaction) with primers designed from conserved regions on 16S rDNA using: SEQ. ID. NO. 16: Forward primer: AACGAGCGCAACCC; SEQ. ID. NO. 17 Reverse primer: GACGGGCGGTGTGTAC.
- a 306 base-pair fragment was amplified (shown in Figure 3). Sequencing of the DNA fragment yielded 98% homology with conserved 16S rDNA fragments in Gen Bank.
- the structural gene (encoding the propeptide ST4SA), the transporter genes and the immunity gene have been sequenced and their respective amino acid sequences translated from the DNA sequences ( Figure 8).
- peptide ST4SA The stability of peptide ST4SA, suspended in sterile distilled water, was tested at temperatures ranging from -20 0 C to 60°C over 42 days ( Figure 12). The peptide remained stable at -20 0 C for 42 days and for three weeks at 4°C. Stability decreased after one week at 37°C. Peptide ST4SA in powder form did, however, remain stable for 6 months at room temperature (25°C). Peptide ST4SA will be produced in powder form and marketed as such. Once dissolved in sterile distilled water, peptide ST4SA may be kept for three weeks at 4 0 C (see Figure 12).
- Binding of peptide ST4SA to target ceils is important to ensure penetration of the peptide.
- the ability of peptide ST4SA to adhere to pathogens was studied and the results were expressed as a percentage binding to the pathogens (Table 7). Concluded from these results, at least 75% of peptide ST4SA binds to the pathogens tested . Adhesion of peptide ST4SA to the target cell leads to penetration and disruption of the cell membrane ( Figure 14).
- Enterococcus mundtii ST4SA as a probiotic
- the survival of Enterococcus mundtii ST4SA was evaluated in a computerized gastrointestinal mode! (GIIvI, shown in Fig 25).
- the first vessel in the GIM simulates the stomach, the second vessel the duodenum, vessel number three the jejunum and ileum, and vessel four the colon.
- Flow of the nutrients was regulated by dedicated software.
- the pH in the different sections of the GIM was regulated by the peristaltic addition of sterile 1 N HCI or 1 N NaOH. Each section was fitted with a highly sensitive pH probe, linked to a control unit and computer.
- the flow rate of nutrients through the GlM was adjusted according to an infant's intestinal tract. Conditions simulating a short digestive tract were chosen to allow greater fluctuation and thus increased stress onto the probiotic.
- Four infant formulas (Lactogen2, NAN Peiargon, ALL110 and Alfare) were evaluated.
- Dosage with the probiotic bacterium was according to prescription, i.e. 10 8 viable cells (cfu) per ml.
- the probiotic cells were suspended in saliva.
- the pancreatic-bile solution contained NaHCO 3 , pancreatin and oxgall, dissolved in distilled water.
- the conditions used in the GIM were as summarized in Tables 10 and 11.
- strain ST4SA against a pathogen was tested by infecting the GiM with Listeria monocytogenes.
- the survival of strain ST4SA and its ability to produce the antimicrobial peptide ST4SA in the GIM was monitored (results shown in Tabie 12).
- strain ST4SA survived in all sections of the intestinal tract.
- Antimicrobial peptide production was in excess of 25 600 AU (arbitrary units) per ml in all sections of the intestinal tract.
- Growth in NAN Paiargon was slightly iess optimal than in MRS. However, in both experiments the cell numbers did not decrease by more than one logarithmic cycle (see Table 13).
- strain ST4SA Resistance of strain ST4SA to various antibiotics has been tested according to standard procedures (antibiotic discs, Oxoid). Concluded from these results, strain ST4SA is resistant to sulphonamides, cioxaci ⁇ in, metronidazole, rnethici ⁇ in, neomycin, nystatin, oxacillin and streptomycin (Table 13).
- TMP-SMX Trimethoprim-sulfamethoxazole
- Metronidazole Metronidazole
- TMP-SMX and Metronidazole decreased the cell numbers of strain ST4SA with four log cycles. However, increased concentrations had no drastic effect on viability.
- strain ST4SA The DNA of strain ST4SA amplified with the latter primers indicated that the strain does not have the genes encoding vancomycin resistance, gelatinase activity, an aggregation substance, and collagen adhesion. Based on present results, strain ST4SA is not pathogenic and should not cause allergic reactions when ingested.
- Peptide ST4SA has two hydrophobic regions (Figure 27) which can intercalate with phospholipid-rich cell membranes after it has formed a reaction with the receptor site on the cell wall.
- the area between the two hydrophobic regions, more specifically between amino acid 29 (serine) and amino acid 30 (alanine) ( Figure 27) is more flexible than the rest of the structure and may act as a hinge area, which would allow the C-terminal half of the peptide to bend and incorporate itself into the phospholipid-rich cell membrane.
- the two sections of peptide ST4SA were synthesized (listed hereinafter as Fragment 1 and Fragment 2), based on the amino acid sequence deduced from the DNA sequence of the structural gene.
- Fragment 1 consisted of the first 29 amino acids (from lysine to serine), just before the hinge area (viz. between the serine at position 29 and alanine at position 30).
- a disulfide bridge was introduced (connecting line, shown below) that covalently linked amino acids 9 (cysteine) and 14 (cysteine), also shown below in the full length peptide sequence: KYYGNGVSCNKKGCSVDWGKAIGIIGNNS.
- the disulfide bridge served to stabilize the structure of the peptide.
- Fragment 1 contained the first hydrophobic region, indicated by the encircled region (six amino acids from position 21 to 26, viz. AIGIIG). This part of the molecule recognizes the receptor on the cell wail of the target (sensitive) organism.
- Fragment 2 comprised the last 13 C-termi ⁇ ai amino acids in the second hydrophobic loop downstream of the hinge area, plus the preceding 11 amino acids just before the hinge area (between serine and alanine):
- Fragment 2 KAIGllGNNSAANLATGGAAGWKS
- PE film was cut into sections of 5 x 5 cm and soaked for 1 h in a solution of 60% isopropanol and peptide ST4SA (activity level: 102 400 ALJ/ml).
