WO2001018169A2 - Agents and compositions and methods for diagnostic and/or treating or preventing plaque forming diseases - Google Patents

Agents and compositions and methods for diagnostic and/or treating or preventing plaque forming diseases Download PDF

Info

Publication number
WO2001018169A2
WO2001018169A2 PCT/IL2000/000518 IL0000518W WO0118169A2 WO 2001018169 A2 WO2001018169 A2 WO 2001018169A2 IL 0000518 W IL0000518 W IL 0000518W WO 0118169 A2 WO0118169 A2 WO 0118169A2
Authority
WO
WIPO (PCT)
Prior art keywords
disease
bacteriophage
group
display vehicle
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IL2000/000518
Other languages
English (en)
French (fr)
Other versions
WO2001018169A3 (en
Inventor
Beka Solomon
Dan Frenkel
Eilat Hanan
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ramot at Tel Aviv University Ltd
Original Assignee
Ramot at Tel Aviv University Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US09/473,653 external-priority patent/US6703015B1/en
Priority to DE60044057T priority Critical patent/DE60044057D1/de
Priority to JP2001522381A priority patent/JP2003509020A/ja
Priority to US09/830,954 priority patent/US6919075B1/en
Priority to AU67232/00A priority patent/AU784568B2/en
Priority to EP00954883A priority patent/EP1180938B1/en
Priority to AT00954883T priority patent/ATE461996T1/de
Priority to IL14294800A priority patent/IL142948A0/xx
Priority to HK02106123.5A priority patent/HK1044564B/en
Application filed by Ramot at Tel Aviv University Ltd filed Critical Ramot at Tel Aviv University Ltd
Priority to CA002349434A priority patent/CA2349434A1/en
Publication of WO2001018169A2 publication Critical patent/WO2001018169A2/en
Priority to IL142948A priority patent/IL142948A/en
Publication of WO2001018169A3 publication Critical patent/WO2001018169A3/en
Anticipated expiration legal-status Critical
Priority to US11/073,526 priority patent/US20050152878A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0007Nervous system antigens; Prions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/0004Screening or testing of compounds for diagnosis of disorders, assessment of conditions, e.g. renal clearance, gastric emptying, testing for diabetes, allergy, rheuma, pancreas functions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4711Alzheimer's disease; Amyloid plaque core protein
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6075Viral proteins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/74Inducing cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • the present invention relates to agents and compositions and to methods of utilizing same for treating plaque-forming diseases. More particularly, the methods according to the present invention involve the use of (i) plaque derived antigens cloned and displayed on the surface of a display vehicle for in vivo elicitation of antibodies capable of preventing plaque formation and of disaggregating existing plaques; and (ii) antibodies raised against plaque derived antigens, at least an immunologic portion of which is cloned and displayed on a display vehicle, which immunologic portion is capable of preventing plaque formation and of disaggregating existing plaques.
  • the present invention further relates to a method of targeting a display vehicle to the brain of an animal, including man and to a method for detecting the presence of plaque forming prions.
  • Plaques forming diseases are characterized by the presence of amyloid plaques deposits in the brain as well as neuronal degeneration.
  • Amyloid deposits are formed by peptide aggregated to an insoluble mass. The nature of the peptide varies in different diseases but in most cases, the aggregate has a beta-pleated sheet structure and stains with Congo Red dye.
  • AD Alzheimer's disease
  • early onset Alzheimer's disease late onset Alzheimer's disease
  • presymptomatic Alzheimer's disease other diseases characterized by amyloid deposits are, for example, SAA amyloidosis, hereditary Icelandic syndrome, multiple myeloma, and prion diseases.
  • prion diseases The most common prion diseases in animals are scrapie of sheep and goats and bovine spongiform encephalopathy (BSE) of cattle (Wilesmith and Wells (1991) Curr Top Microbiol Immunol 172: 21-38).
  • BSE bovine spongiform encephalopathy
  • CJD Creutzfeldt-Jakob Disease
  • GSS Gerstmann-Streussler-Sheinker Disease
  • FFI fatal familial insomnia
  • Prion diseases involve conversion of the normal cellular prion protein (PrP ) into the corresponding scrapie isoform (PrP ).
  • PrP Sc scrapie isoform
  • Spectroscopic measurements demonstrate that the conversion of PrP into the scrapie isoform (PrP Sc ) involves a major conformational transition, implying that prion diseases, like other amyloidogenic diseases, are disorders of protein conformation.
  • the transition from PrP c to PrP Sc is accompanied by a decrease in ⁇ -helical secondary structure (from 42% to 30%) and a remarkable increase in ⁇ -sheet content (from 3% to 43%) (Caughey et. al. 1991, Pan et. al. 1993).
  • AD Alzheimer's disease
  • senile dementia a progressive disease resulting in senile dementia.
  • the disease falls into two categories: late onset, which occurs in old age (typically above 65 years) and early onset, which develops well before the senile period, e.g., between 35 and 60 years.
  • late onset which occurs in old age (typically above 65 years)
  • early onset which develops well before the senile period, e.g., between 35 and 60 years.
  • the pathology is similar, but the abnormalities tend to be more severe and widespread in cases beginning at an earlier age.
  • the disease is characterized by two types of lesions in the brain, senile plaques and neurofibrillary tangles.
  • Senile plaques are areas of disorganized neutrophils up to 150 mm across with extracellular amyloid deposits at the center, visible by microscopic analysis of sections of brain tissue.
  • Neurofibrillary tangles are intracellular deposits of tau protein consisting of two filaments twisted about each other in pairs.
  • Senile plaques and other amyloid plaques The principal constituent of the senile plaques is a peptide termed A ⁇ or beta-amyloid peptide ( ⁇ AP).
  • ⁇ AP beta-amyloid peptide
  • the amyloid beta peptide is an internal fragment of 39-43 amino acids of a precursor protein termed amyloid precursor protein (APP).
  • APP amyloid precursor protein
  • beta-amyloid and particularly its long form, is a causative element in Alzheimer's disease.
  • peptides or proteins with evidence of self aggregation are also known, such as, but not limited to, amylin (Young AA. et al., 1994, FEBS Lett, 343(3);237-41); bombesin, caerulein, cholecystokinin octapeptide, eledoisin, gastrin-related pentapeptide, gastrin tetrapeptide, somatostatin (reduced), substance P; and peptide, luteinizing hormone releasing hormone, somatostatin N-Tyr (Banks and Kastin, Prog Brain Res., 91 : 139- 4, 1992).
  • mAbs monoclonal antibodies
  • Binding of high affinity monoclonal antibodies (mAbs) to such regions may alter the molecular dynamics of the whole protein chain or assembly.
  • mAbs have been found to recognize incompletely folded epitopes and to induce native conformation in partially or wrongly folded protein (Frauenfelder et al. 1979, Blond and Goldberg 1987, Karplus and Petsko 1990, Carlson and Yarmush 1992, Solomon and Schwartz 1995).
  • U.S. Pat. No. 5,688,561 to Solomon teaches methods of identifying monoclonal antibodies effective in disaggregating protein aggregates and preventing aggregation of such proteins.
  • U.S. Pat. No. 5,688,561 demonstrates anti-beta-amyloid monoclonal antibodies effective in disaggregating beta-amyloid plaques and preventing beta-amyloid plaque formation in vitro.
  • U.S. Pat. No. 5,688,561 stipulates the in vivo use of such antibodies to prevent plaque formation by aggregation of beta-amyloid or to disaggregate beta-amyloid plaques which have already formed. These teachings do not, however, identify an epitope to be employed to generate such antibodies.
  • beta-amyloid in human plasma is typically in the range of 50-200 pg/ml (Seubert et al, Nature 359, 325-327 1992). Because this proposed dosage would barely alter the level of endogenous circulating beta-amyloid and because EP 52651 1 does not recommend the use of an adjuvant, it seems implausible that any therapeutic benefit would result therefrom.
  • PCT/US98/25386 by Schenk and a Nature paper by Schenk et al. (Nature, 400: 173-177, 1999) teach administration of beta-amyloid immunogens to a patient in order to generate antibodies to prevent formation of plaques or dissolve existing plaques.
  • This epitope has been independently confirmed as the epitope bound by anti-aggregating antibodies using random combinatorial hexapeptide phage display (Frenkel and Solomon, J. of Neuroimmunol. 88:85-90, 1998).
  • the EFRH (SEQ ID NO: l) epitope is available for antibody binding when beta-amyloid peptide is either in solution or in aggregates. Blocking of this epitope by a monoclonal antibody prevents self-aggregation and enables resolubilization of already formed aggregates.
  • Schenk and colleagues further teach that an immunogenic peptide such as beta-amyloid may be displayed upon the surface of a virus or bacteria. However, they fail to teach use of an antigen so displayed to effect immunization. No mention is made of defining an epitope in this context and no experimental data is provided either. In addition, delivery of antibody displayed on a display vehicle is not taught by Schenk or Schenk et al. altogether.
  • a method of treating a plaque forming disease comprising the steps of (a) displaying a polypeptide on a display vehicle, the polypeptide representing at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the at least one epitope being capable of eliciting antibodies capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein; and (b) introducing the display vehicle into a body of a recipient so as to elicit the antibodies capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein.
  • an agent for treating a plaque forming disease comprising a display vehicle displaying a polypeptide representing at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the at least one epitope being capable of eliciting antibodies capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein.
  • a pharmaceutical composition for treating a plaque forming disease comprising an effective amount of a display vehicle displaying a polypeptide, the polypeptide representing at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the at least one epitope being capable of eliciting an effective amount of antibodies capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein, the pharmaceutical composition further comprising a pharmaceutically acceptable carrier.
  • a method of preparing a display vehicle for treating a plaque forming disease comprising the step of genetically modifying a genome of a display vehicle by inserting therein a polynucleotide sequence encoding a polypeptide representing at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the at least one epitope being capable of eliciting antibodies capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein, such that when the display vehicle propagates the polypeptide is displayed by the display vehicle.
  • a method of treating a plaque forming disease comprising the steps of (a) displaying a polypeptide representing at least an immunological portion of an antibody being for binding at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the binding capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein; and (b) introducing the display vehicle into a body of a recipient so as to disaggregate the aggregating protein and/or prevent its aggregation.
  • a method of introducing a display vehicle lacking an engineered targeting moiety into a brain of a recipient comprising the step of administering the display vehicle intranasally to the recipient.
  • the step of introducing the display vehicle into the body of the recipient so as to disaggregate the aggregating protein is effected through an olfactory system of the recipient.
  • an agent for treating a plaque forming disease comprising a display vehicle displaying a polypeptide representing at least an immunological portion of an antibody which can bind at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the immunological portion of the antibody being capable of disaggregating said aggregating protein and/or of preventing aggregation of the aggregating protein.
  • a pharmaceutical composition for treating a plaque forming disease comprising an effective amount of a display vehicle displaying a polypeptide representing at least an immunological portion of an antibody which can bind at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the immunological portion of the antibody being capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein, the pharmaceutical composition further comprising a pharmaceutically acceptable carrier.
  • a method of preparing a display vehicle for treating a plaque forming disease comprising the step of genetically modifying a genome of a display vehicle by inserting therein a polynucleotide sequence encoding at least an immunological portion of an antibody capable of binding at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the immunological portion of the antibody being capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein.
  • a polypeptide comprising at least an immunological portion of an antibody being capable disaggregating a prion protein aggregate and/or of preventing aggregation of said prion protein.
  • the polyepeptide is capable of binding at least one epitope formed by an amino acid sequence set forth in SEQ ID NO:25.
  • a method of detecting a presence or an absence of a prion protein in a biological sample comprising the steps of: (a) incubating an anti-prion antibody or an immunological portion thereof with the biological sample; (b) determining a presence or an absence of antigen complexes formed with the anti-prion antibody or the immunological portion thereof, to thereby determine the presence or the absence of the prion protein in the biological sample.
