WO2006023781A2 - Neublastin variants - Google Patents

Neublastin variants Download PDF

Info

Publication number
WO2006023781A2
WO2006023781A2 PCT/US2005/029637 US2005029637W WO2006023781A2 WO 2006023781 A2 WO2006023781 A2 WO 2006023781A2 US 2005029637 W US2005029637 W US 2005029637W WO 2006023781 A2 WO2006023781 A2 WO 2006023781A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
polypeptide
arginine
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2005/029637
Other languages
English (en)
French (fr)
Other versions
WO2006023781A3 (en
Inventor
Anthony Rossomando
Laura Silvian
R. Blake Pepinsky
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biogen Inc
Biogen MA Inc
Original Assignee
Biogen Idec Inc
Biogen Idec MA Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA2577755A priority Critical patent/CA2577755C/en
Priority to EA200700460A priority patent/EA013565B1/ru
Priority to AU2005277226A priority patent/AU2005277226B2/en
Priority to NZ553431A priority patent/NZ553431A/en
Priority to BRPI0514534-1A priority patent/BRPI0514534A/pt
Priority to AT05789285T priority patent/ATE474586T1/de
Priority to CN2005800359225A priority patent/CN101123978B/zh
Priority to UAA200702764A priority patent/UA92590C2/uk
Priority to HR20100474T priority patent/HRP20100474T1/hr
Priority to US11/573,773 priority patent/US8263553B2/en
Priority to DE602005022457T priority patent/DE602005022457D1/de
Priority to PL05789285T priority patent/PL1786454T3/pl
Priority to HK07112571.5A priority patent/HK1103991B/en
Priority to SI200531099T priority patent/SI1786454T1/sl
Priority to MX2007002029A priority patent/MX2007002029A/es
Priority to JP2007528061A priority patent/JP4852545B2/ja
Application filed by Biogen Idec Inc, Biogen Idec MA Inc filed Critical Biogen Idec Inc
Priority to DK05789285.3T priority patent/DK1786454T3/da
Priority to EP05789285A priority patent/EP1786454B1/en
Publication of WO2006023781A2 publication Critical patent/WO2006023781A2/en
Priority to IL181311A priority patent/IL181311A/en
Priority to IS8608A priority patent/IS8608A/is
Priority to ZA2007/01395A priority patent/ZA200701395B/en
Anticipated expiration legal-status Critical
Priority to NO20071449A priority patent/NO20071449L/no
Publication of WO2006023781A3 publication Critical patent/WO2006023781A3/en
Priority to IL205201A priority patent/IL205201A0/en
Priority to US13/541,302 priority patent/US20130096065A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • C07K14/495Transforming growth factor [TGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • A61K38/185Nerve growth factor [NGF]; Brain derived neurotrophic factor [BDNF]; Ciliary neurotrophic factor [CNTF]; Glial derived neurotrophic factor [GDNF]; Neurotrophins, e.g. NT-3
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/02Drugs for disorders of the nervous system for peripheral neuropathies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/04Centrally acting analgesics, e.g. opioids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • C07K14/4756Neuregulins, i.e. p185erbB2 ligands, glial growth factor, heregulin, ARIA, neu differentiation factor
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the invention relates to protein chemistry, molecular biology, and neurobiology.
  • Neublastin also known as Artemin and Enovin, is a 24-kDa homodimeric secreted protein that promotes the survival of neurons of the peripheral and central nervous system such as dopaminergic neurons (Baudet et al., 2000, Development,
  • Neublastin is a member of the glial cell line-derived neurotrophic factor (GDNF) ligand family. At the cellular level, GDNF members activate the receptor tyrosine kinase, RET. RET associates with a co-receptor, GDNF family receptor alpha (GFRalpha), a glycosylphosphatidyl inositol (GPI) linked membrane protein that provides ligand specificity for RET.
  • GFRalpha GDNF family receptor alpha
  • GPI glycosylphosphatidyl inositol
  • neublastin has clinical application in the general treatment of neuropathy and more specifically in the treatment of neuropathic pain.
  • Neublastin and the other GDNF family members are members of the transforming growth factor beta (TGF beta) superfamily and thus, are characterized by the presence of seven conserved cysteine residues with similar spacing which form the structure of a cysteine knot (Saarma, 1999, Microsc. Res. Tech., 45:292).
  • Each monomer contains two disulfide bonds that form a closed loop structure encircling the third disulfide to form a tight knot structure.
  • the seventh cysteine contained within each monomer forms an intermolecular disulfide bond, covalently linking the monomers to form the final dimer product (Rattenholl et al 2000, J. MoI. Biol, 305:523).
  • TGF beta family members are synthesized as pre pro proteins that eventually are secreted as a mature homodimer after cleavage of the signal peptide and pro-domain ⁇ see e.g. Rattenholl, et al., 2000, J. MoI. Biol, 305:523; Fairlie et al., 2001, J. Biol. Chem., 276(20): 16911). Both the signal peptide and pro-domain mediate proper secretion for TGF beta family members (Rattenholl et al., 2000, J. MoI Biol, 305:523; Rattenholl et al., 2001, Eur. J. Biochem., 268:3296).
  • the invention is based, at least in part, on the discovery that Neublastin binds to heparin sulfate and that particular amino acid residues in the Neublastin polypeptide contribute to this binding event. Substitution of selected amino acid residues was found to decrease heparin binding by variant Neublastin polypeptides and increase bioactivity and bioavailability of the variants.
  • the invention features a polypeptide containing an amino acid sequence that is at least 80% identical to amino acids 15-113 of SEQ ID NO : 1 , wherein the amino acid sequence contains at least one amino acid substitution, relative to SEQ ID NO: 1, selected from the group consisting of: (i) an amino acid other than arginine at the position corresponding to position 48 of SEQ ID NO: 1 (e.g., the arginine is substituted with a non-conservative amino acid residue such as glutamic acid); (ii) an amino acid other than arginine at the position corresponding to position 49 of SEQ ID NO:1 (e.g., the arginine is substituted with a non-conservative amino acid residue such as glutamic acid); and (iii) an amino acid other than arginine at the position corresponding to position 51 of SEQ ID NO:1 (e.g., the arginine is substituted with a non-conservative amino acid residue such as glutamic acid).
  • the polypeptide
  • the amino acid sequence contains amino acids other than arginine at the positions corresponding to position 48 and position 49 of SEQ ID NO: 1.
  • the arginine residue at position 48 and the arginine reside at position 49 of SEQ ID NO.l can be substituted with non-conservative amino acid residues (e.g., glutamic acid).
  • the amino acid sequence is at least 90%, at least 95%, or at least 98% identical to amino acids 15-113 of SEQ ID NO:1. Also disclosed is a polypeptide containing amino acids 15-113 of SEQ ID NO:2, amino acids 15-113 of SEQ ID NO:3, amino acids 15-113 of SEQ ID NO:4, amino acids 15-113 of SEQ ID NO:5, amino acids 15-113 of SEQ ID NO:8, or amino acids 15-113 of SEQ ID NO.9.
  • the polypeptide contains amino acids 10-113 of SEQ ID NO:2, amino acids 10-113 of SEQ ID NO:3, amino acids 10-113 of SEQ ID NO:4, amino acids 10-113 of SEQ ID NO:5, amino acids 10-113 of SEQ ID NO:8, or amino acids 10-113 of SEQ ID NO:9.
  • the polypeptide contains the amino acid sequence of SEQ ID NO:2, the amino acid sequence of SEQ ID NO:3, the amino acid sequence of SEQ ID NO:4, the amino acid sequence of SEQ ID NO:5, the amino acid sequence of SEQ ID NO:8, or the amino acid sequence of SEQ ID NO:9.
  • polypeptide when dimerized, binds to a complex containing GFRalpha3 and RET.
  • amino acid sequence is at least 90%, at least 95%, or at least 98% identical to amino acids 15-113 of SEQ ID NO:1.
  • polypeptide containing an amino acid sequence at least 80% identical to SEQ ID NO:1, wherein the amino acid sequence comprises at least one amino acid substitution, relative to SEQ ID NO:1, selected from the group consisting of: (i) an amino acid other than arginine at the position corresponding to position 7 of SEQ ID NO:1 (e.g., the arginine is substituted with a non-conservative amino acid residue such as glutamic acid); (ii) an amino acid other than arginine at the position corresponding to position 9 of SEQ ID NO: 1 (e.g., the arginine is substituted with a non-conservative amino acid residue such as glutamic acid); and (iii) an amino acid other than arginine at the position corresponding to position 14 of SEQ ID NO: 1 (e.g., the arginine is substituted with a non-conservative amino acid residue such as glutamic acid).
  • the polypeptide when dimerized, binds to a complex
  • the invention also features conjugates containing a polypeptide described herein conjugated to a non-naturally occurring polymer.
  • An exemplary polymer is a water- soluble synthetic polymer such as a polyalkylene glycol (e.g., polyethylene glycol).
  • the invention also features a fusion protein containing a polypeptide described herein and a heterologous amino acid sequence.
  • the invention also features a dimer containing two of the polypeptides, conjugates, or fusion proteins described herein.
  • the invention also features a pharmaceutical composition containing a polypeptide, dimer, conjugate, or fusion protein described herein and a pharmaceutically acceptable carrier or excipient.
  • nucleic acid containing a sequence that encodes a polypeptide described herein, an expression vector containing the nucleic acid, and a cell containing the expression vector.
  • a method of making a polypeptide including the following steps: (i) providing a cell containing an expression vector containing a nucleic acid encoding a polypeptide described herein, and (ii) culturing the cell under conditions that permit expression of the nucleic acid.
  • the invention also features a method of treating or preventing a nervous system disorder in a mammal by administering to the mammal a therapeutically effective amount of a polypeptide, dimer, conjugate, fusion protein, or pharmaceutical composition described herein.
  • the invention also features a method of treating neuropathic pain in a mammal by administering to the mammal a therapeutically effective amount of a polypeptide, dimer, conjugate, fusion protein, or pharmaceutical composition described herein.
  • the invention also features a method of activating the RET receptor in a mammal by administering to the mammal an effective amount of a polypeptide, dimer, conjugate, fusion protein, or pharmaceutical composition described herein.
  • a polypeptide, dimer, conjugate, fusion protein, or pharmaceutical composition described herein is that they have decreased heparin binding ability as compared to wild type Neublastin. Decreased heparin binding results in a decreased clearance of the variant polypeptide in vivo.
  • a variant Neublastin polypeptide having substitutions at amino acid positions 48 and 49 was unexpectedly found to have greatly deceased heparin binding ability and greatly increased potency and bioavailabilty as compared to single amino acid mutants and/or wild type Neublastin.
  • the double mutant was found to exhibit an approximately 185-fold increase in serum exposure as compared to wild type Neublastin.
  • this double mutant was found to exhibit an over five fold increase in expression in vitro as compared to wild type Neublastin, thereby facilitating large scale production of the protein.
  • the advantages and unexpected properties of the variant Neublastin polypeptides allow for treatment of subjects using lower doses of protein and/or allow for lengthened intervals between administrations (as compared to treatments with the wild type protein).
  • Fig. 1 is an alignment of wild type human (SEQ ID NO: 10), mouse (SEQ ID NO: 11), and rat (SEQ ID NO: 12) pre pro Neublastin polypeptides.
  • the left and right vertical lines indicate, respectively, the start of the mature 113 amino and 104 amino acid forms.
  • the RRXR heparin binding motif is boxed.
  • Fig. 2 A depicts a cationic elution profile of wild-type Neublastin (Peak D) and three single Arg-to-Glu substitution mutants (Peaks A, B, and C) (sloping line represents the theoretical sodium chloride concentration for any given volume eluted from the column). Data are a representation of the OD280 values of the eluted sample.
  • Fig. 2B depicts a Heparin Sepharose elution profile of wild-type Neublastin
  • Figs. 3A-3B are photographs depicting SDS/PAGE of wild-type Neublastin following anionic chromatography in the presence (2A) or absence (2 B) of heparin.