- the PE sections were air-dried (20 min at 60 0 C) and assayed for antimicrobial activity by using the standard agar diffusion method.
- the plates, seeded with L sakei DSM 20017, were incubated for 24 h at 30 0 C and examined for zones of growth inhibition.
- Peptide ST4SA adsorbed to PE within 60 seconds to produce a film with high antimicrobial activity (large inhibition zones surrounding the PE section).
- the strength of binding was determined by soaking the peptide-coated PE film in SDS- buffer, followed by electro-eiuting peptide ST4SA from the film with a current of 30 mA for 2h (room temperature, i.e. ca. 25°C). Samples were taken at regular time intervals and tested for antimicrobial activity. Protein concentrations were determined by using the Bradford method. Electro-eluted film was tested for antimicrobial activity by using the agar diffusion method as before.
- Peptide ST4SA adhered strongly, and it would seem irreversibly, to the PE film. Release of peptide ST4SA from the surface of PE was only possible after 1 h with a current of 3OmA. In a challenge study with red meat as model, surface (PE)-bound peptide ST4SA prevented the growth of pathogenic bacteria (Listeria, Bacillus and Staphylococcus). This suggests that peptide ST4SA is usable in wound dressings to prevent or reduce microbial infections and also finds uses in other medical or aseptic applications such as, for example, implants, ear grommets, catheters, ostomy tubes and pouches, stents, suture material, hygiene products such as feminine hygiene products, contact lenses, contact lens rinsing solutions.
- the encapsulation of the antimicrobial peptide in the polymer leads to a slow release of the antimicrobial peptide and an extended period of treatment of a microbial infection. Furthermore, strong adherence of peptide ST4SA to PE shows that it acts as a slow-release antimicrobial agent.
- Peptide ST4SA binds to more than one receptor site on a microbial ceil and is typical of what one would expect from a broad-spectrum antimicrobial agent.
- the first section of peptide ST4SA (in front of the hinge area) binds to the receptor.
- the second part (downstream of the hinge area) has a bigger hydrophobic region and intercalates into the cell membrane and distorts the permeability, leading to cell death (visualized by DNA and enzyme leakage).
- Peptide ST4SA binds to PE in a stable and slow-release fashion and is suited for incorporation into wound dressings.
- Enterococcus mundtii ST4SA was evaluated in a computerized gastro-intestinal model as shown. This phase comprised further in vitro and in vivo evaluation of strain ST4SA as a probiotic. Adhesion to mucus and epithelial cells were studied in vitro with human ceil lines, in vivo studies were performed in rats.
- the human intestinal cell lines used in the study were from the human colon adenocarcinoma and included Caco-2 cell lines, HT-29 and HT29-MTX (mucus- secreting cells).
- the cell-lines express morphological and functional differentiation when grown under standard culture conditions and show characteristics of mature enterocytes, which include polarization, a functional brush order and apical intestinal hydrolases.
- Adherence of strain ST4SA to host cells is influenced by cell surface carbohydrates, the Efa A protein, the Ace (adhesin of collagen from enterococci) protein and aggregation substance (AS), related to pathogenicity.
- AS is an adhesin which mediates the formation of cell clumps that allows the highly efficient transfer of the sex pheromone plasmid on which AS is encoded.
- strain ST4SA was screened for virulence traits, bile salt hydrolase (BSH) activity, and the ability to adhere to the human enterocyte-like cell line Caco-2, competitive exclusion while adhering to the Caco-2 cell line, and in the in vitro gastrointestinal (GIT) model.
- BSH bile salt hydrolase
- GIT in vitro gastrointestinal
- virulence factors viz. vancomycin resistance (VanA/VanB ⁇ /anC1/VanC2 ⁇ /anC3), production of gelatinase (Gel), aggregation substance (AS), adhesin of collagen from enterococci (Ace), enterococcus surface protein (Esp), haemolysin/bacteriocin (CyI) and non-cytolysin beta hemolysin genes were studied by in vitro tests and/or PCR screening. DNA was extracted from vancomycin resistance (VanA/VanB ⁇ /anC1/VanC2 ⁇ /anC3), production of gelatinase (Gel), aggregation substance (AS), adhesin of collagen from enterococci (Ace), enterococcus surface protein (Esp), haemolysin/bacteriocin (CyI) and non-cytolysin beta hemolysin genes were studied by in vitro tests and/or PCR screening. DNA was extracted from vancomycin resistance
- EfaAfm E. faecium endocarditis antigen
- EfaAfs E faecatis endocarditis antigen
- Ace Adhesin to collagen from E. faecalis
- Cytolysin ( ⁇ -hemolysin activity)
- Esp E ntero coccus surface protein
- Non-Cyt non-cyto!ysin beta hemolysin 111
- Sex pheromone was obtained by growing the pheromone producer, Enterococcus faecatis JH2-2, in MRS broth at 37°C for 18 h.
- ⁇ -hemo!ysin Production of ⁇ -hemo!ysin was indicated by the formation of ciear zones surrounding the colonies on blood agar plates. Blood agar plates were prepared using Columbia Blood Agar Base with 5% sheep blood. No production of ⁇ -hemolysin was observed.
- strain ST4SA does not have the genes encoding vancomycin resistance, gelatinase production, production of the endocarditis antigen, forming of cell aggregates, adherence to collagen, and/or production of a surface protein.
- Genes encoding ⁇ -hemolysin activity and non-cytolysin beta hemolysin III were detected. However, the latter two genes are not expressed (no haemolytic activity was observed on blood agar plates - see below)
- Strain ST4SA was tested for BSH activity by spotting 10 ⁇ l of an overnight culture on MRS agar plates supplemented with 0.5% (w/v) sodium salt of taurodeoxycholic acid (TCDA) and 0.37 g/L CaCI 2 . Plates were incubated in anaerobic jars for 72h at 37 0 C. The formation of precipitation zones were regarded BSH positive.
- TCDA taurodeoxycholic acid
- BSH bile salt hydrolytic
- % Hydrophobicity [( OD 580nm read ⁇ ngi - OD 58 o n m reading 2)/ OD 5 80nm readingl] x 100.