  • the plaque forming disease is selected from the group consisting of early onset Alzheimer's disease, late onset Alzheimer's disease, presymptomatic Alzheimer's disease, SAA amyloidosis, hereditary Icelandic syndrome, senility and multiple myeloma. According to still further features in the described preferred embodiments the plaque forming disease is selected from the group consisting of scrapie, bovine spongiform encephalopathy (BSE), kuru,
  • CJD Creutzfeldt-Jakob Disease
  • GSS Gerstmann-Streussler-Sheinker Disease
  • FFI fatal familial insomnia
  • the aggregating protein is selected from the group consisting of beta-amyloid, serum amyloid A, cystantin C, IgG kappa light chain and prion protein.
  • the display vehicle is selected from the group consisting of a virus, a bacteria and a polypeptide carrier.
  • the virus is selected from the group consisting of a double stranded DNA virus, a single stranded DNA virus, a positive strand RNA virus and a negative strand RNA virus.
  • the display vehicle is a bacteriophage.
  • the display vehicle is a filamentous bacteriophage.
  • the bacteriophage display vehicle is capable of propagating within bacterial flora of the host.
  • the bacteriophage display vehicle is capable of propagating within E. coli.
  • the bacteriophage display vehicle is fd.
  • the display vehicle is incapable of propagation in vivo.
  • a triple dose of 10 units of the chosen display vehicle induces an antibody titer of at least 1 :50,000 within 30 days of administration, as measured by ELISA.
  • the at least one epitope of said prion protein is formed by an amino acid sequence set forth in SEQ ID NO:25.
  • the immunological portion of an antibody serves for binding at least one epitope of an aggregating protein associated with plaque formation in a plaque forming disease, said immunological portion of said antibody being capable of disaggregating said aggregating protein and/or of preventing aggregation of said aggregating protein.
  • the prion protein is the aggregating protein associated with plaque formation
  • the biological sample is derived from tissues and/or body fluids of a human, a primate, a monkey, a pig, a bovine, a sheep, a deer, an elk, a cat, a dog and a chicken.
  • the present invention successfully addresses the shortcomings of the presently known configurations by providing methods, agents, and pharmaceutical compositions for preventing or reversing the progression of a plaque forming disease.
  • the present invention further includes methods for preparing agents and pharmaceutical compositions useful for preventing or treating plaque forming diseases and to a method of detecting the presence of a pathogenic prion protein in a biological sample.
  • FIG. la is a schematic depiction of an IgM antibody.
  • FIG. lb is a photograph of an ethidium bromide stained 1.5 % agarose gel showing cDNA fragments of the heavy and the light chains of IgM508.
  • Lane 1 Kb (Ladder); Lanes 2 and 3 VJJ and VL fragments, respectively, as indicated by arrows.
  • FIG. lc is a photograph of an ethidium bromide stained 1.5 % agarose gel showing scFv DNA fragment derived from antibody IgM 508. Lane 1 : Kb (Ladder); Lane 2: scFv 508 DNA (750 bp).
  • FIG. Id is a schematic depiction of filamentous phage displaying an scFv.
  • FIG. le is a schematic depiction of a soluble scFv.
  • FIG. 2 is a physical map of plasmid pCC-508F which is used for the production of scFv-508-CBD fusion protein (also referred to herein as 508(Fv)-CBD) under control of lac promoter.
  • Amp res - a gene encoding ⁇ - lactamase; VH and VL - sequences coding for the variable domains of the heavy and light chains of scFv-508, respectively; Lin - a gene coding for a (Gly4Ser)3 (SEQ ID NO:2) linker present between the variable domains VJJ and VL. Restriction sites and positions thereof are also shown.
  • FIG. 3 is a physical map of plasmid pfFEKCA-508 which is used according to the present invention for cytoplasmic expression of the scFv- 508-CBD fusion protein under the control of a Ty-promoter.
  • Amp res - a gene encoding ⁇ -lactamase; V j and VL - sequences coding for the variable domains of the heavy and light chains of scFv-508, respectively; Lin - a gene coding for a (Gly4Ser)3 (SEQ ID NO:2) linker present between the variable domains Vpj and VL- T7-promoter and T7 term - T7 promoter and T7 terminator sequences, respectively. Restriction sites and positions thereof are also shown.
  • FIG. 4 shows an analysis of ⁇ AP binding by antibody 508(Fv)-CBD in an ELISA assay.
  • the analyzed antibodies were added to ⁇ AP coated wells. Bound antibodies were detected with HRP conjugated secondary antibodies.
  • the parental 508 IgM antibody was used as a positive control.
  • the unrelated anti- ⁇ -galactosidase antibody Gal6(Fv)-CBD was used as a negative control.
  • FIG. 5 shows PCR analysis of phage DNA inserts.
  • Lane 1 contains a DNA size marker.
  • the arrow marks the position of an intact scFv migrating at about 750 bp.
  • FIG. 6 demonstrates expression and purification of 508(Fv)-CBD.
  • 5- 10 ⁇ g protein were loaded in each lane of a 14 % SDS polyacrylamide gel. Proteins were visualized by Coomassie brilliant blue staining. The arrow marks the position of the scFv-CBD fusion protein.
  • Lane 1 total cell extract from non-induced BL21(DE3) cells carrying 508((Fv)-CBD expression vector.
  • Lane 2 total cell extract from BL21(DE3) cells carrying 508((Fv)-CBD expression vector induced for 3 hours with IPTG.
  • Lane 3 - washed, solubilized and reduced inclusion bodies that were used in refolding.
  • Lane 4 protein that did not bind to cellulose during cellulose- assisted refolding.
  • Lane 5 protein washed away from cellulose with TBS.
  • Lane 6 protein washed away from crystalline cellulose with distilled water.
  • Lane 7 - soluble 508(Fv)-CBD recovered from cellulose by high-pH elution and neutralization.
  • FIG. 7 demonstrates the stability of 508(Fv)-CBD.
  • Purified 508(Fv)- CBD protein was stored at 4 °C for one day (dark squares) or one week (dark circles), and then analyzed for ⁇ AP binding in an ELISA assay, as described in the legend to Figure 4.
  • the unrelated antibody Gal6(Fv)-CBD served as a negative control (open squares).
  • FIG. 8 demonstrates quantitation of 508(Fv) mutants affinity- enrichment by PCR and DNA restriction analysis.
  • the DNA of 19 508(Fv)- mutant micro library clones before ( Figure 8a) and of 11 clones picked up after one cycle of affinity selection ( Figure 8b) were analyzed.
  • the DNA was digested with Pvul and separated on a 1.5 % agarose gel.
  • a non- mutated scFv-CBD appears as an intact 1250 bp fragment (upper arrow).
  • a mutated clone is indicated by the appearance of both 700 bp (middle arrow) and 550 bp (lower arrow) fragments.
  • a DNA size marker is shown in lane 1.
  • FIG. 9 shows an analysis of ⁇ AP binding ( Figure 9a) and stability ( Figure 9b) of mutated 508(Fv) derivatives in an ELISA assay.
  • the analyzed antibodies were added to ⁇ AP coated wells. Bound antibodies stored at 4 °C for one day or for one week were detected as described in the legend to Figure 7. 508(Fv) wild type (open squares), C96F (dark squares), C96Y (dark circles), C96S (dark triangles).
  • the unrelated anti- ⁇ - galactosidase antibody Gal6(Fv)-CBD was used as a negative control (open squares).
  • FIG. 10 shows an analysis of the specific inhibition of ⁇ AP binding by antibody 508F(Fv) in a competitive ELISA assay.
  • the antibody was pre- incubated with varying concentrations of the competing peptides: ⁇ AP (acids 1-16 of SEQ ID NO:3) (dark squares) or the unrelated peptide WVLD (SEQ ID NO:4) (open squares), before being added to ⁇ AP coated wells. Bound antibodies were detected as described in the legend to Figure 7.
  • FIGs. 11a and l ib show nucleotide (SEQ ID NO:5) and deuced amino acid (SEQ ID NO:6) sequences of scFv 508F heavy chain ( Figure 11a); and the linker and the variable region of the light chain ( Figure 1 lb).
  • the amino acid sequence is presented by a three-letter code; CDRs and the linker are underlined.
  • FIG. 12 demonstrates the prevention of ⁇ AP mediated toxic effect on PC 12 cells by 508F(Fv).
  • Cells were incubated with fibrillar ⁇ A alone, or with fibrillar ⁇ A that had been incubated with antibodies at different molar ratio of antibody/ ⁇ AP, as indicated.
  • An 3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyl tetrazolium bromide (MTT) assay was used to estimate cell survival.
  • FIG. 13 demonstrates the disaggregation of fibrillar ⁇ A by 508F(Fv).
  • the fibrillar state of pre-formed ⁇ A fibrils were measured with or without incubation with antibodies at different molar ratio of antibody/ ⁇ AP, as indicated.
  • the fluorescence of thioflavin-T (ThT) reagent in a ThT assay which is proportional to fibril ⁇ A was used to assess the fibril morphology.
  • FIGs. 14a-d demonstrate the detection of filamentous phage (f88- EFRH) in brain sections via immunofluorescence one day following a single dose applied intranasally.
  • FIGs. 15a-d demonstrate the disappearance of filamentous phage (f88-EFRH) from mouse brain 28 days following a single intranasal administration. Disappearance of filamentous phage from mouse olfactory bulb and hippocampus is demonstrated in sections of these organs using fluorescent rabbit anti-phage antibody ( Figures 15a and 15c, respectively), as is compared to an untreated mouse brain ( Figures 15b and 15d, respectively). The sections were observed using a fluorescence microscope at a final magnification of x 10.
  • FIGs. 16a-d show histology of mouse brain sections after phage f88- EFRH clearance.
  • Brain sections of olfactory organ ( Figure 16a) and hipocampous ( Figure 16c) after 28 days following phage f88-EFRH administration were stained with hematoxylin and eosin, and compared to sections of an untreated brain ( Figures 16b and 16d, respectively). The stained sections were examined and photographed at a final magnification of x 40.
  • FIGs. 17a-d show fluorescence detection of biotin of phage pCC- 508F coupled to biotinylated ⁇ AP (acids 1-16 of SEQ ID NO:3) in mouse brain sections following a single intranasal administration. Appearance of ⁇ AP (acids 1-16, SEQ ID NO:3) coupled to filamentous phage displaying scFv508F in mice olfactory bulb and hippocampus sections using streptavidin coupled to PE ( Figures 17a and 17c, respectively) as is compare to an untreated mouse brain ( Figures 17b and 17d, respectively). The sections were observed using a fluorescence microscope at a final magnification of x 20.
  • FIGs. 18a-d show histology of mouse brain after phage pCC-508F coupled to biotinylated ⁇ AP (acids 1-16 of SEQ ID NO:3) administration.
  • Olfactory organ ( Figure 18a) and hippocampus ( Figure 18b) sections one day following phage administration were stained with hematoxylin and eosin, and were compared to untreated mouse brain sections ( Figures 18c and 18d, respectively). The stained sections were examined and photographed at a final magnification of x 40.
  • FIG 19 is a diagram of immunization schedule with filamentous phage displaying the EFRH (SEQ ID NO: 1) epitope of ⁇ -amyloid peptide.
  • FIGs. 20a and 20b show immunization with f3 filamentous phage displaying EFRH (SEQ ID NO: l) epitope of ⁇ -amyloid peptide as a fusion of phage glycoprotein III (gpIII). Serum IgG titer of different bleeds from mice immunized with the EFRH-phage according to the schedule of Figure
  • N-terminal epitope (acids 1-16, SEQ ID NO:3) of ⁇ -amyloid ( Figure 20b).