  • Fig. 4 is a graph depicting the results of a Neublastin CHO cell binding assay.
  • Fig. 5 is a graph depicting the results of a heparin binding ELISA using wild type human NBN113, wild type human NBN 104, Arg48E, Arg49E, Arg51E, and Arg48, 49E.
  • Fig. 6 is a graph depicting the results of KIRA analysis of wild type rat NBN 113,
  • Fig. 7 A is a graph depicting the results of KIRA analysis of wild type human Neublastin and Arg48,49E mutant human Neublastin (113 amino acid form).
  • Fig. 7B is a graph depicting the results of KIRA analysis of wild type human Neublastin, Arg48,49E mutant human Neublastin (104 amino acid form), Arg48,5 IE human Neublastin (113 amino acid form), and Arg49,5 IE human Neublastin (113 amino acid form).
  • Fig. 8 is a graph depicting the results of ternary complex analysis of wild type human Neublastin, Arg48E, Arg49E, Arg51E, Arg48,49E, and Arg48,49,5 IE Neublastin forms.
  • Fig. 9 is a graph depicting the results of ternary complex analysis of wild type Neublastin, Arg48E, Arg49E, Arg51E, Arg48,49E, and Arg48,49,51E Neublastin forms.
  • Fig. 10 is a graph depicting the results of pharmacokinetics analysis of wild type Neublastin and Arg48,49E following a single bolus 7 mg/kg subcutaneous injection (Neublastin plasma concentrations were determined using the Neublastin detection ELISA).
  • Fig. 11 is a graph depicting the results of pharmacokinetics analysis of wild type Neublastin and Arg48,49E following a single bolus 1 mg/kg intravenous injection (Neublastin plasma concentrations were determined using the Neublastin detection ELISA).
  • Fig. 12 is a graph depicting the results of pharmacokinetics analysis of 2X10K PEGylated Arg48,49E Neublastin following a single bolus subcutaneous 7mg/kg (data presented are extrapolated down to 1 mg/kg) injection and 2X10K PEGylated Arg48,49E Neublastin administered intravenously at 1 mg/kg (Neublastin plasma concentrations were determined using the Neublastin detection ELISA).
  • Fig. 13 is a graph depicting relative Neublastin expression levels in CHO cells transfected with plasmids encoding wild type Neublastin or Arg48,49E.
  • Fig. 14 is a graph depicting relative Neublastin expression levels in the leading Arg48,49E double mutant transfected CHO cell lines and a leading wild type Neublastin transfected CHO cell line.
  • the present invention provides variant Neublastin polypeptides having substitutions at selected amino acid residues.
  • specific residues in the wild type Neublastin polypeptide have been found to be important for heparin binding. Because heparin binding is believed to contribute to clearance of Neublastin in vivo, substitutions at one or more of these specific residues are expected to decrease heparin binding and thereby increase serum exposure of the variant polypeptide.
  • Mature wild type human Neublastin is 113 amino acids in length and has the following amino acid sequence: AGGPGSRARAAGARGCRLRSQLVPVRALGLGHR SDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAV SFMDVNSTWRTVDRLSATACGCLG (SEQ ID NO: 1).
  • a variant Neublastin polypeptide contains an amino acid substitution, relative to SEQ ID NO: 1, at (i) an arginine residue at one or more of positions 48, 49, or 51, and/or (ii) one or more of Ser 46, Ser 73, GIy 72, Arg 39, GIn 21, Ser 20, Arg 68, Arg 33, His 32, VaI 94, Arg 7, Arg 9, or Arg 14.
  • any reference herein to a Neublastin amino acid reside by position number refers to the numbering of residues relative to SEQ ID NO:1.
  • a Neublastin amino acid residue designated for substitution e.g., an arginine residue at position 48, 49, and/or 51
  • a non-conservative amino acid residue e.g., glutamic acid
  • substitution of Arg48, Arg 49, and/or Arg 51 with a non- conservative amino acid can result in a variant Neublastin polypeptide that has reduced heparin binding activity but retained (or even enhanced) Neublastin biological activity.
  • Exemplary amino acids that can be substituted an amino acid residue identified herein include glutamic acid, aspartic acid, and alanine.
  • a biologically active variant Neublastin polypeptide when dimerized, binds to a ternary complex containing GFRalpha3 and RET. Any method for detecting binding to this complex can be used to evaluate the biological activity a variant Neublastin polypeptide. Exemplary assays for detecting the ternary complex-binding ability of a variant Neublastin polypeptide are described in WOOO/01815 and in Example 7.
  • a variant Neublastin polypeptide can also be assessed to evaluate its ability to trigger the Neublastin signaling cascade.
  • the Kinase Receptor Activation (KIRA) assay described in Example 6 can be used to assess the ability of a variant Neublastin polypeptide to induce RET autophosphorylation ⁇ See also, Sadick et al., 1996, Anal Biochem., 235(2):207).
  • a variant Neublastin polypeptide can also contain one or more additions, substitutions, and/or deletions at other amino acid positions, as detailed in the following sections.
  • a variant Neublastin polypeptide can, in addition to having one or more of the amino acid substitutions described herein, also vary in length.
  • the mature human Neublastin polypeptide (SEQ ID NO: 1) consists of the carboxy terminal 113 amino acids of pre pro Neublastin, not all of the 113 amino acids are required to achieve useful Neublastin biological activity. Amino terminal truncation is permissible.
  • a variant Neublastin polypeptide can contain one or more of the amino acid substitutions described herein in the context of the carboxy terminal 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, or 113 amino acids of SEQ ID NO:1 (i.e., its length can be 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, or 113 amino acids).
  • a variant Neublastin polypeptide can, in addition to having one or more of the amino acid substitutions described herein (and optionally having a truncation described herein), also vary in sequence. In particular, certain amino acid substitutions can be introduced into the Neublastin sequence without appreciable loss of a Neublastin biological activity.
  • a polypeptide (i) contains one or more of the amino acid substitutions described herein, and (ii) is at least 70%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO:1 (or 70%, 80%, 85%, 90%, 95%, 98% or 99% identical to amino acids 15-113 of SEQ ID NO.l).
  • a variant Neublastin polypeptide differing in sequence from SEQ ID NO:1 may include one or more conservative amino acid substitutions, one or more non-conservative amino acid substitutions, and/or one or more deletions or insertions.
  • Fig. 1 is an alignment of the wild type human, mouse, and rat pre pro Neublastin polypeptides.
  • the vertical lines in Fig.l indicate the start of the mature 113 amino acid form (left vertical line) and 104 amino acid form (right vertical line) of Neublastin.
  • the RRXR heparin binding motif is boxed.
  • This alignment of naturally occurring, bioactive forms of Neublastin indicates specific exemplary residues (i.e., those that are not conserved among the human, mouse, and rat forms) that can be substituted without eliminating bioactivity. Percent identity between amino acid sequences can be determined using the
  • BLAST 2.0 program Sequence comparison can be performed using an ungapped alignment and using the default parameters (Blossom 62 matrix, gap existence cost of 11, per residue gap cost of 1, and a lambda ratio of 0.85).
  • the mathematical algorithm used in BLAST programs is described in Altschul et al., 1997, Nucleic Acids Research 25:3389-3402. A conservative substitution is the substitution of one amino acid for another with similar characteristics.
  • Conservative substitutions include substitutions within the following groups: valine, alanine and glycine; leucine, valine, and isoleucine; aspartic acid and glutamic acid; asparagine and glutamine; serine, cysteine, and threonine; lysine and arginine; and phenylalanine and tyrosine.
  • the non-polar hydrophobic amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine.
  • the polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine and glutamine.
  • the positively charged (basic) amino acids include arginine, lysine and histidine.
  • the negatively charged (acidic) amino acids include aspartic acid and glutamic acid. Any substitution of one member of the above-mentioned polar, basic or acidic groups by another member of the same group can be deemed a conservative substitution.
  • Non-conservative substitutions include those in which (i) a residue having an electropositive side chain (e.g., Arg, His or Lys) is substituted for, or by, an electronegative residue (e.g., GIu or Asp), (ii) a hydrophilic residue (e.g., Ser or Thr) is substituted for, or by, a hydrophobic residue (e.g., Ala, Leu, He, Phe or VaI), (iii) a cysteine or proline is substituted for, or by, any other residue, or (iv) a residue having a bulky hydrophobic or aromatic side chain (e.g., VaI, He, Phe or Trp) is substituted for, or by, one having a smaller side chain (e.g., Ala, Ser) or no side chain (e.g., GIy).
  • an electropositive side chain e.g., Arg, His or Lys
  • an electronegative residue e.g., GIu
  • Exemplary variant Neublastin polypeptides are disclosed in Table 1. Amino acid residues of the variant Neublastin polypeptides that are mutated as compared to the corresponding wild type position are bolded and underlined. In addition, the Neublastin polypeptide (113, 99, or 104 amino acids in length) used as the background for the substitution is depicted in Table 1.
  • a variant Neublastin polypeptide can be optionally coupled to a polymer (e.g., a polyalkylene glycol moiety such as a polyethylene glycol moiety).
  • the polymer is coupled to the polypeptide at a site on the Neublastin polypeptide that is an N terminus.
  • the variant Neublastin polypeptide includes at least one amino acid substitution with respect to SEQ ID NO: 1 (or with respect to amino acids 15-113 of SEQ ID NO:1), which provides an internal polymer conjugation site to which a polymer can be conjugated.
  • the polymer is coupled to the variant Neublastin polypeptide at a residue (numbered in accordance with the sequence of SEQ ID NO: 1) selected from the group consisting of position 14, position 39, position 68, and position 95.
  • a residue numbered in accordance with the sequence of SEQ ID NO: 1 selected from the group consisting of position 14, position 39, position 68, and position 95.
  • Exemplary Neublastin variants that provide internal polymer conjugation sites are described in WO 02/060929 and WO 04/069176 (the contents of which are incorporated herein by reference).
  • a polypeptide can optionally contain heterologous amino acid sequences in addition to a variant Neublastin polypeptide.
  • heterologous refers to a sequence that originates from a source foreign to the particular host cell, or, if from the same host cell, is modified from its original form.
  • exemplary heterologous sequences include a heterologous signal sequence (e.g., native rat albumin signal sequence, a modified rat signal sequence, or a human growth hormone signal sequence) or a sequence used for purification of a variant Neublastin polypeptide (e.g., a histidine tag).
  • Neublastin polypeptides can be isolated using methods known in the art. Naturally occurring Neublastin polypeptides can be isolated from cells or tissue sources using standard protein purification techniques. Alternatively, mutated Neublastin polypeptides can be synthesized chemically using standard peptide synthesis techniques. The synthesis of short amino acid sequences is well established in the peptide art. See, e.g., Stewart, et ah, Solid Phase Peptide Synthesis (2d ed., 1984).
  • variant Neublastin polypeptides are produced by recombinant DNA techniques.
  • a nucleic acid molecule encoding a variant Neublastin polypeptide can be inserted into a vector, e.g., an expression vector, and the nucleic acid can be introduced into a cell.
  • Suitable cells include, e.g., mammalian cells (such as human cells or CHO cells), fungal cells, yeast cells, insect cells, and bacterial cells.
  • the cell is preferably cultured under conditions allowing for expression of a variant Neublastin polypeptide.
  • the variant Neublastin polypeptide can be recovered from a cell suspension if desired.
  • “recovered” means that the mutated polypeptide is removed from those components of a cell or culture medium in which it is present prior to the recovery process.
  • the recovery process may include one or more refolding or purification steps.
  • Variant Neublastin polypeptides can be constructed using any of several methods known in the art.