- strain ST4SA did not show signs of hydrophobicity. Accordingly, the cells do not stick permanently to surfaces in the GIT. The cells move freely (as planctonic cells) in the gut, which enhances the usefulness thereof as a good probiotic.
- Caco-2 cells (Highveld Biological Sciences) were seeded at a concentration of 5 x 10 5 cells per well to obtain confluence. Adherence was examined by adding 100 ⁇ i of bacterial suspension (1 x 10 5 cfu/ml of strain ST4SA and 1 x 10 3 cfu/ml of L monocytogenes) to the wells. After incubation at 37°C for 2h, the eel! lines were washed twice with PBS. The bacterial cells were lysed with Trition-X 100 and plated onto MRS and BHl agar, respectively. Adhesion was calculated from the initial viable counts and the ceil lysates.
- Caco-2 cell monolayers were prepared on glass coverslips in 12-well tissue culture plates. A suspension of ST4SA cells was added to the wells. After a 2h adhesion period, the cell lines were washed twice with PBS, fixed with 10% formalin and gram-stained. Adherent bacteria were examined microscopically. The results are shown in Table 15 and Table 16.
- the antimicrobial activity of ST4SA against L monocytogenes in an in vitro gastro-intestinai model was determined.
- ST4SA was inoculated in the stomach vessel as described hereinbefore.
- L monocytogenes fi x 10 4 was inoculated in the duodenum vessel of the GIT.
- Samples were taken from each vessel and plated out on Enterococcus and Listeria specific medium, respectively.
- As control only L. monocytogenes was inoculated in the GIT model.
- the L monocytogenes challenge with ST4SA in the in vitro GIT model revealed that ST4 had an antimicrobial effect on L. monocytogenes (see graphs on next page). Growth was reduced from 8 x 10 4 to 2 x 10 4 in the jejunum vessel and L monocytogenes was 1 x 10 1 cfu/ml (ower in the ileum vessel when compared with the control, as shown in Figure 29.
- Ten male Wistar rats weighing between 318 g and 335 g were housed in groups of five in plastic cages with 12-hour light/dark cycle, in a controlied atmosphere (temperature 20 0 C ⁇ 3°C). The animals were fed a standard diet, as well as autociaved, reverse osmosis water either supplemented with probiotic or unsupplemented ad lib.
- Strain ST4SA was cultured in MRS Broth at 30 0 C for 18 hours; the optical density was adjusted to 1.8 at 600 nm. Cells were harvested by centrifugation and washed in 20 mM phosphate buffer (pH 7.5). Washed cells were re-suspended in 100 mM sucrose, frozen in liquid nitrogen and lyophilized overnight. The cfu/ml value was determined by suspending a given mass of cells in 1 ml of phosphate buffer and spread plating dilutions on MRS solid media. Strain ST4SA was added to drinking water at a concentration of approximately 2 x 10 8 cfu/ml.
- Rats were placed in single cages overnight at specified sampiing points and the 24 h faecal samples were collected to determine bacterial counts and ⁇ - glucuronidase activity. Faecal samples were homogenized in 20 mM phosphate buffer at a concentration of 100 mg faeces/ml buffer. Samples were stored at -2O 0 C until analysis. The faecal samples were pelleted by centrifugation and resuspended in 1 ml GUS extraction buffer (50 mM NaHPO 4 , 5 mM DTT, 1 mM EDTA, 0.1% Triton X-100), mixed and incubated at 22°C for 10 minutes.
- GUS extraction buffer 50 mM NaHPO 4 , 5 mM DTT, 1 mM EDTA, 0.1% Triton X-100
- ⁇ -Glucuronidase activity was assayed by incubating 100 ⁇ ! of treated faecal suspension with 900 ⁇ l of reaction buffer (extraction buffer containing ImM p-nitrophenyi giucuranide) and incubating at 37 0 C for 2 hours. The reaction was stopped by adding 2.5 ml 1 M Tris, pH 10.4. The absorbance was determined at 415 nm and a standard curve was constructed using concentrations of 0.1 , 0.2, 0.5, 1 and 10 mM p-nitrophenol.
- mice After feeding with test strains for the specified time periods, animals were euthanized by pentobarbitone sodium overdose. Blood samples were obtained by cardiac puncture of the right ventricle. The gross anatomy of the visceral organs of each rat was checked and recorded. A sample of the liver, spleen, ileum, caecum and colon tissues was excised. The tissue samples were collected in cassettes and placed in a 4% formaldehyde (PBS) solution and then embedded in paraffin wax for histological analysis and FISH studies. A section of the ileum and colon were frozen in liquid nitrogen. Blood samples were spread plated on BHI solid media and incubated at
- TNF tumour necrosis factor
- IFN interferon y
- Bacterial enzymes including ⁇ -glucuronidase, are known to be involved in generating mutagens, carcinogens and tumour promoters from precursors found in the GIT and there presence may indicate toxicity of bacterial strains and can therefore be used as an indication of the safety of potential probiotics.
- strain ST4SA and a Lactovita suspension exhibited no ⁇ -glucuronidase activity in vitro (data not shown).
- rats given a Lactovita suspension showed an increase in ⁇ -glucuronidase activity in faecal samples compared to control rats (Table 18A).
- Control animals also showed a decrease in activity at day 107 of the study compared to activity at day 56, experimental animals showed slightly increase values at day 107 compared to day 56.
- Rats given a ST4 supplement showed higher ⁇ -glucuronidase activity compared to control groups (Table 18B), however, this activity was still lower at the end of the study compared to the values on day 0 of the study.
- the control group also showed lower activity at the end of the study compared to day 0.
- An enlarged spleen may indicate increase immune system activity. This also correlates with pronounced MLN.
- MLN are also involved in immune function and may enlarge as a result of inflammation or infection. This enlargement is an indication that they are performing their function as expected. Therefore strain ST4SA may act as an immune stimulant.
- Rats receiving Lactovita supplements showed a smaller spleen and less pronounced MLN compared to the control rats. This indicates that Lactovita does not induce an immune reaction.