  • FIG. 21 demonstrates long lasting immunization with f3 filamentous phage. Serum IgG titer of different bleeds from mice immunized with
  • FIG. 22 show binding of anti-aggregating ⁇ AP monoclonal antibody
  • mAb 10D5 to peptide-presenting phage selected from an f88 phage library.
  • Unrelated mAb 5.5 raised against acetylcholine receptor was used as a negative control.
  • Antibodies were added to phage-coated wells and
  • FIG. 23 show binding of anti-aggregating ⁇ AP mAb (10D5) to a YYEFRH (SEQ ID NO:7)-phage and VHEPHEFRHVALNPV (SEQ ID NO:8)-phage.
  • Antibody in concentration of 1 ⁇ g/ml was added to phage- coated wells and binding was analyzed by ELISA. Filamentous phage without insert was used as a control.
  • FIGs. 24a-b show immunization with f88 filamentous phage displaying EFRH (SEQ ID NO: l) epitope of ⁇ -amyloid peptide as a fusion of phage glycoprotein VIII (gpVIII). Serum IgG titer of different bleeds from mice immunized with EFRH-phage against wild type filamentous phage coat proteins ( Figure 24a) and the N-terminal epitope (acids 1-16, SEQ ID NO:3) of ⁇ -amyloid peptide ( Figure 24b).
  • FIG. 25 shows inhibition of serum of an immunized mice in binding to ⁇ AP by synthetic peptides derived from the N-terminal of ⁇ -amyloid peptide.
  • the assay was done with 1 :3000 dilution of serum after a third immunization with f88-EFRH reacted with the various peptides in various concentrations per well, as indicated.
  • the peptide WVLD (SEQ ID NO:4) was used as a negative control.
  • FIG. 26 demonstrates prevention of ⁇ AP mediated toxic effect on PC 12 cells by serum antibodies raised against f88-EFRH-phage.
  • Cells were incubated with fibrillar ⁇ A alone, or with fibrillar ⁇ A that has been incubated with serum from the third bleeding at different concentration.
  • the negative control was serum from a non-immunized mouse.
  • the MTT assay was used to estimate cell survival.
  • FIG. 27 demonstrates interference with fibrillar ⁇ -amyloid formation by serum antibodies raised against the f88-EFRH-phage.
  • Estimation of the fluorescence of ThT which correlates with the amount of fibrillar ⁇ -amyloid formed after incubation for a week at 37 °C in the presence of serum samples diluted as indicated.
  • the negative control was serum from a non- immunized mouse.
  • the positive control was without serum.
  • Fibril formation was measured by the ThT assay.
  • FIG. 28 illustrates the amino acids sequence corresponding to the human prion protein 106-126 (SEQ ID NO:25) and to the mouse homologue.
  • FIG. 29 demonstrates the neurotoxicity effect of the PrP peptide as measured by MTT assay.
  • PC 12 cells were seeded in 96 well plates in a DMEM medium supplemented with 2mM insulin, 2 ⁇ M L-glutamine and 100 units penicillin/streptomycin. Cell viability was assessed by the MTT assay following incubation with PrP 106-126, (at different concentrations). PrP 106-126 was either preincubated for 4 days at 37 °C and then added to the cells for 3 days (grey bars), or was preincubated for 4 days at 37 °C and then added to the cells for 5 days (white bars) or was preincubated for 7 days at 37 °C and was then added to the cells for 5 days (black bars).
  • FIG. 30 illustrates the extent of aggregation of the PrP peptide, using ThT binding assay.
  • PrP 106-126 (0-0.8 mg/ml) was incubated for 7 days at 37 °C and emmision at 482 nm was measured to determine the extent of aggregation.
  • FIG. 31 demonstrates the protective effect of mAbs 3-11, 2-40 on PrP peptide neurotoxicity.
  • PC 12 cells were seeded in a 96 wells plate in a DMEM medium supplemented with 2mM insulin 2mM L-glutamine and 100 units penicillin/streptomycin and were incubated for three days. The following treatments were conducted: (1) Positive Control, untreated cells; (2) 100 ⁇ M PrP 106-126 that was preincubated for 7 days at 37°C; (3,4,5) an aggregated peptide that was preincubated for 1 hour before exposure to the cells together with the mAbs 3-11 (treatment 3), 2-40 (treatment 4) and 3F4 (treatment 5). Cell viability was assessed using the MTT assay.
  • FIG. 32 illustrates the modulation of PrP conformation by the mAbs.
  • PrP 106-126 0.3 mg/ml was incubated for 7 days at 37°C (1) and with mAbs 2-40, 3-11 and 3F4 (treatments 2, 3 and 4, respectively).
  • the antibodies were incubated with the sample for 24 hours either prior to the PrP incubation (grey bars) or following a one week PrP incubation (white bars). Fibril formation was assessed by the ThT binding assay.
  • FIG. 33 shows the concentration dependent protective effect of mAb 3-11 against PrP fibrillar aggregate formation.
  • PrP 106-126 0.3 mg/ml was incubated for 7 days at 37°C with diluted mAb 3-11 (1 : 1, 1 :10, 1 :50, corresponding to treatments 1, 2, and 3, respectively). The antibody was incubated with the sample for 24 hours either prior to (grey bars), or following (white bars), the one week incubation of PrP.
  • Amyloid fibril formation was assessed using ThT binding assay
  • the present invention is of methods, pharmaceutical agents and compositions, which can be used for treating plaque-forming diseases, including, but not limited to, Alzheimer's disease and prion generated plaque forming diseases.
  • the present invention can be used to (i) induce active immunity to plaque derived antigens in a recipient by immunizing with at least one epitope of an aggregating protein associated with plaque formation in a plaque forming disease on a display vehicle, so that antibodies elicited in response to immunization are capable of preventing plaque formation and/or of disaggregating existing plaques; and (ii) induce passive immunity by administering at least an immunological portion of an antibody which can bind to at least one epitope of an aggregating protein associated with plaque formation in a plaque forming disease, raised against plaque derived antigens, cloned and displayed on a display vehicle, capable of preventing plaque formation and of disaggregating existing plaques.
  • the present invention further relates to a method of targeting a display vehicle to the brain of an animal, including man, so that plaques present in the brain, such as beta amyloid plaques in brains of Alzheimer's disease patients, may be disaggregated.
  • the present invention also related to a method of detecting aggregate forming prion proteins in a biological sample.
  • antigens derived from beta amyloid peptide were displayed on the surface of a filamentous phage which was used for immunization of experimental animals. All of the peptides employed contained the EFRH epitope (SEQ ID NO: l, residues 3-6, SEQ ID NO:3) of beta amyloid peptide (SEQ ID NO:3). The epitope was presented as a fusion protein of fd phage coat glycoprotein III or VIII. Doses ranging from 10 to 10 phages per injection were employed on 8 week old female BALB/c mice.
  • a typical immunization schedule included three injections at 14-day intervals, administered either intraperitoneally or intranasally.
  • the antibody serum titer of subject mice was tested for the production of A ⁇ specific antibodies by enzyme linked immunosorbent assay (ELISA) as detailed in methods and materials hereinbelow.
  • ELISA enzyme linked immunosorbent assay
  • Serum titers were subsequently shown to persist for 1 1 months in response to a protocol including only 3 immunizations. While all tested epitopes containing EFRH produced a titer, displaying the epitope on the surface of a display vehicle produced far highest and unexpected titers. These high titers are believed to be a result of the great number of copies presented to the immune system using this method, and this idea is supported by results of binding assays using controlled amounts of sera.
  • the anti-aggregating properties of the obtained polyclonal antibody raised against EFRH epitopes with respect to beta-amyloid fibril formation was measured by the ThT binding assay. Serum, at dilution of 1 : 10 and 1 : 100, disrupted formation of fibril structure of ⁇ -amyloid with extensive deterioration of fibril morphology, as indicated by a substantial decrease in ThT fluorescence. The unrelated serum used as control (serum from un- immunized mouse) did not significantly inhibit fibril formation.
  • Diluted serum produced according to this embodiment of the present invention prevented the neurotoxicity of beta amyloid peptide.
  • This result implies potential clinical utility in preventing brain deterioration of patients suffering from amyloid plaque diseases.
  • site-directed antibodies designated mAbs 3-11 and 2-40
  • mAbs 3-11 and 2-40 site-directed antibodies
  • the mAbs generated by the preset invention also significantly decrease the peptide fibrillar aggregation and reverse the aggregated form to a disaggregated conformation as assayed by the ThT binding assay.
  • a method of treating a plaque forming disease is effected by displaying a polypeptide on a display vehicle, the polypeptide representing at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the at least one epitope being capable of eliciting antibodies capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein, and introducing the display vehicle into a body of a recipient, so as to elicit the antibodies capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein.
  • the display vehicle is selected such that less than 30 days following an introduction of a triple dose of 10 10 units thereof to the recipient, a titer of the antibodies in the recipient is above 1 :50,000, as is determined by
  • an agent for treating a plaque forming disease comprising a display vehicle displaying a polypeptide, the polypeptide representing at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the at least one epitope being capable of eliciting antibodies capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein.
  • compositions for treating a plaque forming disease comprising an effective amount of a display vehicle displaying a polypeptide, the polypeptide representing at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the at least one epitope being capable of eliciting an effective amount of antibodies capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein, and a pharmaceutically acceptable carrier.
  • a method of preparing a display vehicle for treating a plaque forming disease is effected by genetically modifying a genome of a display vehicle by inserting therein a polynucleotide sequence encoding a polypeptide representing at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the at least one epitope being capable of eliciting antibodies capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein, such that when the display vehicle propagates the polypeptide is displayed by the display vehicle.
  • beta amyloid peptide antigens in conjunction with adjuvants to effect immunization has previously been difficult due to a combination of high toxicity and low titers which result.
  • immunization of a mouse with a 16 amino acids peptide of beta-amyloid conjugated to KLH was carried out. This immunization produced a low but measurable antibody titer against beta- amyloid.
  • IgM hybridoma 508 expressing scFvAb with specificity to beta-amyloid.
  • RNA was subsequently extracted from this hybridoma and was employed for antibody cloning.
  • IgM 508 hybridoma showed specific activity to A ⁇ in preventing its toxic affect on PC 12 cells (Anavi, S. 1998, M. Sc. thesis from the department of Molecular Microbiology and Biotechnology of the Tel-Aviv University, Israel).
  • VJJ and VL sequences of IgM 508 were cloned separately and linked using a commercially available vector to form a single chain antibody with anti-beta amyloid specificity.
  • This single chain antibody was subsequently expressed as a fusion protein in a phage display library and clones with anti beta amyloid activity were selected for propagation in E. coli. Further reduction to practice was demonstrated by determining the apparent binding constants of the purified antibody presenting phage to amyloid beta were measured by ELISA test, and half-maximal binding was obtained at an antibody concentration of 340 ng/ml, corresponding to 8x10" 6 M. This result anticipate that the prepared single chain antibody will be effective under in vivo conditions. This phage was also able to disrupt already formed fibril structures confirming that the purified single chain antibody is biologically active, as suggested by the binding constant determination.
  • a model for assessing PrP 106-126 toxicity was established by the present inventors and utilized to test the effectiveness of two immunoglobulin clones [designated mAb 3-11 (IgM) and mAb 2-40 (IgGl)] for neuroprotective and disaggregative capabilities.
  • both mAb 3-11 and mAb 2- 40 significantly reduced the dose dependent toxic effects of PrP 106-126 on PC-12 cells.
  • Co-incubation of mAb 3-11 with PrP 106-126 prevented fibrillar aggregation, while administration of mAb 3-11 to already formed aggregates, resulted in disaggregation of 50% of the amyloid fibrils (Example 21).