  • One such method is site-directed mutagenesis, in which a specific nucleotide (or, if desired a small number of specific nucleotides) is changed in order to change a single amino acid (or, if desired, a small number of predetermined amino acid residues) in the encoded variant Neublastin polypeptide.
  • site-directed mutagenesis kits are commercially available.
  • One such kit is the "Transformer Site Directed Mutagenesis Kit” sold by Clontech Laboratories (Palo Alto, CA).
  • a variant Neublastin polypeptide can be incorporated into a pharmaceutical composition containing a therapeutically effective amount of the polypeptide and one or more adjuvants, excipients, carriers, and/or diluents.
  • Acceptable diluents, carriers and excipients typically do not adversely affect a recipient's homeostasis (e.g., electrolyte balance).
  • Acceptable carriers include biocompatible, inert or bioabsorbable salts, buffering agents, oligo- or polysaccharides, polymers, viscosity-improving agents, preservatives and the like.
  • One exemplary carrier is physiologic saline (0.15 M NaCl, pH 7.0 to 7.4).
  • Another exemplary carrier is 50 mM sodium phosphate, 100 mM sodium chloride. Further details on techniques for formulation and administration of pharmaceutical compositions can be found in, e.g., REMINGTON'S
  • compositions containing a variant Neublastin polypeptide can be systemic or local.
  • Pharmaceutical compositions can be formulated such that they are suitable for parenteral and/or non-parenteral administration.
  • Specific administration modalities include subcutaneous, intravenous, intramuscular, intraperitoneal transdermal, intrathecal, oral, rectal, buccal, topical, nasal, ophthalmic, intra-articular, intra-arterial, sub-arachnoid, bronchial, lymphatic, vaginal, and intra-uterine administration.
  • Formulations suitable for parenteral administration conveniently contain a sterile aqueous preparation of the variant Neublastin polypeptide, which preferably is isotonic with the blood of the recipient (e.g., physiological saline solution). Formulations may be presented in unit-dose or multi-dose form.
  • An exemplary formulation contains a variant Neublastin polypeptide described herein and the following buffer components: sodium succinate (e.g., 10 mM); NaCl
  • Formulations suitable for oral administration may be presented as discrete units such as capsules, cachets, tablets, or lozenges, each containing a predetermined amount of the variant Neublastin polypeptide; or a suspension in an aqueous liquor or a non-aqueous liquid, such as a syrup, an elixir, an emulsion, or a draught.
  • a composition can be administered to the subject, e.g., systemically at a dosage from O.Ol ⁇ g/kg to 1000 ⁇ g/kg body weight of the subject, per dose.
  • the dosage is from 1 ⁇ g/kg to 100 ⁇ g/kg body weight of the subject, per dose.
  • the dosage is from 1 ⁇ g/kg to 30 ⁇ g/kg body weight of the subject, per dose, e.g., from 3 ⁇ g/kg to 10 ⁇ g/kg body weight of the subject, per dose.
  • a variant Neublastin polypeptide is first administered at different dosing regimens.
  • the unit dose and regimen depend on factors that include, e.g., the species of mammal, its immune status, the body weight of the mammal.
  • protein levels in tissue are monitored using appropriate screening assays as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen.
  • the frequency of dosing for a variant Neublastin polypeptide is within the skills and clinical judgement of physicians.
  • the administration regime is established by clinical trials which may establish optimal administration parameters.
  • the practitioner may vary such administration regimes according to the subject's age, health, weight, sex and medical status.
  • the frequency of dosing may also vary between acute and chronic treatments for neuropathy.
  • the frequency of dosing may be varied depending on whether the treatment is prophylactic or therapeutic.
  • Variant Neublastin polypeptides are useful for modulating metabolism, growth, differentiation, or survival of a nerve or neuronal cell.
  • variant Neublastin polypeptides can be used to treat or alleviate a disorder or disease of a living animal, e.g., a human, which disorder or disease is responsive to the activity of a neurotrophic agent.
  • the variant Neublastin polypeptides disclosed herein can be used in methods for treating a disorder characterized by damage to sensory neurons or retinal ganglion cells, including neurons in the dorsal root ganglia or in any of the following tissues: the geniculate, petrosal and nodose ganglia; the vestibuloacoustic complex of the eighth cranial nerve; the ventrolateral pole of the maxillomandibular lobe of the trigeminal ganglion; and the mesencephalic trigeminal nucleus.
  • sensory and/or autonomic system neurons can be treated.
  • nociceptive and mechanoreceptive neurons can be treated, more particularly A-delta fiber, C-fiber and A-beta fiber neurons.
  • sympathetic and parasympathetic neurons of the autonomic system can be treated.
  • motor neuron diseases such as amyotrophic lateral sclerosis ("ALS") and spinal muscular atrophy can be treated.
  • the variant Neublastin polypeptides can be used to enhance nerve recovery following traumatic injury.
  • a nerve guidance channel with a matrix containing polymer-conjugated Neublastin polypeptides, or fusion or conjugates of mutated Neublastin polypeptides can be used.
  • Such nerve guidance channels are disclosed, e.g., United States Patent No. 5,834,029.
  • the variant Neublastin polypeptides are used in the treatment of various disorders in the eye, including photoreceptor loss in the retina in patients afflicted with macular degeneration, retinitis pigmentosa, glaucoma, and similar diseases.
  • the variant Neublastin polypeptides (and pharmaceutical compositions comprising same) are used for treating neuropathic pain, for treating tactile allodynia, for reducing loss of pain sensitivity associated with neuropathy, for treating viral infections and viral-associated neuropathies, for treating painful diabetic neuropathy, and for treating nervous system disorders. The methods are discussed in detail in the following subsections.
  • variant Neublastin polypeptides disclosed herein can be used in methods for treating neuropathic pain in a subject comprising administering to the subject an effective amount of a variant
  • Neublastin polypeptide either alone, or by also administering to the subject an effective amount of an analgesia-inducing compound selected from the group consisting of opioids, anti-arrhythmics, topical analgesics, local anaesthetics, anticonvulsants, antidepressants, corticosteroids and non-steroidal anti-inflammatory drugs (NSAIDS).
  • an analgesia-inducing compound selected from the group consisting of opioids, anti-arrhythmics, topical analgesics, local anaesthetics, anticonvulsants, antidepressants, corticosteroids and non-steroidal anti-inflammatory drugs (NSAIDS).
  • the analgesia-inducing compound is an anticonvulsant.
  • the analgesia-inducing compound is gabapentin ((l-aminomethyl)cyclohexane acetic acid) orpregabalin (S-(+)-4-amino-3- (2-methylpropyl)
  • the variant Neublastin polypeptides disclosed herein can be used in the treatment of pain associated with peripheral neuropathies.
  • peripheral neuropathies which can be treated are trauma-induced neuropathies, e.g., those caused by physical injury or disease state, physical damage to the brain, physical damage to the spinal cord, stroke associated with brain damage, and neurological disorders related to neurodegeneration.
  • the variant Neublastin polypeptides disclosed herein can be used in the treatment of a number of peripheral neuropathies, including: (a) trauma-induced neuropathies, (b) chemotherapy-induced neuropathies, (c) toxin-induced neuropathies (including but not limited to neuropathies induced by alcoholism, vitamin B 6 intoxication, hexacarbon intoxication, amiodarone, chloramphenicol, disulfiram, isoniazide, gold, lithium, metronidazole, misonidazole, nitrofurantoin), (d) drug-induced neuropathies, including therapeutic drug-induced neuropathic pain (such as caused by anti-cancer agents, particularly anti-cancer agents selected from the group consisting of taxol, taxotere, cisplatin, nocodazole, vincristine, vindesine and vinblastine; and such as caused by anti- viral agents, particularly anti- viral agents selected from the group consisting of ddl, DDC
  • herpes zoster which may lead to post- herpetic neuralgia), a human immunodeficiency virus (HIV), and a papilloma virus
  • auto-immune neuropathies including but not limited to Guillain-Barre syndrome, chronic inflammatory de-myelinating polyneuropathy, monoclonal gammopathy of undetermined significance and polyneuropathy
  • trigeminal neuralgia and entrapment syndromes including but not limited to Carpel tunnel
  • other neuropathic pain syndromes including post-traumatic neuralgia, phantom limb pain, multiple sclerosis pain, complex regional pain syndromes (including but not limited to reflex sympathetic dystrophy, causalgia), neoplasia- associated pain, vasculitic/angiopathic neuropathy, and sciatica.
  • Neuropathic pain may be manifested as allodynia, hyperalgesia, spontaneous pain or phantom pain.
  • the variant Neublastin polypeptides disclosed herein can be used in the treatment of tactile allodynia in a subject.
  • tactile allodynia typically refers to the condition in a subject where pain is evoked by stimulation of the skin (e.g. touch) that is normally innocuous.
  • tactile allodynia is treated by administering to the subject a pharmaceutically effective amount of a variant Neublastin polypeptide.
  • tactile allodynia may be treated by administering to a subject an effective amount of a variant Neublastin polypeptide either alone, or by administering to the subject an effective amount of a variant Neublastin polypeptide with an effective amount of an analgesia-inducing compound selected from the group consisting of opioids, anti- arrhythmics, topical analgesics, local anaesthetics, anticonvulsants, antidepressants, corticosteroids and NSAIDS.
  • the analgesia-inducing compound is an anticonvulsant.
  • the analgesia-inducing compound is gabapentin ((l-aminomethyl)cyclohexane acetic acid) or pregabalin (S-(+)-4-amino-3- (2-methylpropyl)butanoic acid).
  • a variant Neublastin polypeptide is administered in association with a therapeutic agent, including but not limited to an anti-cancer agent or an anti-viral agent.
  • Anti-cancer agents include, but are not limited to, taxol, taxotere, cisplatin, nocodazole, vincristine, vindesine and vinblastine.
  • Anti-viral agents include, but are not limited to, ddl, DDC, d4T, foscarnet, dapsone, metronidazole, and isoniazid. 3. Treatment for Reduction of Loss of Pain Sensitivity
  • variant Neublastin polypeptides disclosed herein can be used in a method for reducing the loss of pain sensitivity in a subject afflicted with a neuropathy.
  • the neuropathy is diabetic neuropathy.
  • the loss of pain sensitivity is a loss in thermal pain sensitivity. This methods include both prophylactic and therapeutic treatment.
  • a variant Neublastin polypeptide is administered to a subject at risk of developing loss of pain sensitivity (such a subject would be expected to be a subject with an early stage neuropathy).
  • the treatment with a variant Neublastin polypeptide under such circumstances would serve to treat at-risk patients preventively.
  • a variant Neublastin polypeptide is administered to a subject who has experienced loss of pain sensitivity as a result of affliction with a neuropathy (such a subject would be expected to be a subject with a late stage neuropathy).
  • the treatment with a variant Neublastin polypeptide under such circumstances would serve to rescue appropriate pain sensitivity in the subject. 4.
  • Treatment of Viral Infections and Viral- Associated Neuropathies Prophylactic treatment of infectious and viral neuropathies is contemplated.
  • a variant Neublastin polypeptide is administered to prevent appearance of neuropathic pain including but not limited to neuropathic pain associated with leprosy, Lyme disease, neuropathic pain associated with infection by a virus, particularly a virus selected from the group consisting of a herpes virus (and more particularly by a herpes zoster virus, which may lead to post-herpetic neuralgia), a human immunodeficiency virus (HIV), and a papilloma virus), hi an alternative embodiment, a variant Neublastin polypeptide is administered to reduce the severity of neuropathic pain, should it appear.
  • a virus particularly a virus selected from the group consisting of a herpes virus (and more particularly by a herpes zoster virus, which may lead to post-herpetic neuralgia), a human immunodeficiency virus (HIV), and a papilloma virus