- the MLN and spleen of the control rats were enlarged and no symptoms of disease were observed in the absence of any immune stimulant.
- Immune modulation Northern hybridization studies did not indicate any cytokine (TNF or IFN) expression in either the experimental ST4SA group or control group. Positive signals were detected of relatively the same intensity when RNA was probed with a ⁇ -actin DNA probe indicating the presence of RNA.
- Cytokines are secreted proteins that mediate cell growth, inflammation, immunity, differentiation and repair. They often only require femtomolar concentrations to produce their required effects. Often they act in combination with cell surface receptors to produce changes in the pattern of RNA and protein synthesis. Because they are usually present in such low concentrations it may be more beneficial to determine the expression of additional genes that are under the influence of these proteins.
- strain ST4SA does not possess genes encoding vancomycin resistance. Genes encoding ⁇ -hemolysin activity and non-cytolysin beta hemolysin III were detected, but they remained silent (not expressed). Strain ST4SA has no bile salt hydrolytic (BSH) activity. This indicates that the strain would perform better in the lower sections of the G!T (ileum and colon). As shown above, the data indicate that E. mundtii strain ST4SA moves freely through the GIT and prevents the adhesion of Listeria to Caco-2 cells, while also successfully competing against Listeria from binding to receptors on human ceils. Strain ST4SA had an antimicrobial effect on L monocytogenes in gastro-intestinal model (GiM) studies.
- GaM gastro-intestinal model
- Strain ST4SA is not toxic, as shown with rat studies. No treatment-reiated illness or death occurred. Strain ST4SA also performed better than Lactovita as such, with rats being given Lactovita showing an increase in ⁇ -glucuronidase activity; strain ST4SA therefore stimulates the immune response in rats. Rats given Lactovita supplements showed a smaller spleen and less pronounced MLN compared to the control rats, which suggest that Lactovita does not induce an immune reaction. As indicated above, peptide ST4SA inhibits the growth of a variety of bacteria and maximal production of peptide ST4SA (51 200 AU/ml) was recorded after 20 h of growth in MRS broth (Biolab), which was maintained throughout fermentation,
- the cells were harvested by centrifugation (8 000 x g, 4°C, 15 min) and the cell-free supernatant incubated at 80° C for 10 min. Ammonium sulfate was gently added to the cell-free supernatant at 4° C to a saturation level of 60%. After 4 h of slow stirring, the precipitate was collected by centrifugation (20000 x g, 1 h, 4° C).
- the pellet was resuspended in one-tenth volume 25 mM ammonium acetate (pH 6.5) and desalted against sterile MiIIiQ water using a 1.0 kDa cut-off Spectra/Por dialysis membrane (Spectrum Inc., CA, USA). Further separation was by cation exchange chromatography in a 1 ml Resource S column (Amersham Biosciences) with an AKTApur/f/er(Amersham), as described hereinbefore.
- Active fractions collected from the AKTApurifier corresponded to the ST4SA peak and produced a 42-amino acid peptide, the expected size of peptide ST4SA.
- Iso-electric focusing of peptide ST4SA was done by using the Rotofor® electro-focusing cell (Bio-Rad, Hercules, California, USA).
- a constant current of 12 W was applied for 5 h at 8°C.
- Cost reduction of cultivation media forms an important part of media optimization. Media costs can be lowered by using industrial media as a carbon and/or nitrogen source.
- Corn steep liquor (CSL), cheese whey powder (CWp) and molasses are regularly used as part of growth media.
- CSL is a by-product formed during the miliing of corn. It Is mainly a nitrogen source, but also contains sugars (mainly sucrose), vitamins and minerals.
- Cheese whey a by-product in the diary industry, is the most common fermentation medium for lactic acid (LA) production, and contains mainly lactose, proteins and salts.
- Molasses is a by-product containing mainly sucrose with traces of other minerals.
- Strain ST4SA was cultured in MRS broth (Biolab) and inoculated (2% v/v) into CSL, CWp and molasses, respectively.
- the pH was adjusted with NaOH before sterilization (121 0 C for 15 min).
- the concentration of NaOH depended on the buffer capacity of the media.
- a 24-hour-old culture was used for inoculation (2% v/v). Batch fermentations were conducted in test tubes at 30 0 C for 16 hours, pH 6.5 - 7.0. The pH was not controlled. Optical density (OD) was measured at 600 nm.
- a Dionex DX500 analyser with a CarboPac PA100 column was used to analyse the samples for monomer sugars.
- the eluent used was 250 mM NaOH, H 2 O and 1 M NaOAc at a flow rate of 1 ml.min "1 .
- the Dionex was equipped with an auto sampler and the injection volume was 10 ⁇ l.
- Peptide ST4SA activity of up to 12800 ALJ ml "1 was recorded in pure CSL at a concentration of 10 g TS. f . This was, however, low compared to peptide ST4SA activity recorded in MRS (51200 AU. ml "1 ).
- MRS components except glucose
- CSL at 40 g TS. I "1 CSL with supplements yielded low activity.
- a high concentration of CSL inhibited growth (small decrease in pH) and, subsequently, also peptide ST4SA production. This may be due to inhibiting components in CSL.
- the same experiment was done with CWp (Table 22).
- Beef extract (B), potassium phosphate (E), tri-ammonium citrate (G) and sodium acetate (K) had negative coefficients in the linear model (equation 2) causing a decrease in the response variable. This reflected their negative effect on peptide ST4SA production. This meant that only yeast extract (YE) (C) and CSL (D) increased peptide ST4SA production.
- a growth curve with optimal media is shown in Figure 30.
- CSL-based media and MRS yielded similar growth kinetics.
- composition of CSL may vary on a daily basis, as it is a waste product. A difference in composition has the potential of significantly affecting results.
- the final media consisted of the following three components: YE (C), CSL
- Tween ⁇ O has emulsifying properties.
- the sugar content of the CSL medium was measured before and after fermentation.
- CSL was made up to a concentration of 7.5 g TS. i '1 .