  • a method of treating a plaque forming disease is effected by displaying a polypeptide representing at least an immunological portion of an antibody being for binding at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the binding capable of disaggregating the aggregating protein and/or of preventing aggregation of the aggregating protein, and introducing the display vehicle into a body of a recipient so as to disaggregate the aggregating protein and/or prevent its aggregation.
  • introducing the display vehicle into the body of the recipient so as to disaggregate the aggregating protein and/or prevent the aggregation of the aggregating protein is effected through an olfactory system of the recipient.
  • an agent for treating a plaque forming disease there is provided an agent for treating a plaque forming disease.
  • the agent according to this aspect of the present invention comprising a display vehicle displaying a polypeptide representing at least an immunological portion of an antibody which can bind at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the immunological portion of the antibody being capable of disaggregating said aggregating protein and/or of preventing aggregation of the aggregating protein.
  • compositions for treating a plaque forming disease comprising an effective amount of a display vehicle displaying a polypeptide representing at least an immunological portion of an antibody which can bind at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the immunological portion of the antibody being capable of disaggregating the aggregating protein, and a pharmaceutically acceptable carrier.
  • a method of preparing a display vehicle for treating a plaque forming disease is effected by genetically modifying a genome of a display vehicle by inserting therein a polynucleotide sequence encoding at least an immunological portion of an antibody capable of binding at least one epitope of an aggregating protein associated with plaque formation in the plaque forming disease, the immunological portion of the antibody being capable of disaggregating the aggregating protein.
  • patient For pu ⁇ oses of this specification and the accompanying claims the terms "patient”, “subject” and “recipient” are used interchangeably. They include humans and other mammals which are the object of either prophylactic, experimental, or therapeutic treatment.
  • beta amyloid peptide is synonymous with " ⁇ -amyloid peptide", “ ⁇ AP”, “ ⁇ A”, and “A ⁇ ”. All of these terms refer to a plaque forming peptide derived from amyloid precursor protein.
  • PrP protein refers to polypeptides which are capable, under appropriate conditions, of inducing the formation of aggregates responsible for plaque forming diseases.
  • PrP normal cellular prion protein
  • PrP Sc scrapie isoform
  • BSE bovine spongiform encephalopathy
  • CJD Creutzfeldt- Jakob Disease
  • GSS Gerstmann- Straussler-Scheinker disease
  • FFI fatal familial insomnia
  • disaggregating refers to solubilization of aggregated proteins typically held together by non covalent bonds.
  • compositions that comprises A ⁇ peptide encompasses both an isolated A ⁇ peptide and A ⁇ peptide as a component of a larger polypeptide sequence.
  • an immunological portion of an antibody may be included as a part of a larger of the antibody, say the entire antibody.
  • treating includes substantially inhibiting, slowing or reversing the progression of a disease, substantially ameliorating clinical symptoms of a disease or substantially preventing the appearance of clinical symptoms of a disease.
  • plaque forming disease refers to diseases characterized by formation of plaques by an aggregating protein (plaque forming peptide), such as, but not limited to, beta-amyloid, serum amyloid A, cystantin C, IgG kappa light chain or prion protein, in diseases such as, but not limited to, early onset Alzheimer's disease, late onset Alzheimer's disease, presymptomatic Alzheimer's disease, SAA amyloidosis, hereditary Icelandic syndrome, senility, multiple myeloma, and to prion diseases that are known to affect humans, such as for example, kuru, Creutzfeldt- Jakob disease (CJD), Gerstmann-Straussler-Scheinker disease (GSS), and fatal familial insomnia (FFI) and animals, such as, for example, scrapie and BSE.
  • an aggregating protein such as, but not limited to, beta-amyloid, serum amyloid A, cystantin C, IgG kappa light chain
  • any proposed treatment modality must demonstrate an ability to cross the blood brain barrier (BBB) as well as an ability to dissolve amyloid plaques.
  • BBB blood brain barrier
  • the average size of molecules capable of penetrating the BBB is approximately 2 kDa.
  • Monoclonal antibodies are typically in the range 135-900 kDa. Therefore, future therapeutic use of antibodies in treating amyloid plaque diseases must rely on either reduction of their size concurrent with retention of activity, or on development of novel delivery strategies.
  • Small synthetic peptides consisting of antigen epitopes such as the EFRH (SEQ ID NO:l) epitope of A ⁇ or the PrP 106-126 peptide (SEQ ID NO:25) described herein, are in general poor antigens and need to be coupled to a larger carrier. Even after coupling they may induce only a low affinity immune response. For example, injection of A ⁇ -KLH or A ⁇ -fibril leads to very slow immune response (Anavi, S., 1998, M. Sc. thesis from the Department of Molecular Microbiology and Biotechnology of the Tel- Aviv University) and many efforts have been made to circumvent low affinity response, with limited success.
  • BBB blood brain barrier
  • Olfactory receptor neurons are bipolar cells that reside in the epithelial lining of the nasal cavity. Their axons traverse the cribriform plate and project to the first synapse of the olfactory pathway in the olfactory pathway in the olfactory bulb of the brain. This configuration makes them a highway by which viruses or other transported substances may gain access to the CNS across the BBB.
  • the BBB may limit the entry of antibody circulating in the periphery to the CNS.
  • a ⁇ anti-aggregating antibodies displayed on a phage surface have the potential not only be delivered directly to the CNS by intranasal administration but also to prevent olfactory permanent damage by ⁇ A in the patients.
  • intranasal administration (Mathison et al., J. Drug Target, 1998) 5(6), 415-441; Chou et al., Biopharm Drug Dispos. 1997) 18(4):335-46; et al., Gene Therapy 1995) 2:418-423) enables the direct entry of viruses and macromolecules into the CSF or CNS.
  • a vehicle displaying an immunological portion of an antibody capable of disaggregating, or preventing the formation of, a polypeptide aggregate associated with a plaque forming disease is delivered via this route to the brain.
  • intranasal administration of such a vehicle may also prevent the progression of the disease by minimizing the amount of peripheral A ⁇ available to form plaques.
  • display vehicles such as filamentous phages as a drug delivery system to the CNS opens new horizons for therapeutic approaches for Alzheimer's disease, as well as for other neurodegenerative diseases involving toxic extracellular aggregation of human peptides such as for example, prion generated diseases.
  • the display vehicle according to the present invention can be of any type including viral (e.g., bacteriophage, such as filamentous bacteriophage, fd, for example), bacterial and prion display vehicles.
  • the display vehicle can be a double stranded DNA virus, a single stranded DNA virus, an RNA virus (positive or negative strand), a bacteria and a polypeptide carrier.
  • the display vehicle is capable of propagation in the recipient.
  • a bacteriophage display vehicle can be propagated in bacterial flora, such as Escherichia coli residing in the recipient's body.
  • the display vehicle is an in vivo non-propagateable particle.
  • the phage or virus vehicle has promise as a targetable in vivo therapy approach. Although concerns about the potential infection of the natural intestinal flora (Delmastro et al, Vaccine 1997, 15: 1276-1285; Willis et al., Gene. 1993, 128:79-83; Poul et al., J. Mol. Biol. 1999, 288, 203-211) have been expressed, UV inactivation of phage showed (Delmastro et al., Vaccine 1997, 15: 1276-1285) that they are as immunogenic as their infective counte ⁇ arts.
  • the display vehicles employed in the present invention may be either replicating or non-replicating.
  • Phage or virus display involves the expression of cDNA clones as fusion proteins with phage or virus coat proteins. If the cDNAs selected for expression encode antigens, the phage or virus may then be employed as an antigen presenting vehicle, which can optionally replicate within a recipient.
  • antigens displayed by a phage or virus may be used directly for vaccination, without antigen purification.
  • the bulk of the coat proteins serve to stimulate a general immune response because they are "non-self with respect to the vaccinated subject.
  • the antigen-coat protein fusion elicits a specific antibody against epitopes in the displayed cDNA gene product.
  • Antibody phage or virus display is accomplished, for example, by fusing the coding sequence of the antibody variable regions to a phage or virus coat protein.
  • variable (V) regions (V]-[ and VL) mRNA isolated from antibody-producing cells is reverse-transcribed into cDNA, and heavy and light chains assembled randomly to encode single chain Fv (scFv).
  • scFv single chain Fv
  • a suitable vector such as a phagemid vector for expression and display on the phage or virus surface.
  • This linkage between antibody genotype and phenotype allows the enrichment of antigen specific phage or virus antibodies, using immobilized or labeled antigen. Phage or virus that display a relevant antibody will be retained on a surface coated with antigen, while non-adherent phages or viruses will be washed away. Bound phages or viruses can be recovered from the surface, re-infected into suitable host cells and re-grown for further enrichment and, eventually for binding analysis.
  • Phage or virus antibody genes can be sequenced, mutated and screened to improve antigen binding.
  • the antibody can be maintained on the surface of the phage or virus for further manipulation or be released as soluble scFv (-25 kDa) fragment.
  • phage display Since its invention at the beginning of the 1990's, antibody phage display has revolutionized the generation of monoclonal antibodies and their engineering. This is because phage display allows antibodies to be made completely in vitro, bypassing the immune system and the immunization procedure, and allowing in vitro tailoring of the affinity and specificity of the antibody. It is therefore anticipated that the most efficient new vaccine development strategies will employ this technology.
  • Additional features can be added to the vector to ensure its safety and/or enhance its therapeutic efficacy.
  • Such features include, for example, markers that can be used to negatively select against cells infected with the recombinant virus such as antibiotic sensitivity. Negative selection is therefore a means by which infection can be controlled because it provides inducible suicide through the addition of antibiotic. Such protection ensures that if, for example, mutations arise that produce altered forms of the viral vector or recombinant sequence, cellular transformation will not occur.
  • Features that limit expression to particular cell types can also be included. Such features include, for example, promoter and regulatory elements that are specific for the desired cell type.
  • Viruses are very specialized infectious agents that have evolved, in many cases, to elude host defense mechanisms. Typically, viruses infect and propagate in specific cell types.
  • the targeting specificity of viral vectors utilizes its natural specificity to specifically target predetermined cell types and thereby introduce a recombinant gene into the infected cell.
  • polypeptide refers to a stretch of amino acids covalently linked there amongst via peptide bonds.
  • Different polypeptides have different functionalities according to the present invention. While according to one aspect a polypeptide is derived from an immunogen designed to induce an active immune response in a recipient, according to another aspect of the invention, a polypeptide is derived from an antibody which results following the elicitation of an active immune response, in, for example, an animal, and which can serve to induce a passive immune response in the recipient. In both cases, however, the polypeptide is encoded by a polynucleotide according to any possible codon usage.
  • immune response refers to the development of a beneficial humoral (antibody mediated) and/or a cellular (mediated by antigen-specific T cells or their secretion products) response directed against an aggregating protein (plaque forming peptide) in a recipient patient.
  • a cellular immune response is elicited by the presentation of polypeptide epitopes in association with Class I or Class II MHC molecules, to activate antigen-specific CD4 T helper cells and/or CD8 cytotoxic T cells.
  • the response may also involve activation of monocytes, macrophages, NK, cells, basophils, dendritic cells, astrocytes, microglia cells, eosinophils or other components of innate immunity.
  • active immunity refers to any immunity conferred upon a subject by administration of an antigen.
  • Passive immunity refers to any immunity conferred upon a subject without administration of an antigen. “Passive immunity” therefore includes, but is not limited to, administration of a replicating display vehicle which includes an immunological portion of an antibody presented on its surface to a recipient. Although replication of such a vehicle is active, the immune response is passive from the standpoint of the recipient.
  • epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation.
  • Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed. (1996).
  • Antibodies that recognize the same epitope can be identified in a simple immunoassay showing the ability of one antibody to block the binding of another antibody to a target antigen.
  • T-cells recognize continuous epitopes of about nine amino acids for CD8 cells or about 13-15 amino acids for CD4 cells.