  • Symptoms of acute viral infection often include the appearance of a rash. Other symptoms include, for example, the development of persistent pain in the affected area of the body, which is a common complication of a herpes zoster infection (shingles). Post- herpetic neuralgia can last for a month or more, and may appear several months after any rash-like symptoms have disappeared.
  • Prophylactic treatment of painful diabetic neuropathy is contemplated.
  • Prophylactic treatment of diabetic neuropathies would commence after determination of the initial diagnosis of diabetes or diabetes-associated symptoms and before onset of neuropathic pain.
  • Prophylactic treatment of painful diabetic neuropathy may also commence upon determining that a subject is at risk for developing diabetes or diabetes- associated symptoms.
  • a variant Neublastin polypeptide is administered to prevent appearance of neuropathic pain.
  • a variant Neublastin polypeptide is administered to reduce the severity of neuropathic pain that has already appeared.
  • variant Neublastin polypeptides disclosed herein can be used in the treatment or prevention of a nervous system disorder in a subject (such as a human), by administering to a subject in need thereof a therapeutically effective amount of a variant Neublastin polypeptide, a composition containing a variant Neublastin polypeptide, or a complex that includes a stable, aqueous soluble conjugated variant Neublastin polypeptide coupled to a polyalkylene moiety such as, e.g., PEG.
  • a polyalkylene moiety such as, e.g., PEG.
  • the nervous system disorder can be a peripheral nervous system disorder, such as a peripheral neuropathy or a neuropathic pain syndrome. Humans are preferred subjects for treatment.
  • a variant Neublastin polypeptide is useful for treating a defect in a neuron, including without limitation lesioned neurons and traumatized neurons.
  • Peripheral nerves that experience trauma include, but are not limited to, nerves of the medulla or of the spinal cord.
  • Variant Neublastin polypeptides are useful in the treatment of neurodegenerative disease, e.g., cerebral ischemic neuronal damage; neuropathy, e.g., peripheral neuropathy, Alzheimer's disease, Huntington's disease, Parkinson's disease, amyotrophic lateral sclerosis (ALS).
  • Such variant Neublastin polypeptides can be used in the treatment of impaired memory, e.g., memory impairment associated with dementia.
  • Human Neublastin was crystallized and its structure revealed a triad of sulfate ions interacting with the following four Neublastin residues in close proximity to each other: Argl4, Arg48, Arg49, and Arg51. Based upon the presence of this triad and their relative spacing to one another, it was postulated that this region of Neublastin could be a potential heparin sulfate-binding domain. Subsequently, a previously solved heparin sulfate structure was docked (in-silico) to Neublastin at the site of the sulfate triad.
  • Neublastin crystallization data also revealed that the following amino acid residues provide supplementary interactions with either the triad of sulfate ions or with one or more of three other sulfate ions that interact with Neublastin: Ser 46, Ser 73, GIy 72, Arg 39, GIn 21, Ser 20, Arg 68, Arg 33, His 32, and VaI 94.
  • GPGSRAR heparin sulfate binding site consensus sequence
  • This region was unstructured in the crystal structure but may become ordered upon binding glycosaminoglycans.
  • the region is likely to be close in space to the three sulfate cluster observed in the crystal structure (Arg 14 contributes to the heparin-binding site that is mainly centered in the hinge region of the protein).
  • the variant Neublastin polypeptides were subjected to further biochemical analysis to determine the effect each mutation had on heparin binding. Heparin Sepharose and cationic chromatography were both employed. Since wild-type human Neublastin is a basic protein with an apparent pi of 11.31 , Neublastin binds efficiently to cationic-based resins. A single conversion of arginine to glutamate decreases the apparent pi to 10.88. However, this lower pi was not expected to dramatically alter cationic resin-binding nor was it expected to alter the elution profile of the mutants compared to that of the wild-type control. Each of the mutants (along with the wild-type Neublastin control) was subjected to cationic chromatography.
  • each of the three mutants (along with wild-type human Neublastin) was subjected to Heparin Sepharose chromatography (Fig. 2B). Binding and elution conditions were similar to those used for cationic chromatography. However, the observed elution profile was significantly different from the cationic resin elution profile. Wild-type Neublastin eluted at approximately 720 mM sodium chloride (Fig. 2B; Peak H) whereas Arg51E, Arg49E, and Arg48E eluted at 570 mM (Fig. 2B; Peak G), 510 mM (Fig.
  • Neublastin has been shown previously to bind non-specifically to the surface of Chinese Hamster Ovary (CHO) cells.
  • a Neublastin CHO cell-binding assay was established to determine whether this interaction is mediated, at least in part, through Neublastin's binding to cell surface heparin sulfate molecules.
  • Wild-type human Neublastin (40 ug) or the Arg48E mutant was pre-mixed with
  • CHO cells (10 6 cells) at a cell density which completely binds both Neublastin forms along with increasing amounts of 16 kDa heparin sulfate and incubated at 37 0 C for 4 hours. Following incubation, the cells were pelleted by centrifugation and remaining non-bound Neublastin in the supernatant was subjected to SDS/PAGE analysis. After quantification of each protein band by densitometry, the resulting optical density value was plotted against the heparin concentration in each sample (Fig. 4).
  • both the wild type and the mutant Neublastin forms had equal amounts of protein identified in the supernatant.
  • heparin concentration increased to 0.5 ug/ml and higher, more wild-type Neublastin was identified in the supernatant than that of the Arg48E mutant.
  • This observation suggested that heparin can compete with cell surface-bound heparin for wild- type Neublastin binding (i.e., binding of heparin to wild-type Neublastin results in its removal from the cell surface), whereas heparin cannot as readily compete off the Arg48E mutant.
  • the Arg48E mutant began to elute off the cell surface, suggesting an ionic interaction between heparin and the Arg48E mutant might be responsible for this observation.
  • Example 5 Heparin Binding of Wild Type Neublastin and Variant Neublastin Polypeptides
  • a heparin binding ELISA was established.
  • an anti-Neublastin monoclonal antibody was coated onto a 96-well plate, followed by washing and the addition of one of the Neublastin forms. Biotinylated heparin was then added to the plate. Following an additional wash step, the Neublastin/Heparin complex was identified using a Strepavidin-HRP conjugate with a chemiluminescent substrate.
  • This heparin- binding ELISA was used to compare wild type human Neublastin 113 amino acid (SEQ ID NO : 1 ) and 104 amino acid (amino acids 10- 113 of SEQ ID NO : 1 ) forms to variant Neublastin polypeptides containing a single amino acid substitution (Arg48E, Arg49E, and Arg51E; SEQ ID NOS:2-4) as well as a double substitution (Arg48, 49E; SEQ ID NO:5). Both wild-type forms of Neublastin bound heparin with an EC50 of ⁇ 1 ng/ml heparin (Fig. 5).
  • Arg49E and Arg51E bound less efficiently, with an apparent EC50 of ⁇ 10ng/ml, but maximum binding remained the same (Fig. 5).
  • Arg48E had the most dramatic effect on heparin binding, with an apparent EC50 of ⁇ 100 ng/ml, but still achieved the same maximum heparin binding value when compared to the unmodified Neublastin forms (Fig. 5).
  • the Arg48E mutant was thus one hundred fold less efficient in binding heparin as compared to the unmodified Neublastin forms and ten fold less efficient as compared to the other single substitution mutants.
  • mutant Neublastin forms along with the wild- type Neublastin were subjected to Kinase Receptor Activation (KIRA) analysis.
  • KIRA Kinase Receptor Activation
  • Example 8 Near and Far UV CD Analysis To further investigate the effects of the double mutations on Neublastin's secondary and tertiary structure, the Arg48,49E double mutant was subjected to both Near and Far UV CD analysis. Although subtle differences were detected in the secondary and tertiary structures, the conformation of the double mutant was very close to that of the wild-type Neublastin.
  • Example 9 Pharmacokinetic Analysis of the Neublastin Arg48, 49E Double Mutant Human Neublastin exhibits poor pharmacokinetics (PK) when administered to rats intravenously (IV) or subcutaneously (SC), with an overall bioavailability of less than 1%. Heparin-based clearance may be one of the reasons for this low bioavailability. To determine whether heparin-based clearance participates in human Neublastin's rapid clearance from the rat, the Arg48,49E double mutant (along with the wild-type control) was subjected to PK analysis.
  • PK pharmacokinetics
  • both the wild type and double mutant forms of Neublastin were PEGylated with 10 kDa PEG using SPA-based coupling chemistry. Since Neublastin is a homo-dimer with no native lysine residues, the 10-kDa moieties specifically labeled the amino terminus of each monomer. 2X1 OK PEGylated human double mutant neublastin was purified to homogeneity, and subjected to structural and biological analysis prior to PK analysis.
  • 2X10K PEG Arg48, 49E double mutant was injected either IV (1 mg/kg) or SC (7 mg/kg) into rats and serum collected at various time points for analysis. Following IV administration, 2X1 OK PEG double mutant achieved the theoretical Cmax of 10 ug/ml (diamonds) with typical alpha and beta phases (Fig. 12). SC administration of the PEGylated double mutant demonstrated a Cmax of 40 ng/ml at 24 hours injection
  • Plasmid constructs encoding wild type and mutant Neublastin were expressed in CHO cells and the amount of secreted soluble protein was measured by ELISA.
  • the plasmid constructs used in these experiments encoded a fusion protein containing the human growth hormone signal peptide (SigPep) (with or without an intron included in the plasmid) fused to (i) the carboxy terminal 104 amino acids of wild type human Neublastin, or (ii) the Arg48,49E double mutant (104 amino acid form).
  • SigPep human growth hormone signal peptide
  • the Neublastin sequences are in upper case type.
  • the human growth hormone signal peptide sequences are in lower case type.
  • the junction of the signal peptide and Neublastin sequences is indicated with a carat ( ⁇ ).
  • the amino acids at positions 48 and 49 are underlined.
  • SigPep-NBN wild type: matgsrtslllafgllclswlqegsa A AAGARGCRLRSQLVPV RALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPC CRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG (SEQ ID NO: 13).
  • SigPep-NBN (Arg48,49E): matgsrtslUafgllclswlqegsa A AAGARGCRLRSQLVP VRALGLGHRSDELVRFRFCSGSCEEARSPHDLSLASLLGAGALRPPPGSRPVSQP CCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG (SEQ ID NO: 14).
  • CHO cells were transfected with plasmids encoding each of the foregoing forms of Neublastin and cultured in 384-well plates. After several weeks, wells that contained growing cells were transferred to fresh 96-well culture plates. Conditioned medium was analyzed by ELISA to measure the titer of soluble Neublastin. The cumulative absorbance data for each plasmid tested (mean value with one standard deviation as error bars) was detected. Transfection of CHO cells with plasmids encoding the Arg48,49E double mutant resulted in a significantly increased number of cell lines exhibiting high expression levels of recombinant protein, as compared to cells transfected with plasmids encoding wild type Neublastin (Fig. 13).
  • the leading cell lines from each transfection were further expanded. Fixed numbers of cells were cultured for three days and total cell count, viability, and titer were determined. The titers of Neublastin expressed from the leading Arg48,49E double mutant cell lines were roughly five-fold greater than those of a leading wild type Neublastin cell line (Fig. 14).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Toxicology (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Epidemiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Psychology (AREA)
  • Pain & Pain Management (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Saccharide Compounds (AREA)
  • Steroid Compounds (AREA)
PCT/US2005/029637 2004-08-19 2005-08-18 Neublastin variants Ceased WO2006023781A2 (en)