- the main monomer sugars present were giucose and fructose at a total concentration of 3.883 g.l "1 . Only about 51.8% of the total sugar was therefore in a fermentable form and not all sugars were metabolized during fermentation.
- the pH was 4.6 and the residual sugars left were 8.8%. Growth limitations were due to low pH and not due to a lack of nitrogen, minerals, vitamins or any other nutrients, and Table 27 shows the carbon uptake during fermentation.
- CSL supplemented with YE could match high peptide ST4SA levels obtained in commercial MRS broth.
- this has the potential of significantly reducing costs associated with cultivation media.
- CSL was selected as growth medium for industrial production of peptide ST4SA.
- probiotic bacteria may also compete with pathogenic bacteria for adhesion sites.
- Caco-2 cells which originate from human colon adenocarcinoma, were used as an in vitro model to investigate the adhesion and competitive exclusion abilities of E. mundtii ST4SA to epithelial cells.
- E. mundtii ST4SA and L. monocytogenes Scott A were able to adhere and both showed 5% adhesion to the Caco-2 cells.
- the adhesion of f. mundtii ST4SA was lowered to 1 % when the incubation time was only 1 h. Food material stays in the small intestine for 2h and therefore would ailow sufficient time for E. mundtii ST4 to adhere to the epitheiiai DCis.
- E. mundtii ST43A did not have an effect on the adhesion of L. monocytogenes Scott A regardless of whether the strain was added before, during or after the incubation with the pathogen.
- E. mundtii ST4SA showed resistance against two antibiotics (Cefasyn and Utin) and the inflammatory medicaments Rheugesic, Coxflam and Pynmed. The results are shown in Table 28. Antibiotics with the greatest growth inhibition on E. mundtii ST4SA are Promoxil, Cipadur, Roxibidd and Doximal.
- Promoxil, Doximal, Cefasyn and Utin had no effect on the adhesion of ST4SA cells to Caco-2 cells compared to the control.
- Adhesion decreased with 10% in the presence of Cipadur, Roxibudd and ibugestic syrup and 14% with a higher concentration of Cefasyn, as may also be seen in Table 29.
- E. mundtii strain ST4SA was cultured in MRS Broth at 30 0 C for 18 hours; the optical density was adjusted to 1.8 at 600 nm.
- Cells were harvested by centrifugation and washed in 20 mM phosphate buffer (pH 7.5). Washed cells were resuspended in 10O mM sucrose, frozen at -8O 0 C and lyophilized overnight. The cfu/vial values were determined by suspending a given mass of cells in 1 ml of phosphate buffer and spread plating dilutions on MRS soiid media. Lyophiiized ceils were resuspended in sterile skim milk (10%) and 2 x 10 ⁇ cfu strain ST4SA was administered via intragastric gavage.
- Lactovita capsules were emptied into a vial and resuspended in sterile skim milk (10%) and 2 x 10 8 cfu was administered via intragastric gavage.
- Washed cells were resuspended in 100 mM sucrose, frozen at -8O 0 C and lyophilized overnight. The number of cfu/vial was determined as described above.
- Lyophilised cells were resuspended in sterile skim milk (10%) and 10 4 cfu were administered via intragastric gavage.
- Sections were stained with hemolysin and eosin for histological analysis.
- the Enterococcus mundtii strain, ST4SA isolated from soy bean extract
- ST4SA isolated from soy bean extract
- peptide ST4SA is active against a number of pathogenic organisms such as those isolated from human middle-ear infections and the human intestine.
- peptide ST4SA is not cytotoxic.
- the Enterococcus mundtii ST4SA strain has been distinguished by the Applicant from other strains of E.
- Peptide ST4SA has been purified and sequenced, and contains two large hydrophobic regions.
- the Applicant has isolated and sequenced the nucleic acid sequence encoding peptide ST4SA, as well as the nucleic acid sequence encoding the transport of peptide ST4SA across the cell membrane, which serves to render immunity to the producer cell against its own peptide.
- strain ST4SA survives low pH conditions (phi 2.5), grows in medium adjusted from pH 4.0 to 9.6 in the presence of 6.5% NaCI, and is resistant to 1.0% (w/v) bile salts and pancreatic juice. Growth of strain ST4SA occurs at 1 O 0 C (although slowly) and at 45°C, with optimal growth at 37 0 C. Only L(+)- lactic acid is produced from glucose.
- the peptide also has use as an antimicrobial agent in a liquid formulation, as a topical treatment for, for exampie, middle-ear infections.
- This liquid formulation may be applied to the ear using an ear drop applicator.
- the liquid formulation is also included in a liquid form of the probiotic of Enterococcus mundtii for use as a liquid supplement to meals.
- the peptide further finds use as an antimicrobial agent in either a liquid or aspirated form in a nasal spray for treatment in , for example, sinus infections or sinusitis.
- the peptide is also used as an antimicrobial agent encapsulated in a polymer.
- This polymer is then used in a formulation for topical treatment of infections such as, for example, skin infections, or it may be used for incorporation in implants such as, for example, ear grommets, or for incorporation in wound dressings.
- infections such as, for example, skin infections
- implants such as, for example, ear grommets, or for incorporation in wound dressings.
- the encapsulation of the antimicrobial peptide in the polymer leads to a slow release of the antimicrobial peptide and an extended period of treatment of a microbial infection.
- the peptide also finds use as an antimicrobial agent by being incorporated into ointment, lotion, or cream formulations and used to treat infections.
- the peptide may also further be used as an antimicrobial agent by being incorporated into liquid formulations such as, for example, contact lens rinsing fluid, or it may be incorporated into the contact lenses themselves.
- the peptide may also be used as an antimicrobial agent by being incorporated into packaging material such as plastic, for use in the manufacture of aseptic packaging.
- packaging material such as plastic
- the peptide may be used as part of a broad- spectrum probiotic of Enterococcus mundtii in a tablet form or in a capsule form or it may be in an edible form such as, for example, a sweet or chewing gum.