  • T cells that recognize the epitope can be identified by in vitro assays that measure antigen-dependent proliferation, as determined by H- thymidine inco ⁇ oration by primed T cells in response to an epitope (Burke et al., J. Inf. Dis. 170, 1110-19, 1994), by antigen-dependent killing (cytotoxic T lymphocyte assay, Tigges et al., J. Immunol. 156, 3901-3910) or by cytokine secretion.
  • the presence of a cell-mediated immunological response can be determined by proliferation assays (CD4 T cells) or CTL (cytotoxic T lymphocyte) assays.
  • the relative contributions of humoral and cellular responses to the protective or therapeutic effect of an immunogen can be distinguished by separately isolating IgG and T-cells from an immunized syngeneic animal and measuring protective or therapeutic effect in a second subject.
  • antibody or “immunoglobulin” are used interchangeably and refer to any of several classes of structurally related proteins that function as part of the immune response of an animal or recipient, which proteins include IgG, IgD, IgE, IgA, IgM and related proteins.
  • Antibodies of the IgG class are made up of four polypeptide chains linked together by disulfide bonds.
  • the four chains of intact IgG molecules are two identical heavy chains referred to as H-chains and two identical light chains referred to as L-chains.
  • a host such as a rabbit or goat, is immunized with the antigen or antigen fragment, generally with an adjuvant and, if necessary, coupled to a carrier.
  • Antibodies to the antigen are subsequently collected from the sera of the host.
  • the polyclonal antibody can be affinity purified against the antigen rendering it monospecific. Previous experience has shown that standard production of polyclonal antibodies is not the method of choice for preparation of disaggregating antibodies for plaque forming peptides due to problems of poor titer and toxicity.
  • hyperimmunization of an appropriate donor generally a mouse, with the antigen is undertaken. Isolation of splenic antibody producing cells is then carried out. These cells are fused to a cell characterized by immortality, such as a myeloma cell, to provide a fused cell hybrid (hybridoma) which can be maintained in culture and which secretes the required monoclonal antibody.
  • the cells are then be cultured, in bulk, and the monoclonal antibodies harvested from the culture media for use.
  • monoclonal antibodies are specific to a single epitope.
  • Monoclonal antibodies often have lower affinity constants than polyclonal antibodies raised against similar antigens for this reason.
  • Monoclonal antibodies may also be produced ex-vivo by use of primary cultures of splenic cells or cell lines derived from spleen (Anavi, S., 1998. Locking the N-terminal of the Alzheimer ⁇ -amyloid peptide prevents the neurotoxicity in cell cultures, M. Sc. thesis.
  • RNAs from antibody producing B-lymphocytes of animals, or hybridoma are reverse-transcribed to obtain complementary DNAs (cDNAs).
  • cDNAs complementary DNAs
  • Antibody cDNA which can be full length or partial length, is amplified and cloned into a phage or a plasmid.
  • the cDNA can be a partial length of heavy and light chain cDNA, separated or connected by a linker.
  • the antibody, or antibody fragment is expressed using a suitable expression system to obtain recombinant antibody.
  • Antibody cDNA can also be obtained by screening pertinent expression libraries.
  • the antibody can be bound to a solid support substrate or conjugated with a detectable moiety or be both bound and conjugated as is well known in the art.
  • a solid support substrate For a general discussion of conjugation of fluorescent or enzymatic moieties see Johnstone & Tho ⁇ e, Immunochemistry in Practice, Blackwell Scientific Publications, Oxford, 1982.
  • the binding of antibodies to a solid support substrate is also well known in the art. See for a general discussion Harlow & Lane Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Publications, New York, 1988 and Borrebaeck, Antibody Engineering - A Practical Guide, W.H. Freeman and Co., 1992.
  • an immunological portion of an antibody include an F(ab')2 fragment of an antibody, an Fab fragment of an antibody, an Fv fragment of an antibody, a heavy chain of an antibody, a light chain of an antibody, an unassociated mixture of a heavy chain and a light chain of an antibody, a heterodimer consisting of a heavy chain and a light chain of an antibody, a catalytic domain of a heavy chain of an antibody, a catalytic domain of a light chain of an antibody, a variable fragment of a light chain of an antibody, a variable fragment of a heavy chain of an antibody, and a single chain variant of an antibody, which is also known as scFv.
  • the term includes chimeric immunoglobulins which are the expression products of fused genes derived from different species, one of the species can be a human, in which case a chimeric immunoglobuhn is said to be humanized.
  • an immunological portion of an antibody competes with the intact antibody from which it was derived for specific binding to an antigen.
  • an antibody or preferably an immunological portion of an antibody can be chemically conjugated to, or expressed as, a fusion protein with other proteins.
  • all such fused proteins are included in the definition of antibodies or an immunological portion of an antibody.
  • immunogenic agent or "immunogen” or
  • antigen are used interchangeably to describe a molecule capable of inducing an immunological response against itself on administration to a recipient, either alone, in conjunction with an adjuvant, or presented on a display vehicle.
  • adjuvant refers to a compound that, when administered in conjunction with an antigen, augments the immune response to the antigen, but when administered alone does not generate an immune response to the antigen.
  • adjuvants can augment an immune response by several mechanisms including lymphocyte recruitment, stimulation of B and/or T cells, and stimulation of macrophages.
  • a pharmaceutical preparation according to the present invention includes, as an active ingredient, a display vehicle displaying at least one epitope of an aggregating protein associated with plaque formation in a plaque forming disease, the at least one epitope being capable of eliciting antibodies capable of disaggregating the aggregating protein.
  • a pharmaceutical composition according to the present invention includes, as an active ingredient, a display vehicle displaying at least an immunological portion of an antibody being for binding at least one epitope of an aggregating protein associated with plaque formation in said plaque forming disease, said immunological portion of said antibody being capable of disaggregating said aggregating protein.
  • the preparation according to the present invention can be administered to an organism per se, or in a pharmaceutical composition where it is mixed with suitable carriers or excipients.
  • a "pharmaceutical composition” refers to a preparation of one or more of the active ingredients described herein with other chemical components such as physiologically suitable carriers and excipients.
  • the pu ⁇ ose of a pharmaceutical composition is to facilitate administration of a compound to an organism.
  • active ingredient refers to the preparation accountable for the biological effect.
  • pharmaceutically acceptable carrier refers to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered compound.
  • An adjuvant is included under these phrases.
  • excipient refers to an inert substance added to a pharmaceutical composition to further facilitate administration of an active ingredient.
  • excipients include calcium carbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils and polyethylene glycols.
  • Suitable routes of administration may, for example, include oral, rectal, transmucosal, especially transnasal, intestinal or parenteral delivery, including intramuscular, subcutaneous and intramedullary injections as well as intrathecal, direct intraventricular, intravenous, inrtaperitoneal, intranasal, or intraocular injections.
  • compositions of the present invention may be manufactured by processes well known in the art, e.g., by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes.
  • compositions for use in accordance with the present invention thus may be formulated in conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into preparations which, can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
  • the active ingredients of the invention may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer.
  • physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer.
  • penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
  • the compounds can be formulated readily by combining the active compounds with pharmaceutically acceptable carriers well known in the art.
  • Such carriers enable the compounds of the invention to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, and the like, for oral ingestion by a patient.
  • Pharmacological preparations for oral use can be made using a solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries if desired, to obtain tablets or dragee cores.
  • Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carbomethylcellulose; and/or physiologically acceptable polymers such as polyvinylpyrrolidone (PVP).
  • disintegrating agents may be added, such as cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
  • Dragee cores are provided with suitable coatings.
  • suitable coatings For this pu ⁇ ose, concentrated sugar solutions may be used which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, titanium dioxide, lacquer solutions and suitable organic solvents or solvent mixtures.
  • Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
  • Pharmaceutical compositions, which can be used orally include push-fit capsules made of gelatin as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol.
  • the push- fit capsules may contain the active ingredients in admixture with filler such as lactose, binders such as starches, lubricants such as talc or magnesium stearate and, optionally, stabilizers.
  • filler such as lactose, binders such as starches, lubricants such as talc or magnesium stearate and, optionally, stabilizers.
  • the active ingredients may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols.
  • stabilizers may be added. All formulations for oral administration should be in dosages suitable for the chosen route of administration.
  • the compositions may take the form of tablets or lozenges formulated in conventional manner.
  • the active ingredients for use according to the present invention are conveniently delivered in the form of an aerosol spray presentation from a pressurized pack or a nebulizer with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichloro-tetrafluoroethane or carbon dioxide.
  • a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichloro-tetrafluoroethane or carbon dioxide.
  • the dosage unit may be determined by providing a valve to deliver a metered amount.
  • Capsules and cartridges of, e.g., gelatin for use in a dispenser may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
  • compositions described herein may be formulated for parenteral administration, e.g., by bolus injection or continuos infusion.
  • Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multidose containers with optionally, an added preservative.
  • the compositions may be suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • compositions for parenteral administration include aqueous solutions of the active preparation in water-soluble form.
  • suspensions of the active ingredients may be prepared as appropriate oily or water based injection suspensions.
  • Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acids esters such as ethyl oleate, triglycerides or liposomes.
  • Aqueous injection suspensions may contain substances, which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol or dextran.
  • the suspension may also contain suitable stabilizers or agents which increase the solubility of the active ingredients to allow for the preparation of highly concentrated solutions.
  • the active ingredient may be in powder form for constitution with a suitable vehicle, e.g., sterile, pyrogen-free water based solution, before use.
  • the preparation of the present invention may also be formulated in rectal compositions such as suppositories or retention enemas, using, e.g., conventional suppository bases such as cocoa butter or other glycerides.
  • compositions suitable for use in context of the present invention include compositions wherein the active ingredients are contained in an amount effective to achieve the intended pu ⁇ ose. More specifically, a therapeutically effective amount means an amount of active ingredients effective to prevent, alleviate or ameliorate symptoms of disease or prolong the survival of the subject being treated.
  • the therapeutically effective amount or dose can be estimated initially from in vitro and cell culture assays.
  • a dose can be formulated in animal models to achieve a desired circulating antibody concentration or titer. Such information can be used to more accurately determine useful doses in humans.
  • Toxicity and therapeutic efficacy of the active ingredients described herein can be determined by standard pharmaceutical procedures in vitro, in cell cultures or experimental animals.
  • the data obtained from these in vitro and cell culture assays and animal studies can be used in formulating a range of dosage for use in human.
  • the dosage may vary depending upon the dosage form employed and the route of administration utilized.
  • the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. (See e.g., Fingl, et al., 1975, in "The Pharmacological Basis of Therapeutics", Ch. 1 p. l).
  • Dosage amount and interval may be adjusted individually to provide plasma or brain levels of antibodies which are sufficient to prevent aggregation or disaggregate existing aggregates (minimal effective concentration, MEC).
  • MEC minimum effective concentration
  • the MEC will vary for each preparation, but can be estimated from in vitro data. Dosages necessary to achieve the MEC will depend on individual characteristics and route of administration. Binding assays can be used to determine plasma concentrations.
  • Dosage intervals can also be determined using the MEC value. Preparations should be administered using a regimen, which maintains plasma levels above the MEC for 10-90 % of the time, preferable between 30-90 % and most preferably 50-90 %.
  • dosing can be of a single or a plurality of administrations, with course of treatment lasting from several days to several weeks or until cure is effected or diminution of the disease state is achieved.
  • compositions to be administered will, of course, be dependent on the subject being treated, the severity of the affliction, the manner of administration, the judgment of the prescribing physician, etc.
  • compositions of the present invention may, if desired, be presented in a pack or dispenser device, such as an FDA approved kit, which may contain one or more unit dosage forms containing the active ingredient.
  • the pack may, for example, comprise metal or plastic foil, such as a blister pack.