Priority Applications (24)

Application Number Priority Date Filing Date Title
MX2007002029A MX2007002029A (es) 2004-08-19 2005-08-18 Variantes de neublastina.
AU2005277226A AU2005277226B2 (en) 2004-08-19 2005-08-18 Neublastin variants
NZ553431A NZ553431A (en) 2004-08-19 2005-08-18 Neublastin variants with decreased heparin binding
BRPI0514534-1A BRPI0514534A (pt) 2004-08-19 2005-08-18 variantes de neublastina
AT05789285T ATE474586T1 (de) 2004-08-19 2005-08-18 Neublastin-varianten
CN2005800359225A CN101123978B (zh) 2004-08-19 2005-08-18 神经胚素变体
UAA200702764A UA92590C2 (uk) 2004-08-19 2005-08-18 Варіанти нейбластину
HR20100474T HRP20100474T1 (hr) 2004-08-19 2005-08-18 Varijante neublastina
EA200700460A EA013565B1 (ru) 2004-08-19 2005-08-18 Варианты полипептидов нейбластина, способы их получения и их применение
DE602005022457T DE602005022457D1 (de) 2004-08-19 2005-08-18 Neublastin-varianten
PL05789285T PL1786454T3 (pl) 2004-08-19 2005-08-18 Odmiany neublastyny
HK07112571.5A HK1103991B (en) 2004-08-19 2005-08-18 Neublastin variants
SI200531099T SI1786454T1 (sl) 2004-08-19 2005-08-18 Variante neoblastina
CA2577755A CA2577755C (en) 2004-08-19 2005-08-18 Neublastin variants
US11/573,773 US8263553B2 (en) 2004-08-19 2005-08-18 Neublastin variants
JP2007528061A JP4852545B2 (ja) 2004-08-19 2005-08-18 ニューブラスチン(Neublastin)変異体
DK05789285.3T DK1786454T3 (da) 2004-08-19 2005-08-18 Neublastinvarianter
EP05789285A EP1786454B1 (en) 2004-08-19 2005-08-18 Neublastin variants
IL181311A IL181311A (en) 2004-08-19 2007-02-13 Variants of neoblastin polypeptide, dimers, conjugates, and fusion proteins that include them, pharmacological compounds based on them, nucleic acids encoding them, and vectors - expression including said nucleic acids, cells containing said vectors, methods for making and using said polypeptides
IS8608A IS8608A (is) 2005-06-24 2007-02-14 Afbrigði neublastíns
ZA2007/01395A ZA200701395B (en) 2004-08-19 2007-02-16 Neublastin variants
NO20071449A NO20071449L (no) 2004-08-19 2007-03-19 Neublastinvarianter
IL205201A IL205201A0 (en) 2004-08-19 2010-04-19 Neublastin variants
US13/541,302 US20130096065A1 (en) 2004-08-19 2012-07-03 Neublastin variants