- SEQ. ID. NO. 1 Forward primer
- SEQ. ID. NO. 2 Reverse primer GACGGGCGGTGTGTAC
- Enterococcus mundtii strain ST4SA (ATCC PTA-7278) structural gene primers SEQ. JD. NO. 3: Forward primer
- SEQ. ID. NO. 4 Reverse primer
- Enterococcus mundtii strain ST4SA (ATCC PTA-7278) ABC transporter gene primers SEQ. ID. NO, 5: Forward primer
- ABCl-b ATCTCTTCTCCGTTTAATCG
- SEQ. ID. NO. 7 Forward primer
- SEQ. iD. NO. 8 Reverse primer ABC2-b : T CTAGATAC GT ATCAAGTCC
- SEQ. ID. NO. 10 Reverse primer
- SEQ. ID. NO. 14 Polypeptide encoded by Enterococcus mundtii ST4SA (ATCC PTA-7278) ABC transporter gene
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Microbiology (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Virology (AREA)
- Biochemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Tropical Medicine & Parasitology (AREA)
- Biomedical Technology (AREA)
- Mycology (AREA)
- General Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biophysics (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Plant Pathology (AREA)
- Agronomy & Crop Science (AREA)
- Pest Control & Pesticides (AREA)
- Dentistry (AREA)
- Environmental Sciences (AREA)
- Immunology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA002647161A CA2647161A1 (en) | 2006-05-28 | 2007-05-25 | Probiotic strain and antimicrobial peptide derived therefrom |
| CN2007800198580A CN101454440B (zh) | 2006-05-28 | 2007-05-25 | 益生菌株以及从其衍生的抗微生物肽 |
| NZ571619A NZ571619A (en) | 2006-05-28 | 2007-05-25 | Probiotic strain of Enterococcus mundtii and the broad-spectrum bacteriocin ST4SA |
| JP2009512739A JP2009538614A (ja) | 2006-05-28 | 2007-05-25 | プロバイオティクス菌株及びこれに由来する抗菌性ペプチド |
| EP07736018.8A EP2021457B1 (en) | 2006-05-28 | 2007-05-25 | Probiotic strain and antimicrobial peptide derived therefrom |
| US12/302,067 US7951385B2 (en) | 2006-05-28 | 2007-05-25 | Probiotic strain and antimicrobial peptide derived therefrom |
| EA200802409A EA017558B1 (ru) | 2006-05-28 | 2007-05-25 | ШТАММ БАКТЕРИЙ Е.Mundtii ST4SA, СПОСОБНЫЙ ПРОДУЦИРОВАТЬ АНТИБАКТЕРИАЛЬНЫЙ ПЕПТИД ST4SA, СПОСОБ ПОЛУЧЕНИЯ ПЕПТИДА ST4SA И ПРИМЕНЕНИЕ ШТАММА БАКТЕРИЙ Е.Mundtii ST4SA И ПЕПТИДА |
| AP2008004626A AP2841A (en) | 2006-05-28 | 2007-05-25 | Probiotic strain and antimicrobial peptide derivedtherefrom |
| AU2007266675A AU2007266675B2 (en) | 2006-05-28 | 2007-05-25 | Probiotic strain and antimicrobial peptide derived therefrom |
| KR1020087031307A KR101521123B1 (ko) | 2006-05-28 | 2007-05-25 | 프로바이오틱 스트레인 및 그로부터 유도된 항균 펩티드 |
| NO20084577A NO20084577L (no) | 2006-05-28 | 2008-11-03 | Probiotisk stamme og antimikrobielle peptider fra disse |
| IL195520A IL195520A0 (en) | 2006-05-28 | 2008-11-26 | Probiotic strain and antimicrobial peptide derived therefrom |
| US13/094,155 US8444998B2 (en) | 2006-05-28 | 2011-04-26 | Probiotic strain and antimicrobial peptide derived therefrom |
| IL250634A IL250634A0 (en) | 2006-05-28 | 2017-02-16 | Probiotic sequence and generation of an antimicrobial peptide from it |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ZA200604035A ZA200604035B (en) | 2005-05-31 | 2006-05-28 | Improved grenade launcher |
| ZA2006/04035 | 2006-05-28 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/302,067 A-371-Of-International US7951385B2 (en) | 2006-05-28 | 2007-05-25 | Probiotic strain and antimicrobial peptide derived therefrom |
| US13/094,155 Division US8444998B2 (en) | 2006-05-28 | 2011-04-26 | Probiotic strain and antimicrobial peptide derived therefrom |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2007138538A2 true WO2007138538A2 (en) | 2007-12-06 |
| WO2007138538A3 WO2007138538A3 (en) | 2008-04-17 |
Family
ID=38779065
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2007/051982 Ceased WO2007138538A2 (en) | 2006-05-28 | 2007-05-25 | Probiotic strain and antimicrobial peptide derived therefrom |
Country Status (13)
| Country | Link |
|---|---|
| US (2) | US7951385B2 (https=) |
| EP (1) | EP2021457B1 (https=) |
| JP (1) | JP2009538614A (https=) |
| KR (1) | KR101521123B1 (https=) |
| CN (1) | CN101454440B (https=) |
| AP (1) | AP2841A (https=) |
| AU (1) | AU2007266675B2 (https=) |
| CA (1) | CA2647161A1 (https=) |
| EA (1) | EA017558B1 (https=) |
| IL (2) | IL195520A0 (https=) |
| NO (1) | NO20084577L (https=) |
| NZ (1) | NZ571619A (https=) |
| WO (1) | WO2007138538A2 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011045764A1 (en) * | 2009-10-15 | 2011-04-21 | Cipla Medpro Research And Development (Pty) Ltd | A product for delivering antimicrobially active substances to an infected site |
| US20220062181A1 (en) * | 2017-09-19 | 2022-03-03 | Advaxis, Inc. | Compositions and methods for lyophilization of bacteria or listeria strains |