  • the pack or dispenser device may be accompanied by instructions for administration.
  • the pack or dispenser may also be accommodated by a notice associated with the container in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals, which notice is reflective of approval by the agency of the form of the compositions or human or veterinary administration. Such notice, for example, may be of labeling approved by the U.S. Food and Drug Administration for prescription drugs or of an approved product insert.
  • Compositions comprising a preparation of the invention formulated in a compatible pharmaceutical carrier may also be prepared, placed in an appropriate container, and labeled for treatment of an indicated condition, as if further detailed above.
  • the present invention also relates to a method of detecting both the pathogenic and non-pathogenic form of a prion protein in a biological sample.
  • a method of detecting a presence or an absence of a prion protein in a biological sample comprising the steps of: (a) incubating an anti-prion antibody or an immunoilogical portion thereof with the biological sample; and (b) determining a presence or an absence of antibody-antigen complexes, thereby determining the presence or the absence of the prion protein in the biological sample.
  • this aspect of the present invention provides a method of assaying or screening biological samples, such as body tissue or fluid suspected of including a prion protein either in a native non-disease conformation or a disease related conformation.
  • the detection method according to this aspect of the present invention can also be utilized for rapid and cost effective screening of products such as pharmaceuticals (derived from natural sources), foods, cosmetics or any materials which might contain prions.
  • the 508 IgM hybridoma used as the source for antibody variable- region sequences was generated from splenocytes of a mouse that had been immunized with a peptide corresponding to the 16 amino terminal residues of ⁇ AP conjugated to keyhole limpet hemocyanin, used as a carrier.
  • mRNA extraction, first strand cDNA synthesis, PCR amplification of variable heavy (Vpj) and variable light (VL) sequences, and assembly of scFv cassettes, were done according to protocols essentially as described (Pharmacia Biotech RPAS manual).
  • Assembled 508 scFv DNA was digested with Sfi and Notl, and 100 ng were ligated with 150 ng of vector D ⁇ A prepared by digestion of phagemid pCC-Gal6(Fv) (Berdichevsky Y et al, J Immunol Methods., 31 ;228( 1 -2) : 151 -62, 1999) with Sfil and Notl .
  • This phage-display system is designed to express the scFv in frame fusion protein with cellulose binding domain (CBD) derived from Clostridium thermocellum (Morag E et al. Appl Environ Microbiol., 61(5):1980-6, 1995).
  • Ligated D ⁇ A was introduced into XL-1 Blue cells (Stratagene, La Jolla, CA) by transformation and transformants were plated onto 2 X YT Agar plates containing 100 ⁇ g/ml ampicillin and 1 % glucose for overnight growth at 37 °C.
  • ⁇ -amyloid binding scFv-CBD fusion proteins Individual clones were picked and grown, each in 5 ml 2 X YT, 1 % glucose, 100 ⁇ g/ml Ampicillin overnight at 30 °C. IPTG was added at 1 mM for a 3 hr induction period. Soluble scFv-CBD fusion proteins were isolated from each clone by sonication of induced cell pellets.
  • This vector utilizes the strong T7 promoter for expression, where the T7 RNA polymerase gene is carried as a lac repressor controlled-IPTG inducible gene in E. coli BL21 (DE3) (Studier, F.W., et al., Methods Enzymol., 85, 60-89, 1990).
  • T7 RNA polymerase gene is carried as a lac repressor controlled-IPTG inducible gene in E. coli BL21 (DE3) (Studier, F.W., et al., Methods Enzymol., 85, 60-89, 1990).
  • 508(Fv)-CBD proteins accumulated as insoluble inclusion bodies. They were recovered by the cellulose-assisted refolding method as previously described (Berdichevsky Y et al, Protein Expr Purif, 17(2):249-59, 1999).
  • SDS polyacrylamide gel electrophoresis was used to separate proteins according to their molecular weight under denaturing conditions (Laemmli, U.K., Nature 227:263- 270,1970). Stability assay of the purified 508(Fv)-CBD protein:
  • the activity of purified 508(Fv)-CBD protein was checked before and after storage at 4 °C for 7 days. 250 ng/well ⁇ -amyloid peptide was covalently bound to epoxy-coated wells of microtiter plates for 16 hr at 4 °C (Solomon B. et al, Proc. Natl. Acad. Sci. USA. 94, 4109-41 12, 1997). Wells were blocked with a mixture of 3 % bovine semm albumin and bovine hemoglobin in PBS for 2 hr at 37 °C, then washed and incubated with the 508(Fv)-CBD protein (0.5 ⁇ g/ml or as otherwise specified) for 1 hr at 37 °C.
  • Bound antibody fragments were detected by incubation with HRP-conjugated rabbit anti-mouse antibodies (BioMakor, Rehovot, Israel), diluted 1 :5,000 and rabbit anti CBD diluted 1 : 10,000 in PBST for 1 hr at 37 °C. The bound antibody fragments were monitored as described above. Construction of a phage library for the isolation the 508(Fv) ⁇ AP binding mutants:
  • Splicing overlap extension (SOE) PCR technique (Lefenbrve, B., et al., Biotechniques, 19:186-188, 1995) was used to replace VL cysteine codon 96 of 508(Fv) with other codons.
  • pCC-508(Fv) DNA was used as template.
  • the template DNA was amplified with the following primers:
  • the antisense primer 508-mut-FOR 5'-CCCCCCTCCGAAC GTSNATGGGTAACTcgatcgCTGATGGCAGTA-3' (SEQ ID NO: 10) inserts a Pvul restriction site (underlined), where S represents nucleotides C or G and N represents A, C, T or G.
  • This primer was used for the replacement of cysteine codon 96 with phenylalanine (F), leucine (L), serine (S), tyrosine (Y) or tryptophan codons.
  • the primer Sfil 5'BACK 5'- ATCTATGCggcccagccggccATG-3' (SEQ ID NO: 11) inserts an Sfil site at the 5' end of the scFv.
  • the resulting PCR product (S/?I-508mut) corresponds to the 5' half of 508(Fv)-CBD.
  • the complete 508(Fv)-CBD was re-assembled by amplifying pCC-508(Fv) DNA with the S/tI-508mut PCR product from step 1 serving as the 5' end primer and CBD(BX): 5'-GTGGTGCTGAGTggatccta TACTACACTGCCACCGGG-3' (SEQ ID NO: 12) as the 3' end primer.
  • the final PCR product (S H-508mut-BX) is a complete 508(Fv)-CBD cassette with replacements at VL codon 96 and an engineered Pvul restriction site as a silent mutation for analysis.
  • St?I-508mut-BX DNA was digested with Sfil, Pvul and Notl and ligated in a three fragment ligation with Sfil and Notl linearized pCC-Gal ⁇ (Fv) D ⁇ A which is a phagemid vector used to display an anti E. coll ⁇ -galactosidase scFv (Berdichevsky Y et al, J Immunol Methods., 31;228(l-2): 151-62, 1999).
  • the resulting ligated phagemid D ⁇ A was introduced into E. coli XL- 1 -Blue cells by electroporation. Cultures of E.
  • a sample containing rescued phage particles was subjected to one round of affinity selection (biopanning) and amplification.
  • affinity selection biopanning
  • amplification cycle 0.5 ⁇ g/ml biotinylated ⁇ -amyloid 1-16 amino acid peptide ( ⁇ AP(l- 16), acids 1-16 OF SEQ ID NO:3) in a total volume of 1 ml were used.
  • the phages were pre-incubated with the biotinylated peptide for 2 hr at room temperature, and the reaction mixture was then layered on streptavidin- coated 30 mm polystyrene Petri dishes and incubated for 20 min at room temperature. Unbound phages were removed by extensive washing with PBST.
  • the bound phages were eluted with 0.3 ml of 0.1 M HC1 titrated to pH 2.2 with glycine. The eluate was neutralized with 80 ⁇ l of 0.5 M Tris (HC1) pH 10, and used to infect E. coli XL- 1 -Blue cells. Individual bacterial colonies containing amplified phage particles were used as a template for colony PCR (Novagen Madison, USA) with primers S zI5'Back and CBD(BX). The PCR product of about the size of an intact scFv-CBD fragment (about 1250 bp) was digested with the restriction enzyme Pvul and analyzed by agarose gel electrophoresis.
  • Rat phenochromocytoma PC 12 cells were cultured in DMEM supplemented with 5 % horse semm, 10 % fetal calf semm, 2 mM L- glutamine, and 100 units/ml penicillin/streptomycin and incubated at 37 °C under 5 % CO2.
  • cultured PC 12 cells were seeded into a 96-well plate at a density of 10 ⁇ cells/ 100 ⁇ l/well in a serum- free medium supplemented with 2 M of insulin.
  • the effect on the prevention of the neurotoxicity of ⁇ A was measured as follows: 0.12 mM ⁇ - amyloid that was incubated for a week at 37 °C for the generation of fibrils, and further incubated in the presence of 508F(Fv)-CBD or with the unrelated Gal6(Fv)-CBD at a molar ratio of ⁇ AP to scFv of 15:1 or 30:1 for 24 hr.
  • the ⁇ A/antibody mixture was added to the wells containing PC 12 cells.
  • the plates were incubated at 37 °C for 2 days, after which cell viability was assessed by measuring cellular redox activity with 3-(4,5- dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide (MTT), as described (Sladowski, D. et al., J. Immunol. Methods., 157:203-207,1993).
  • MTT 3-(4,5- dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide
  • Aggregation of ⁇ -amyloid peptide measured by Thioflavin T (ThT) fluorimetry Aggregation of ⁇ -amyloid peptide was measured by the Thioflavin T (ThT) binding assay, in which the fluorescence intensity reflects the degree of ⁇ -amyloid fibril formation. ThT characteristically stains amyloid-like deposits (Levine, H. Ill, Protein Sci., 2: 404-410,1993) and exhibits enhanced fluorescence emission at 485 nm upon excitation at 435 nm when added to the suspension of aggregated ⁇ -sheet preparations.
  • Aqueous solutions of 0.12 mM ⁇ AP in 0.1 M Tris (HCl) pH 7.1 were incubated at 37 °C for 1 week and further incubated in the presence of 508F(Fv)-CBD or with the unrelated Gal6(Fv)-CBD at a molar ratio of ⁇ AP to scFv of 15: 1 or 30:1 for 24 hr.
  • the fluorescence was measured after addition of 1 ml of ThT (2 ⁇ M in 50 mM Glycine, pH 9) with an LSB-50 Perkin Elmer Ltd., UK, spectrofluorimeter.
  • mice were divided to four groups of 3 mice per group. One group was used as control. Following a single dose of 10 H phage particles (fd phage, taken from a 15-mer phage peptide library which was provided by George P. Smith, University of Missouri, Columbia, MO) administered intranasally, mice were sacrificed in intervals of 1, 14 and 28 days in each group and their brains were taken for further analysis.
  • H phage particles fd phage, taken from a 15-mer phage peptide library which was provided by George P. Smith, University of Missouri, Columbia, MO
  • ScFv-508F fusion to filamentous minor coat gpIII were used in order to investigate the ability of ⁇ AP anti-aggregating scFv to be carries by a fillamentous phage display system directly into the CNS.
  • mice This scFv was prepared from anti-aggregation hybridoma 508 as described above and preserved its specific binding activity.
  • mice Nine Balb/c mice divided into three groups were treated as follows: Mice of a first group were treated with 0.2 ml of 10 ⁇ 3 M biotin ⁇ A(l-16) alone. Mice of a second group were treated with a mix of 10 ⁇ 0 phage carrying 508F-scFv which were pre incubated with 0.2 ml of 10 ⁇ 3 M biotin ⁇ A(l-16) for 1 hr. Mice of a third group were used as control. Following a single dose applied intranasally, mice were sacrificed in each group in intervals of 1, 14 and 28 days and their brains were taken for further analysis.