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US60282504P 2004-08-19 2004-08-19
US60/602,825 2004-08-19
US69406705P 2005-06-24 2005-06-24
US60/694,067 2005-06-24

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US13/541,302 Continuation US20130096065A1 (en) 2004-08-19 2012-07-03 Neublastin variants

Publications (2)

Publication Number Publication Date
WO2006023781A2 true WO2006023781A2 (en) 2006-03-02
WO2006023781A3 WO2006023781A3 (en) 2007-08-16

Family

ID=35968235

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2005/029637 Ceased WO2006023781A2 (en) 2004-08-19 2005-08-18 Neublastin variants

Country Status (26)

Country Link
US (2) US8263553B2 (enExample)
EP (3) EP1786454B1 (enExample)
JP (2) JP4852545B2 (enExample)
KR (2) KR20110126732A (enExample)
CN (1) CN102924585A (enExample)
AT (1) ATE474586T1 (enExample)
AU (1) AU2005277226B2 (enExample)
BR (1) BRPI0514534A (enExample)
CA (1) CA2577755C (enExample)
CY (1) CY1111136T1 (enExample)
DE (1) DE602005022457D1 (enExample)
DK (1) DK1786454T3 (enExample)
EA (1) EA013565B1 (enExample)
GE (1) GEP20115196B (enExample)
HR (1) HRP20100474T1 (enExample)
IL (2) IL181311A (enExample)
MX (1) MX2007002029A (enExample)
NO (1) NO20071449L (enExample)
NZ (1) NZ553431A (enExample)
PL (1) PL1786454T3 (enExample)
PT (1) PT1786454E (enExample)
RS (1) RS51453B (enExample)
SI (1) SI1786454T1 (enExample)
UA (1) UA92590C2 (enExample)
WO (1) WO2006023781A2 (enExample)
ZA (1) ZA200701395B (enExample)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015042580A1 (en) 2013-09-23 2015-03-26 Biogen Idec Ma Inc. Compositions and methods for treatment of neuropathic pain
WO2016022800A1 (en) 2014-08-07 2016-02-11 Biogen Ma Inc. Characterization of cystine knot superfamily proteins
US10328125B2 (en) 2006-02-27 2019-06-25 Gloriana Therapeutics, Inc. Treatments for neurological disorders

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7442370B2 (en) 2001-02-01 2008-10-28 Biogen Idec Ma Inc. Polymer conjugates of mutated neublastin
US7276580B2 (en) * 2001-03-12 2007-10-02 Biogen Idec Ma Inc. Neurotrophic factors
JP4571776B2 (ja) * 2002-11-05 2010-10-27 Jx日鉱日石エネルギー株式会社 潤滑油組成物
NZ543365A (en) 2003-04-18 2009-02-28 Biogen Idec Inc Polymer-conjugated glycosylated neublastin
DE602005022082D1 (de) * 2004-08-19 2010-08-12 Biogen Idec Inc Rückfaltung von proteinen der transforming-growth-factor-beta-familie
EP1786454B1 (en) 2004-08-19 2010-07-21 Biogen Idec MA Inc. Neublastin variants
ES2450065T3 (es) * 2006-03-01 2014-03-21 Biogen Idec Ma Inc. Composiciones y métodos para la administración de proteínas de la familia de ligandos del GDNF
US8329655B2 (en) 2007-05-01 2012-12-11 Biogen Idec Ma Inc. Methods for increasing vascularization
US20110135648A1 (en) * 2007-08-08 2011-06-09 Biogen Idec Ma Inc. Anti-neublastin antibodies and uses thereof
JP2022516053A (ja) * 2018-12-21 2022-02-24 グロリアーナ・セラピューティクス・ソシエテ・ア・レスポンサビリテ・リミテ 哺乳動物細胞培養物によって生産されるニューブラスチン抗体