Families Citing this family (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR101521123B1 (ko) * | 2006-05-28 | 2015-05-19 | 시플라 메드프로 리서치 앤드 디벨롭먼트 (피티와이) 엘티디 | 프로바이오틱 스트레인 및 그로부터 유도된 항균 펩티드 |
| US8357519B2 (en) * | 2008-11-19 | 2013-01-22 | The Ohio State University | Methods and processes for producing esters |
| JP5881017B2 (ja) * | 2010-11-05 | 2016-03-09 | 国立大学法人広島大学 | 籾殻または玄米から単離された植物乳酸菌およびその利用 |
| WO2012148891A1 (en) * | 2011-04-29 | 2012-11-01 | Evonik Degussa Corporation | Peptide-lipid conjugates and uses thereof |
| RU2532227C1 (ru) * | 2013-10-23 | 2014-10-27 | Федеральное бюджетное учреждение науки Государственный научный центр прикладной микробиологии и биотехнологии (ФБУН ГНЦ ПМБ) | Штамм enterоcoccus mundtii, продуцирующий субстанцию пептидной природы с антилистериозной активностью |
| RU2599430C1 (ru) * | 2015-07-23 | 2016-10-10 | Федеральное государственное бюджетное образовательное учреждение высшего профессионального образования "Горский государственный аграрный университет" | ШТАММ ЛАКТОБАКТЕРИЙ Enterococcus mundtii - ПРОДУЦЕНТ МОЛОЧНОЙ КИСЛОТЫ И АНТИБИОТИЧЕСКИХ ВЕЩЕСТВ |
| US9944960B2 (en) * | 2015-11-17 | 2018-04-17 | Premier Research Labs, Lp | Process for microbial production of dihydrolipoic acid and extraction of dihydrolipoic acid with edible oils |
| CN105385636A (zh) * | 2015-12-07 | 2016-03-09 | 江南大学 | 一株产细菌素的肠膜明串珠菌及其应用 |
| AU2017240064B8 (en) | 2016-03-31 | 2021-11-11 | Gojo Industries, Inc. | Antimicrobial peptide stimulating sanitizing composition |
| EP3436041B1 (en) | 2016-03-31 | 2023-05-24 | Gojo Industries, Inc. | Sanitizer composition with probiotic/prebiotic active ingredient |
| WO2017173240A1 (en) | 2016-03-31 | 2017-10-05 | Gojo Industries, Inc. | Antimicrobial peptide stimulating cleansing composition |
| KR101722255B1 (ko) * | 2016-04-22 | 2017-04-03 | 주식회사 폴인브레드 | 쌀과 쌀누룩을 이용한 자연발효종 제조방법 |
| JP2020500860A (ja) | 2016-11-23 | 2020-01-16 | ゴジョ・インダストリーズ・インコーポレイテッド | プロバイオティック/プレバイオティックな有効成分を含む消毒薬組成物 |
| WO2019151371A1 (ja) * | 2018-01-31 | 2019-08-08 | ニュートリー株式会社 | 肺炎球菌感染症の予防及び/又は治療剤 |
| KR102076089B1 (ko) | 2018-10-02 | 2020-02-11 | 서울대학교 산학협력단 | 니신 z 생산능이 우수한 락토코커스 락티스 서브스페시스 락티스 ldtm 6804 신균주(kctc 13564bp) |
| CN109456911B (zh) * | 2018-10-10 | 2019-10-18 | 南京林业大学 | 一株蒙氏肠球菌HcM7及其应用 |
| CN110846260B (zh) * | 2019-12-18 | 2021-03-02 | 江南大学 | 一株降低生物胺的肉葡萄球菌及其应用 |
| KR102951826B1 (ko) * | 2023-01-18 | 2026-04-13 | 조선대학교산학협력단 | 오리 유래 항균 펩타이드로부터 설계된 신규 항균 펩타이드 및 이의 용도 |
Family Cites Families (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPH1084969A (ja) | 1996-09-19 | 1998-04-07 | Chemo Sero Therapeut Res Inst | ヘモフィルス・パラガリナルム由来新規ポリペプチド及びその製法 |
| US7655775B2 (en) * | 1997-09-05 | 2010-02-02 | Canbiocin, Inc. | Expression vectors for treating bacterial infections |
| AU7898700A (en) | 1999-10-22 | 2001-05-08 | Shanghai Bio Road Gene Development Ltd. | A novel polypeptide-rna binding protein 33 and polynucleotide encoding said polypeptide |
| GB0027761D0 (en) | 2000-11-14 | 2000-12-27 | Nestle Sa | Nutritional composition for an immune condition |
| DE10105347A1 (de) * | 2001-02-05 | 2002-08-22 | Nutrinova Gmbh | Sorbinsäurepräparat enthaltend Probiotika als Futtermittelzusatz in der Nutztieraufzucht |
| GB0125535D0 (en) | 2001-10-24 | 2001-12-12 | Microbiological Res Authority | Mycobacterial genes down-regulated during latency |
| US6878373B2 (en) | 2001-12-03 | 2005-04-12 | Micropure Technologies, Inc. | Probiotic composition containing Bacillus cereus RRRL B-30535 |
| JP4111489B2 (ja) * | 2002-05-23 | 2008-07-02 | プリマハム株式会社 | 新規バクテリオシン |
| WO2004005492A2 (fr) * | 2002-07-03 | 2004-01-15 | Galina Gennadievna Alekhina | Composition probiotique a base d'une souche d'enterocoques pour moyens de traitement et de prevention et procede de fabrication correspondant |
| EP1384483A1 (en) * | 2002-07-23 | 2004-01-28 | Nestec S.A. | Probiotics for treatment of irritable bowel disease (IBS) through improvement of gut neuromuscular function |
| ITBO20020564A1 (it) | 2002-09-06 | 2004-03-07 | Alfa Wassermann Spa | Bifidobatteri e preparazioni che li contengono. |
| KR101521123B1 (ko) * | 2006-05-28 | 2015-05-19 | 시플라 메드프로 리서치 앤드 디벨롭먼트 (피티와이) 엘티디 | 프로바이오틱 스트레인 및 그로부터 유도된 항균 펩티드 |
-
2007
- 2007-05-25 KR KR1020087031307A patent/KR101521123B1/ko not_active Expired - Fee Related
- 2007-05-25 EA EA200802409A patent/EA017558B1/ru not_active IP Right Cessation
- 2007-05-25 US US12/302,067 patent/US7951385B2/en active Active
- 2007-05-25 JP JP2009512739A patent/JP2009538614A/ja active Pending
- 2007-05-25 CA CA002647161A patent/CA2647161A1/en not_active Abandoned
- 2007-05-25 AU AU2007266675A patent/AU2007266675B2/en not_active Ceased
- 2007-05-25 WO PCT/IB2007/051982 patent/WO2007138538A2/en not_active Ceased
- 2007-05-25 EP EP07736018.8A patent/EP2021457B1/en active Active
- 2007-05-25 AP AP2008004626A patent/AP2841A/xx active