  • brains were removed and cut into two halves along the mid-sagittal sinus. Randomly, one half-brain was fixed by immersion in 4 % paraformaldehyde solution in 0.1 M phosphate buffer for two hours in 4 °C and then immersed for cold protection in 4.5 % sucrose in 0.1 M PBS over night. The sections were then moved to 30 % sucrose for 2 hr in 4 °C. Sections of coronal blocks containing the olfactory and hippocampus were put in OCT and cut with thick-nesses of 6 ⁇ m with a cryostat at - 20 °C, and then taken up on glass slides. Slides were kept at -
  • the other mid-sagittal half-brain was used for preparing paraffin tissue section for histology.
  • the section were fixed in 4 % paraformaldehyde for 2 hr, then transferred to 10 % formalin saline for 2 days in room temperature, followed by embedding in paraffin, and cut with thick-nesses of 4 ⁇ m on a microtom and then taken up on glass slides. The slides were kept at room temperature until used. Detection of antigen in brain sections:
  • Immunizations were performed with a genetically engineered fd phage carrying the peptide YYEFRH (SEQ ID NO:7) fused to its minor coat gpIII. Doses of 1010 phages per injection were used to immunize at
  • mice 14-day intervals, through intraperitoneal injections. Mice were injected the phages with or without Freund's complete adjuvant (Difco) for the first injection and Freund's incomplete adjuvant (Difco) for the second injection. Following 7 days of each injections, the mice were bled and their semm were tested by ELISA for antibody IgG reactivity for both phage coat proteins and for ⁇ A.
  • Freund's complete adjuvant Difco
  • Freund's incomplete adjuvant Difco
  • the 15-mer phage-peptide library used in this study was provided by George P. Smith (University of Missouri, Columbia, MO).
  • the library o consists of about 1.9 x 10 phage particles and comprises a random peptide repertoire of 15 amino acid residues fused to coat glycoprotein VIII of the fd phage. Experiments with this library were carried out according to instmctions of the provider (George P. Smith University of Missouri, Columbia, MO).
  • Biotinylation of antibodies 100 ⁇ g of each antibody in 0.1 M 5 NaHC03, pH 8.6, was incubated for 2 hr at room temperature with 5 ⁇ g of biotinamidocoproate N-hydroxysuccinimide ester (Sigma, B 2643) from a stock solution of 1 mg/ml in dimethylformamide and dialyzed at 4 °C against phosphate-buffered saline (PBS; 0.14M NaCl/0.01 M phosphate buffer, pH 7.4) overnight.
  • PBS phosphate-buffered saline
  • a library sample containing 10 ⁇ infectious phage particles was subjected to three rounds of selection (biopanning) and amplification. For each selection cycle a biotinylated monoclonal antibody (1 ⁇ g/ ⁇ l) in a total volume of 25 ⁇ l was used. The phage clones were pre incubated with the biotinylated
  • Binding of antibodies to phage was analyzed by ELISA.
  • Wells of microtiter plates (Maxisorb, Nunc) were coated with 50 ⁇ l (at dilution of 1 : 1000 in 0.1 M NaHC ⁇ 3, pH 8.6) of rabbit anti-phage serum and incubated overnight at 4 °C. The wells were blocked with a mixture of 3
  • Coat glycoprotein VIII of filamentous phage is presented in approximately 2700 copies on the phage coat.
  • the following oligonucleotides were prepared: sense - 5'-agctccGATGCTGAATTCGG TGATAGCGGCTACGAAGTGCATCATCAGAAAcctgcag-3' (SEQ ID NO: 13); and antisense - 5'-ggTTTCTGATGATGCACTTCGTAGC CGCTATCATGACGAAATTCAGCATCgg-3' (SEQ ID NO: 14).
  • duplex (68-70 ° C, 10 minutes, followed by slow cool to room temperature) which encodes for amino acids 1-16 of human ⁇ AP and contain a silent mutation of a specific restriction site (EcoRI) which is useful for further analysis.
  • the duplex was phosphorylated and lygated into Htndlll/Pstl linearized f88-4 phagemid, which is a vector used to display fusion peptides on gpVIII of filamentous phage.
  • the resulting ligated phagemid DNA was introduce into E.
  • coli K91K cells by transformation and transformants were plated onto 2 x YT Agar plates containing 10 ⁇ g/ml tetracycline and 1 % glucose for overnight growth at 37 °C. Individual bacterial colonies containing phage particles were used to inoculate 2YT medium containing 10 ⁇ g/ml tetracycline for overnight growth at 37 °C for amplification. The DNA phagemid product obtained from each colony was analyzed by ⁇ coRI. Positive clones were further amplified for antigen preparation.
  • Immunization with f88-EFRH Immunizations were performed with a genetically engineered fd phage carrying the peptide VH ⁇ PH ⁇ FRHVALNPV (S ⁇ Q ID NO: 8) fused to its major coat glycoprotein VIII. Doses of l ⁇ lO phages per injection were used to immunize at 14-day intervals, through intraperitoneal injections. Mice were injected the phages with or without Freund's complete adjuvant (Difco) for the first injection and Freund's incomplete adjuvant (Difco) for the second injection. Following 7 days of each injections, the mice were bled and their semm were tested by ELISA for antibody IgG reactivity for both phage coat proteins and for ⁇ A.
  • Difco Freund's complete adjuvant
  • Difco Freund's incomplete adjuvant
  • Rat phenochromocytoma PC 12 cells were cultured in DMEM supplemented with 5 % horse serum, 10 % fetal calf semm, 2 mM L- glutamine, and 100 units/ml penicillin/streptomycin and incubated at 37 °C under 5 % CO2.
  • cultured PC 12 cells were seeded into a 96- well plate at a density of 10 ⁇ cells/ 100 ⁇ l/well in a serum- free medium supplemented with 2 M of insulin.
  • the effect on the prevention of the neurotoxicity of ⁇ A was measured as follows: 0.12 mM ⁇ - amyloid that was incubated for a week at 37 °C for the generation of fibrils, and further incubated in the presence of serum of EFRH-phage immunized mice and serum of a non-relevant phage immunized mice at dilutions of 5: 1 and 10: 1 for 24 hr.
  • the ⁇ A antibody mixture was added to the wells containing PC 12 cells.
  • the plates were incubated at 37 °C for 2 days, after which cell viability was assessed by measuring cellular redox activity with 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide (MTT), as described (Sladowski, D. et al, J. Immunol. Methods., 157:203-207,1993).
  • MTT 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide
  • mice immunized with synthetic peptide corresponding to the sequence of human PrP 106-126 (SEQ ID NO:25)(obtained from Chiron Technologies, Claton Victoria, Australia) coupled to the larger carrier KLH were used for generating monoclonal antibodies following the fusion techniques of Kohler and Milstein (Kohler and Milstein 1975). Hybridomas were tested for the production of peptide-specific antibodies by ELISA, as follows: Peptide PrP 106-126 was covalently attached to the epoxy groups of Eupergit-C coated 96 well plates (Solomon et al. 1992, 1993). The residual epoxy groups were blocked by incubating the plates with 3% skim milk (blocking solution).
  • the antibodies 3-1 1 (IgM) and 2-40 (IgG) were biotinylated.
  • the following libraries (provided by G.P. Smith) were searched to find the epitope of the antibodies studied, as previously described (Frenkel et al. 1998).
  • PrP 106-126 aggregation and immunocomplexation In vitro aggregation of peptide 106-126 was induced by incubation of an aqueous solution of PrP 106-126 (10 mg/ml) for various time intervals at 37°C. The aggregated peptide was incubated either with monoclonal antibodies 2-40, 3-11 or 3F4 at conditions specified later.
  • the cell viability was assessed by the MTT assay which measures the activity of mitochondrial enzymes responsible for the conversion of the tetrazolium salt, 3-(4,5- dimethylthiazol-2-yl)-2,5-diphenyl-tetrazolium bromide (MTT) to a formazan product in viable cells (Hansen et al. 1989).
  • MTT was added to the wells to a final concentration of 1 mg/ml and incubated with the cells for an additional 3 hours at 37°C.
  • Cell lysis buffer (20% wt/vol SDS in a solution of 50%) dimethyl formamide, pH 4.7) was added, and the plate was incubated overnight at 37°C.
  • MTT reduction was determined colorimetrically by measuring the optical density (OD) at 550 nm.
  • PrP 106-126 (10 mg/ml) was incubated for 7 days at 37°C to induce maximal aggregation of the peptide.
  • Monoclonal antibodies 3-1 1, 2-40 and 3F4 were added for 1 hour to samples of lrnM of the already aggregated peptide.
  • the antibody-peptide mixtures, as well as the aggregated peptide alone, were applied to the cells to a peptide final concentration of 100 ⁇ M.
  • ThT Thioflavin T
  • the aggregation of the prion peptide was followed using samples of PrP 106-126 (0.3 mg/ml) in 0.1 M Tris/HCl pH-7.1 incubated for 7 days at 37°C, either with or without mAbs 3-11, 2-40 and 3F4 at various dilutions. Disaggregation of already formed prion amyloid fibrils was measured using samples of PrP 106-126 that were incubated for 7 days at 37°C and then supplemented with the mAbs for an additional 24 hours. Fluorescence (emission at 482 nm after excitation at 435 nm) was measured after an addition of the samples to ThT (2 ⁇ M in 50mM glycine, pH-9). EXPERIMENTAL RESUL TS
  • Examples 1-6 below relate to the production of a single chain version of the anti aggregating monoclonal antibody.
  • Examples 7-8 relate to delivery of peptide or antibody displaying phage to the brain.
  • Examples 9- 14 relate to the production of high titers of anti-aggregating polyclonal antibodies by direct immunization with beta amyloid antigens displayed on a phage, and to characterization of these antibodies.
  • EXAMPLE 1 Generation of an IgM hybridoma 508
  • MAb 508 showed specific recognition of ⁇ -amyloid and prevented its toxic affects on PC12 cells (Anavi S., 1998, ibid).
  • RNA was extracted from 10 ⁇ 508 hybridoma cells and was used as a source for antibody variable region coding sequences.
  • RT-PCR was used to amplify the variable domains that were cloned into the phage display vector pCC-Gal6(Fv), as described in Materials and Methods.
  • hybridoma derived antibodies are cloned as scFvs, some of the clones may contain aberrant sequences that are not functional.
  • FIG. 2 shows a physical map of plasmid pCC-508 which was used to express the 508-scFv.
  • the CBD domain serves as an immunological detection of soluble scFv protein or as a novel approach in refolding of soluble scFv protein inclusion bodies of overexpressed protein (Berdichevsky Y et al, Protein Expr Purif, 17(2):249-59, 1999).
  • the plasmid used for 508-scFv over expression is shown in Figure 3.
  • Figure 6 summarizes the production process of 508(Fv)-CBD by the cellulose-assisted refolding method (Berdichevsky Y et al, Protein Expr Purif, 17(2):249-59, 1999).
  • 508(Fv)-CBD could be purified to near homogeneity (Figure 6 lane 7) by this method, it refolded relatively poorly and was unstable upon storage at 4 °C ( Figure 7). It was assumed that substitution of the cysteine with a different residue may increase the production yield and stability of the soluble scFv without having an adverse affect on its affinity (Ki ⁇ riyanov, M.S. et al, Protein Engineering, 10:445- 453, 1997).
  • the lower 750 and 500 bp fragments represent the 508Mut-(FV)-CBD DNA, while an intact 1250 bp fragment represent scFv-CBD from the pCC-Gal6(Fv) DNA which was used as a vector. It was found that before affinity selection the library was heavily contaminated with the pCC-Gal(Fv) vector DNA. This is evident from the fact that the DNA of 18/19 randomly picked library clones was not cleaved at the Pvul site engineered adjacent to 508 VL position 96. Only one of the 19 analyzed clones showed the expected restriction pattern associated with a mutation ( Figure 8a). However, after affinity selection, 5/11 randomly selected clones showed the expected restriction pattern ( Figure 8b).