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5834029A (en) 1994-07-20 1998-11-10 Cytotherapeutics, Inc. Nerve guidance channel containing bioartificial three-dimensional hydrogel extracellular matrix derivatized with cell adhesive peptide fragment
WO2002060929A2 (en) 2001-02-01 2002-08-08 Biogen, Inc. Polymer conjugates of neublastin and methods of using same
WO2004069176A2 (en) 2001-02-01 2004-08-19 Biogen Idec Ma Inc. Polymer conjugates of mutated neublastin

Family Cites Families (77)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4352883A (en) 1979-03-28 1982-10-05 Damon Corporation Encapsulation of biological material
US4353888A (en) 1980-12-23 1982-10-12 Sefton Michael V Encapsulation of live animal cells
US4407957A (en) 1981-03-13 1983-10-04 Damon Corporation Reversible microencapsulation of a core material
US5525464A (en) 1987-04-01 1996-06-11 Hyseq, Inc. Method of sequencing by hybridization of oligonucleotide probes
US4883666A (en) 1987-04-29 1989-11-28 Massachusetts Institute Of Technology Controlled drug delivery system for treatment of neural disorders
US5158881A (en) 1987-11-17 1992-10-27 Brown University Research Foundation Method and system for encapsulating cells in a tubular extrudate in separate cell compartments
US5283187A (en) 1987-11-17 1994-02-01 Brown University Research Foundation Cell culture-containing tubular capsule produced by co-extrusion
DE3829752A1 (de) 1988-09-01 1990-03-22 Akzo Gmbh Integrale asymmetrische polyaethersulfonmembran, verfahren zur herstellung und verwendung zur ultrafiltration und mikrofiltration
DE3829766A1 (de) 1988-09-01 1990-03-22 Akzo Gmbh Verfahren zur herstellung von membranen
US5143854A (en) 1989-06-07 1992-09-01 Affymax Technologies N.V. Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof
US5800992A (en) 1989-06-07 1998-09-01 Fodor; Stephen P.A. Method of detecting nucleic acids
US5194596A (en) 1989-07-27 1993-03-16 California Biotechnology Inc. Production of vascular endothelial cell growth factor
US5350836A (en) 1989-10-12 1994-09-27 Ohio University Growth hormone antagonists
GB8927546D0 (en) 1989-12-06 1990-02-07 Ciba Geigy Process for the production of biologically active tgf-beta
US5084350A (en) 1990-02-16 1992-01-28 The Royal Institution For The Advance Of Learning (Mcgill University) Method for encapsulating biologically active material including cells
US5618531A (en) 1990-10-19 1997-04-08 New York University Method for increasing the viability of cells which are administered to the brain or spinal cord
CA2109085C (en) 1991-04-25 2003-03-11 Keith E. Dionne Implantable biocompatible immunoisolatory vehicle for delivery of selected therapeutic products
ES2141108T3 (es) 1991-07-02 2000-03-16 Inhale Inc Metodo y dispositivo para proporcionar medicamentos en aerosol.
GEP20002243B (en) 1991-09-20 2000-09-25 Amgen Inc Glial Derived Neurotrophic Factor
US5939524A (en) 1991-12-09 1999-08-17 The Scripps Research Institute Platelet GPIII P1A1 and P1A2 epitopes, their preparation and use
US5414135A (en) 1991-12-30 1995-05-09 Sterling Winthrop Inc. Vinyl sulfone coupling of polyoxyalkylenes to proteins
US5785049A (en) 1994-09-21 1998-07-28 Inhale Therapeutic Systems Method and apparatus for dispersion of dry powder medicaments
ES2179831T3 (es) 1992-09-29 2003-02-01 Inhale Therapeutic Syst Liberacion en los pulmones de fragmentos activos de hormona paratiroidiana.
US5349056A (en) 1992-10-09 1994-09-20 Regeneron Pharmaceuticals Modified ciliary neurotrophic factors
CA2092271C (en) 1993-03-09 2009-10-13 Eddie Reed Use of g-csf for treating taxol side-effects
DE69430824T2 (de) 1993-08-12 2003-01-23 Neurotech S.A., Evry Biokompatible immunoisolatorische Kapseln, die genetisch veränderte Zellen enthalten
DE4339605A1 (de) 1993-11-20 1995-05-24 Beiersdorf Ag Desodorierende Wirkstoffkombinationen auf der Basis von alpha, omega-Alkandicarbonsäuren und Fettsäurepartialglyceriden
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
US5795716A (en) 1994-10-21 1998-08-18 Chee; Mark S. Computer-aided visualization and analysis system for sequence evaluation
US5770577A (en) 1994-11-14 1998-06-23 Amgen Inc. BDNF and NT-3 polypeptides selectively linked to polyethylene glycol
US5780014A (en) 1995-04-14 1998-07-14 Inhale Therapeutic Systems Method and apparatus for pulmonary administration of dry powder alpha 1-antitrypsin
US5654007A (en) 1995-06-07 1997-08-05 Inhale Therapeutic Systems Methods and system for processing dispersible fine powders
US5739307A (en) 1995-08-28 1998-04-14 Washington University Polynucleotide encoding neurturin neurotrophic factor
US5733729A (en) 1995-09-14 1998-03-31 Affymetrix, Inc. Computer-aided probability base calling for arrays of nucleic acid probes on chips
US5641749A (en) 1995-11-29 1997-06-24 Amgen Inc. Method for treating retinal ganglion cell injury using glial cell line-derived neurothrophic factor (GDNF) protein product
US6063757A (en) 1995-11-29 2000-05-16 Urso; Richard G. Wound treatment method with nerve growth factor
JP4019432B2 (ja) 1995-12-21 2007-12-12 味の素株式会社 ヒトアクチビンaのリフォールディング方法
US6299895B1 (en) 1997-03-24 2001-10-09 Neurotech S.A. Device and method for treating ophthalmic diseases
US6677135B1 (en) 1996-05-08 2004-01-13 Biogen, Inc. Ret ligand (RetL) for stimulating neutral and renal growth
US5754524A (en) 1996-08-30 1998-05-19 Wark; Barry J. Computerized method and system for analysis of an electrophoresis gel test
US6083725A (en) 1996-09-13 2000-07-04 Transkaryotic Therapies, Inc. Tranfected human cells expressing human α-galactosidase A protein
WO1998013496A1 (en) 1996-09-26 1998-04-02 Medical Research Council Chaperone fragments
KR100195886B1 (ko) 1996-11-01 1999-06-15 김상조 당뇨병 치료용 의약조성물
US6653098B1 (en) 1998-02-23 2003-11-25 G. D. Searle & Co. Method of producing mouse and human endostatin
US20020055467A1 (en) 1998-07-06 2002-05-09 Johansen Teit E. Novel neurotrophic factors
US6593133B1 (en) 1998-07-06 2003-07-15 Nsgene A/S Neurotrophic factors
US7067473B1 (en) 1998-07-14 2006-06-27 Janssen Pharmaceutica N.V. Neurotrophic growth factor
WO2000004050A2 (en) 1998-07-14 2000-01-27 Janssen Pharmaceutica N.V. Neurotrophic growth factor
WO2000017360A1 (en) 1998-09-22 2000-03-30 University Of Maryland, Baltimore Cystine knot growth factor mutants
US6284540B1 (en) 1998-09-29 2001-09-04 Washington University Artemin, a novel neurotrophic factor
US6361771B1 (en) 1999-04-06 2002-03-26 Neurotech S.A. ARPE-19 as a platform cell line for encapsulated cell-based delivery
JP2003525916A (ja) 1999-04-22 2003-09-02 エイドゲントシッシュ テクニーシェ ホッシュール チューリッヒ モディファイドタンパク質マトリクス
PT1223966E (pt) 1999-10-29 2003-09-30 Biopharm Ges Biotechn Entwickl Utilizacao do gdnf para tratamento de defeitos na cornea
CA2327208A1 (en) 2000-11-30 2002-05-30 The Government Of The United States Of America Methods of increasing distribution of therapeutic agents
MXPA03005721A (es) * 2000-12-22 2004-04-21 Genentech Inc Uso novedoso de artemina, un miembro de la familia de ligandos gdnf.
US7276580B2 (en) 2001-03-12 2007-10-02 Biogen Idec Ma Inc. Neurotrophic factors
US20040077543A1 (en) 2001-03-28 2004-04-22 Sah Dinah W. Y. Treatment using neublastin polypeptides
CA2442159C (en) * 2001-03-28 2011-08-23 Biogen, Inc. Treatment using neublastin polypeptides
NZ543953A (en) 2001-04-24 2007-04-27 Univ Chicago Method and compositions for treating mammalian nerve tissue injuries
US20030100497A1 (en) 2001-06-20 2003-05-29 Genentech, Inc. Compositions and methods for the diagnosis and treatment of disorders involving angiogenesis
US20040028613A1 (en) 2001-06-25 2004-02-12 Nastech Pharmaceutical Company Inc Dopamine agonist formulations for enhanced central nervous system delivery
US7129085B2 (en) 2001-10-11 2006-10-31 Bristol-Myers Squibb Company Polynucleotides encoding a human leucine-rich repeat domain containing protein, HLLRCR-1
GB0205022D0 (en) 2002-03-04 2002-04-17 Univ Cambridge Tech Materials and methods for the treatment of cns damage
JP4310608B2 (ja) 2002-04-25 2009-08-12 東洋紡績株式会社 Hsp70ファミリータンパク質基質結合ドメインフラグメントの利用方法
NZ543365A (en) 2003-04-18 2009-02-28 Biogen Idec Inc Polymer-conjugated glycosylated neublastin
DE602004019524D1 (de) 2003-06-10 2009-04-02 Nsgene As Verbesserte sezernierung von neublastin
US7598059B2 (en) 2003-10-02 2009-10-06 Biogen Idec Ma Inc. Neublastin expression constructs
WO2005072764A2 (en) 2004-01-16 2005-08-11 Novocell, Inc. Fibrin-bound angiogenic factors to stimulate vascularization of transplant site of encapsulated cells
US20060014288A1 (en) 2004-06-23 2006-01-19 Tissuegene, Inc. Nerve regeneration
US7598356B2 (en) 2004-07-08 2009-10-06 Board of Regents of the University of Nebraska by and on behalf of the University of Nebraska Medical Center Method for purifying a protein of the cystine-knot superfamily
DE602005022082D1 (de) 2004-08-19 2010-08-12 Biogen Idec Inc Rückfaltung von proteinen der transforming-growth-factor-beta-familie
EP1786454B1 (en) 2004-08-19 2010-07-21 Biogen Idec MA Inc. Neublastin variants
EP1937295A2 (en) 2005-10-11 2008-07-02 NS Gene A/S Treatment of retinopathies using gfr 3 agonists
TWI501774B (zh) 2006-02-27 2015-10-01 Biogen Idec Inc 神經性病症之治療
ES2450065T3 (es) 2006-03-01 2014-03-21 Biogen Idec Ma Inc. Composiciones y métodos para la administración de proteínas de la familia de ligandos del GDNF
ES2618787T5 (es) 2006-04-25 2022-10-21 Univ California Administración de factores de crecimiento para el tratamiento de trastornos del SNC
US8329655B2 (en) 2007-05-01 2012-12-11 Biogen Idec Ma Inc. Methods for increasing vascularization