- 2007-05-25 NZ NZ571619A patent/NZ571619A/en not_active IP Right Cessation
- 2007-05-25 CN CN2007800198580A patent/CN101454440B/zh not_active Expired - Fee Related
-
2008
- 2008-11-03 NO NO20084577A patent/NO20084577L/no not_active Application Discontinuation
- 2008-11-26 IL IL195520A patent/IL195520A0/en unknown
-
2011
- 2011-04-26 US US13/094,155 patent/US8444998B2/en not_active Expired - Fee Related
-
2017
- 2017-02-16 IL IL250634A patent/IL250634A0/en unknown
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011045764A1 (en) * | 2009-10-15 | 2011-04-21 | Cipla Medpro Research And Development (Pty) Ltd | A product for delivering antimicrobially active substances to an infected site |
| US20220062181A1 (en) * | 2017-09-19 | 2022-03-03 | Advaxis, Inc. | Compositions and methods for lyophilization of bacteria or listeria strains |
| US12239738B2 (en) * | 2017-09-19 | 2025-03-04 | Advaxis, Inc. | Compositions and methods for lyophilization of bacteria or listeria strains |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2007266675A1 (en) | 2007-12-06 |
| AU2007266675B2 (en) | 2012-09-06 |
| US20110268703A1 (en) | 2011-11-03 |
| AP2841A (en) | 2014-02-28 |
| AP2008004626A0 (en) | 2008-10-31 |
| US20090297482A1 (en) | 2009-12-03 |
| CA2647161A1 (en) | 2007-12-06 |
| US8444998B2 (en) | 2013-05-21 |
| NO20084577L (no) | 2008-12-19 |
| KR101521123B1 (ko) | 2015-05-19 |
| EP2021457B1 (en) | 2015-02-11 |
| NZ571619A (en) | 2011-10-28 |
| IL195520A0 (en) | 2011-08-01 |
| WO2007138538A3 (en) | 2008-04-17 |
| IL250634A0 (en) | 2017-03-30 |
| EA017558B1 (ru) | 2013-01-30 |
| KR20090023626A (ko) | 2009-03-05 |
| EA200802409A1 (ru) | 2009-10-30 |
| CN101454440A (zh) | 2009-06-10 |
| US7951385B2 (en) | 2011-05-31 |
| EP2021457A2 (en) | 2009-02-11 |
| CN101454440B (zh) | 2013-05-29 |
| JP2009538614A (ja) | 2009-11-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7951385B2 (en) | Probiotic strain and antimicrobial peptide derived therefrom | |
| EP2590662B1 (fr) | Complexe macromoleculaire provenant de bifidobacterium longum et utilisation dudit complexe pour prevenir et traiter les rhumatismes inflammatoires | |
| EP2848682B1 (en) | Isolation, identification and characterization of strains with probiotic activity from the faeces of babies fed exclusively with breast milk | |
| Todorov et al. | Bacteriocin production and resistance to drugs are advantageous features for Lactobacillus acidophilus La-14, a potential probiotic strain | |
| US9963488B2 (en) | Variants of the lantibiotic MU1140 and other lantibiotics with improved pharmacological properties and structural features | |
| KR20190103234A (ko) | 과민성 대장 증후군 또는 염증성 대장 질환의 치료에 사용하기 위한 미생물 라이소자임 | |
| KR101310123B1 (ko) | 헬리코박터 파이로리의 생육을 저해하는 김치 유래 젖산균 | |
| CN114574405B (zh) | 植物乳杆菌菌株wka86及其在制备防治口臭制品方面的用途与制品 | |
| KR101364695B1 (ko) | 헬리코박터 파이로리의 생육을 저해하는 타락 유래 젖산균 | |
| EP3484442A1 (en) | Lantibiotic variants and uses thereof | |
| AU2005329462B2 (en) | Bacteriocins and novel bacterial strains | |
| Antonio et al. | A Review of Lactic Acid Bacteria and their Bacteriocins: Classification, Biosynthesis, and Mechanism against Oral Pathogens | |
| JP2004519236A (ja) | ビフィドバクテリウム由来の新規なプラスミド、これを利用した組換え発現ベクターおよび形質転換方法 | |
| CA2522362A1 (fr) | Produit immunomodulateur obtenu a partir d'une culture de bifidobacterium et compositions le contenant | |
| CN114149942A (zh) | 一株东洋芽孢杆菌及其应用 | |
| EP1148064A1 (en) | Lactobacillus johnsonii bacteriocin, active against Helicobacter pylori | |
| JP5145506B2 (ja) | バシラス属細菌、及びその用途 | |
| BRPI0621581A2 (pt) | cepas de enterococcus e streptococcus e bacteriocinas | |
| WO2023150886A1 (en) | Probiotic strain for countering caries pathogens | |
| Şanlıbaba | Antibiotic Resistance and Virulence Factors of Enterococci | |
| Yu | Antagonism of Clostridium botulinum by Clostridium species | |
| Sarmah et al. | ARTICLE INFO ABSTRACT |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200780019858.0 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 07736018 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2647161 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2007266675 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 571619 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 4174/KOLNP/2008 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2007266675 Country of ref document: AU Date of ref document: 20070525 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2007736018 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009512739 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 200802409 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12302067 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 250634 Country of ref document: IL |