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5834029A (en) 1994-07-20 1998-11-10 Cytotherapeutics, Inc. Nerve guidance channel containing bioartificial three-dimensional hydrogel extracellular matrix derivatized with cell adhesive peptide fragment
WO2002060929A2 (en) 2001-02-01 2002-08-08 Biogen, Inc. Polymer conjugates of neublastin and methods of using same
WO2004069176A2 (en) 2001-02-01 2004-08-19 Biogen Idec Ma Inc. Polymer conjugates of mutated neublastin

Non-Patent Citations (11)

* Cited by examiner, † Cited by third party
Title
ALTSCHUL ET AL., NUCLEIC ACIDS RESEARCH, vol. 25, 1997, pages 3389 - 3402
BALOH ET AL., NEURON, vol. 21, 1998, pages 1291
FAIRLIE ET AL., J BIOL. CHEM., vol. 276, no. 20, 2001, pages 16911
OROZCO ET AL., EUR. J NEUROSCI., vol. 13, no. 11, 2001, pages 2177
RATTENHOLL ET AL., EUR. J BIOCHEM., vol. 268, 2001, pages 3296
RATTENHOLL ET AL., J MOL. BIOL., vol. 305, 2000, pages 523
RATTENHOLL ET AL., J. MOL. BIOL., vol. 305, 2000, pages 523
ROSEBLAD ET AL., MOL. CELL NEUROSCI., vol. 15, no. 2, 2000, pages 199
SAARMA, MICROSC. RES. TECH., vol. 45, 1999, pages 292
SADICK ET AL., ANAL. BIOCHEM., vol. 235, no. 2, 1996, pages 207
STEWART ET AL.: "Solid Phase Peptide Synthesis", 1984

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10328125B2 (en) 2006-02-27 2019-06-25 Gloriana Therapeutics, Inc. Treatments for neurological disorders
WO2015042580A1 (en) 2013-09-23 2015-03-26 Biogen Idec Ma Inc. Compositions and methods for treatment of neuropathic pain
WO2016022800A1 (en) 2014-08-07 2016-02-11 Biogen Ma Inc. Characterization of cystine knot superfamily proteins

Also Published As

Publication number Publication date
EP2238983A3 (en) 2011-03-09
EA200700460A1 (ru) 2007-10-26
EP2335713A3 (en) 2011-11-02
DK1786454T3 (da) 2010-09-06
CA2577755C (en) 2014-05-13
DE602005022457D1 (de) 2010-09-02
EP2335713A2 (en) 2011-06-22
US20130096065A1 (en) 2013-04-18
UA92590C2 (uk) 2010-11-25
AU2005277226A1 (en) 2006-03-02
IL205201A0 (en) 2011-07-31
CN102924585A (zh) 2013-02-13
WO2006023781A3 (en) 2007-08-16
ATE474586T1 (de) 2010-08-15
IL181311A0 (en) 2007-07-04
KR20110126732A (ko) 2011-11-23
SI1786454T1 (sl) 2010-10-29
EP2238983B1 (en) 2014-07-23
IL181311A (en) 2013-06-27
EP2238983A2 (en) 2010-10-13
JP2011155987A (ja) 2011-08-18
KR101215697B1 (ko) 2012-12-28
CA2577755A1 (en) 2006-03-02
GEP20115196B (en) 2011-04-11
PL1786454T3 (pl) 2010-12-31
KR20070050964A (ko) 2007-05-16
JP2008510468A (ja) 2008-04-10
BRPI0514534A (pt) 2008-06-17
PT1786454E (pt) 2010-08-18
EP1786454B1 (en) 2010-07-21
NZ553431A (en) 2010-04-30
EP1786454A2 (en) 2007-05-23
CY1111136T1 (el) 2015-06-11
EP1786454A4 (en) 2008-06-18
HRP20100474T1 (hr) 2010-10-31
RS51453B (sr) 2011-04-30
EA013565B1 (ru) 2010-06-30
AU2005277226B2 (en) 2012-01-19
US20080039385A1 (en) 2008-02-14
ZA200701395B (en) 2009-03-25
MX2007002029A (es) 2007-03-28
US8263553B2 (en) 2012-09-11
NO20071449L (no) 2007-05-18
HK1103991A1 (en) 2008-01-04
JP4852545B2 (ja) 2012-01-11

Similar Documents

Publication Publication Date Title
US20130096065A1 (en) Neublastin variants
ES2349043T3 (es) Variantes de neublastina.
EP1993590B1 (en) Compostions and methods for administering gdnf ligand family proteins
US20120083453A1 (en) Treatment using neublastin polypeptides
AU2002250203A1 (en) Use of neublastin polypeptides for treating neuropathic pain
WO2002078730A2 (en) Use of neublastin polypeptides for treating neuropathic pain
JP2011078434A (ja) 変異ニューブラスチンのポリマー結合体
HK1103991B (en) Neublastin variants
HK1147940A (en) Neublastin variants
HK1158991A (en) Neublastin variants
WO2015042580A1 (en) Compositions and methods for treatment of neuropathic pain

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU LV MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 181311

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2007528061

Country of ref document: JP

Ref document number: 200701395

Country of ref document: ZA

WWE Wipo information: entry into national phase

Ref document number: MX/a/2007/002029

Country of ref document: MX

Ref document number: 12007500409

Country of ref document: PH

Ref document number: 2577755

Country of ref document: CA

Ref document number: 1294/DELNP/2007

Country of ref document: IN

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2005277226

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 553431

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2005789285

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 1020077005926

Country of ref document: KR

ENP Entry into the national phase

Ref document number: 2005277226

Country of ref document: AU

Date of ref document: 20050818

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2005277226

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 9928

Country of ref document: GE

WWE Wipo information: entry into national phase

Ref document number: 200700460

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 200580035922.5

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 2005789285

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 11573773

Country of ref document: US

ENP Entry into the national phase

Ref document number: PI0514534

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 205201

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: P-2010/0386

Country of ref document: RS