  • the 508-scFv mutant that carries the C96F mutation (508F(Fv)) was chosen, which show the higher affinity and shelf stability ( Figures 9a-b).
  • the specificity of ⁇ AP(l- 16) binding by 508F(Fv) was tested in a competitive ELISA.
  • binding of the purified 508F(Fv)-CBD to ⁇ AP was inhibited by soluble ⁇ AP(l-16) peptide serving as the competitor in the liquid phase in a dose-dependent manner. Inhibition of 50 % binding was obtained at about 1 ⁇ M competitor. Binding was not affected by an irrelevant peptide (WVLD, SEQ ID NO:4).
  • ThT reagent that binds specifically to fibrillar stmctures (Levine, H. Ill, Protein Sci., 2: 404-410,1993) was used.
  • the interference with the already formed ⁇ A fibril was measured at the same molar ratio of ⁇ AP :scFv as in the ⁇ A neurotoxic assay and was quantitated by ThT fluorimetry.
  • Figure 13 shows that 508F(Fv) incubated with preformed ⁇ A fibrils disrupted the fibril stmcture indicating extensive deterioration of fibril mo ⁇ hology, as is evidenced by a substantial (62 %) decrease in ThT fluorescence.
  • EXAMPLE 7 Ability of filamentous phage to enter the CNS via olfactory track
  • Female Balb/c mice were treated with phage vector f88-EFRH via intranasal administration. The propose of this experiment was to check the ability of filamentous phage to reach the hippocampous region via olfactory tract. Since the phage is not carrying any specific molecule for targeting neuron cells, it should be vanished without causing any harm after several day following the administration.
  • a filamentous phage displaying 508F was incubated with 10 ⁇ 3 M biotinlated ⁇ AP(l-16), in order to form antibody antigen immunocomplex.
  • Balb/c mice were divided into two groups and were administrated intranasally with two different antigens: 508F- ⁇ AP(l-16) immunocomplex and for comparison biotinlated ⁇ AP(l-16) alone. Following a single dose the mice were sacrificed and brain sections thereof prepared and reacted with streptavidin coupled to a fluorescent agent.
  • the phage act as an inert vehicle of antibody to the brain, carrying the ⁇ AP(l-16) molecule into the brain.
  • EXAMPLE 9 Raising anti-aggregating ⁇ AP antibody through immunization of mice with ⁇ -EFRH phage
  • the anti-aggregating epitope within ⁇ AP map to positions 3-6 of the amino acid sequence of ⁇ AP.
  • mice were immunized with genetically engineered fd phage carrying the peptide YYEFRH (SEQ ID NO: 7) fused to its minor coat gpIII according to the immunization schedule shown in Figure 19. Doses of 10 ⁇ phage particles per injection were used to immunize, at 14-day intervals, through intraperitoneal injection.
  • mice were bled and their sera tested by ELISA for IgG antibody reactivity against wild type phage (not bearing the peptide YYEFRH on its surface) and against ⁇ AP ( Figures 20a-b).
  • This route of administration a very high response against ⁇ AP (1 :750) following the third injection.
  • injection through phage carrying epitope is long lasting ( Figure 21), it is non-toxic and may be given without adjuvant.
  • the phage vector is found to be an immunogenic tool to raise a high affinity immune response within 14 days from the first injection.
  • the immune response against the peptide YYEFRH (SEQ ID NO:7) is low, compared to the immune response against the entire phage and could be explained by the low copy number of the fusion gpIII on the phage envelope. Therefore, for further analysis phages displaying the epitope through glycoprotein VIII were employed.
  • a phage-epitope library was screened with biotinylated antibody. After three cycles of panning and phage amplification, 90 individually isolated bacterial colonies were grown in microtiter plates and their phages were assayed for antibody binding. ELISA analysis revealed that of the phage-clones which were selected followed by three biopanning cycles, most (above 80%) bound specifically to anti-aggregating mAb, respectively. DNA from 6 positive clones was sequenced (Table 2).
  • EFRH SEQ ID NO: l
  • EPRH SEQ ID NO: l
  • the inserted peptide bears the sequence of the three residues FRH (acids 2-4 of SEQ ID NO:l), lacking the glutamate residue.
  • Binding of anti-aggregating mAb to the EFRH-bearing phage was concentration dependent; half-maximal binding was obtained at an antibody concentration of 100 ng/ml, corresponding to 10 ⁇ 9 M ( Figure 4) which resembles the level of binding of these antibodies to the whole peptide.
  • One specific f88-EFRH phage (termed C3-II, table 2) showed higher level of avidity as is compared to the others ( Figure 22). It may be due to higher level of EFRH epitope exposure on its surface.
  • mice were immunized with genetically engineered fd phage carrying the peptide VHEPHEFRHVALNPV (SEQ ID NO: 8) fused to its major coat gpVIII.
  • This phage was selected from a 15-mer phage peptide library by an anti aggregating ⁇ P antibody and is presenting the mAb epitope
  • mice (underlined) within ⁇ AP. This phage was used to immunize mice as described. Following 7 days of each injection with 10 ⁇ phage particles (without adjuvant) the mice were bled and their sera tested by ELISA for
  • Figure 25 shows inhibition of mice serum antibody with synthesized peptides derived from ⁇ AP, each of which includes the sequence EFRH) such as: DAEFRH
  • DAEFRHDSG (positions 1-9, SEQ ID NO:3), and ⁇ AP itself, DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG GW
  • Figure 25 shows that all of the synthetic peptides which bear the motive EFRH (SEQ ID NO:l) similarly inhibited binding of mouse serum antibody to the ⁇ AP with IC50 values of about 5xl0 _ 6 M.
  • ThT reagent that binds specifically to fibrillar stmctures
  • FIG. 27 shows that mouse serum, at dilution of 1 :5 and 1 :20, dismpted the fibril stmcture of ⁇ A with extensive deterioration of fibril mo ⁇ hology, as indicated by a substantial 75 % (1 :5 dilution) and 50 % (1 :20 dilution) decrease in ThT fluorescence.
  • the unrelated semm used as control did not significantly inhibit fibril formation as is compared to the immunized serum. This result strongly emphasizes the ability of the EFRH epitope displayed by a filamentous phage vector to evoke an immune response resulting in anti-agreggation antibody.
  • EXAMPLE 15 The teachings of the present invention can also be applied to prion related diseases which are also characterized by plaque formation.
  • PrP sequences that play a role in the amyloid formation A fragment of PrP consisting of amino acids 106-126 was demonstrated to be toxic to rat hippocampal neurons (Forloni et al. 1993), to mouse cortical and cerebellar cells (Brown et al., 1994; 1997), and to be particularly highly fibrillogenic
  • the inventors of the present invention have generated mAbs specific to epitopes formed by amino acids 106-126 of the PrP protein. Such antibodies are usefull in studying plaque formation and mo ⁇ hology and as possible active agents for treating or preventing prion generated plaque diseases.
  • Phage display libraries displaying various peptide fragments of the human PrP 106-126 polypeptide were generated as described hereinabove in the method section. Clones reactive to mAbs 3-11 or mAb 2-40 (for each library) were not detected following 6 cycles of library biopanning (368 clones screened) raising the possibility that epitopes that are recognized by these antibodies are of a conformational nature.
  • EXAMPLE 17 Competitive inhibition of antibodies bound to PrP by peptide NMKH
  • the above described anti-PrP 106-126 antibodies were preincubated with a peptide of an amino acid sequence NMKH (SEQ ID NO:26) at equimolar ratio before reacting with the PrP 106-126 polypeptide in order to determine the ability of NMKH to compete with the human PrP 106-126 for antibody binding.
  • SEQ ID NO:26 amino acid sequence NMKH
  • this sequence is highly conserved between mice and human sequences (and others) with the exception of two different amino acids, M109 instead of L and M 112 instead of V.
  • PrP 106-126 is toxic to PC 12 cells in a dose dependant manner, which toxicity is related to the conformational state of the peptide and to the exposure time of the cells to aggregated peptide. Cell viability considerably decreased (as detected by
  • 106-126 fibrillar aggregation and disaggregate the aggregated form of this peptide A significant decrease in amyloid fibril formation (about 80% prevention) was observed when PrP 106-126 was incubated at 37 °C in the presence of mAbs 3-11 and 2-40. When these antibodies were added to already formed aggregates of PrP 106-126, more than 50% of the fibrils were disaggregated. In contrast, mAb 3F4 had lower efficacy both in inhibiting amyloid fibril formation and in inducing their disaggregation
  • Em ission 482 «w (Pr P ⁇ 0 ⁇ - 126 incubated with A b) Struktur, n n
  • Em ission 482 «w (Pr 106 - 126 incubated alone)
  • N-terminal EFRH sequence of Alzheimer's ⁇ -amyloid peptide represents the epitope of its anti- aggregating antibodies. J. Neuroimmunology 88, 85-90.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biomedical Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Neurology (AREA)
  • Biochemistry (AREA)
  • Toxicology (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Neurosurgery (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Rheumatology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Diabetes (AREA)
  • Microbiology (AREA)
  • Urology & Nephrology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Pathology (AREA)
  • Endocrinology (AREA)
  • Mycology (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Orthopedic Medicine & Surgery (AREA)
PCT/IL2000/000518 1999-09-03 2000-08-31 Agents and compositions and methods for diagnostic and/or treating or preventing plaque forming diseases Ceased WO2001018169A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
CA002349434A CA2349434A1 (en) 1999-09-03 2000-08-31 Agents and compositions and methods utilizing same useful in diagnosing and/or treating or preventing plaque forming diseases
AT00954883T ATE461996T1 (de) 1999-09-03 2000-08-31 Verbindungen, zusammensetzungen und verfahren zur behandlung oder vorsorge von alzheimer erkrankung
JP2001522381A JP2003509020A (ja) 1999-09-03 2000-08-31 プラーク形成疾患の診断、治療、予防に有用な薬剤、組成物、その使用法
US09/830,954 US6919075B1 (en) 1999-09-03 2000-08-31 Bacteriophage displaying aβ epitopes and method of use
AU67232/00A AU784568B2 (en) 1999-09-03 2000-08-31 Agents and compositions and methods utilizing same useful in diagnosing and/or treating or preventing plaque forming diseases
EP00954883A EP1180938B1 (en) 1999-09-03 2000-08-31 Agents, compositions and methods utilizing the same useful in treating or preventing alzheimer disease
IL14294800A IL142948A0 (en) 1999-09-03 2000-08-31 Agents and compositions and methods utilizing same useful in diagnosing and/or treating or preventing plaque forming diseases
DE60044057T DE60044057D1 (de) 1999-09-03 2000-08-31 Verbindungen, zusammensetzungen und verfahren zur behandlung oder vorsorge von alzheimer erkrankung
HK02106123.5A HK1044564B (en) 1999-09-03 2000-08-31 Agents, compositions and methods utilizing the same useful in treating or preventing alzheimer disease
IL142948A IL142948A (en) 1999-09-03 2001-05-03 Agents and compositions and methods utilizing same useful in diagnosing and/or treating or preventing plaque forming diseases
US11/073,526 US20050152878A1 (en) 1999-09-03 2005-03-08 Agents and compositions and methods utilizing same useful in diagnosing and/or treating or preventing plaque forming diseases

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US15241799P 1999-09-03 1999-09-03
US60/152,417 1999-09-03
US09/473,653 US6703015B1 (en) 1999-09-03 1999-12-29 Filamentous bacteriophage displaying an β-amyloid epitope
US09/473,653 1999-12-29
US62997100A 2000-07-31 2000-07-31
US09/629,971 2000-07-31

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
US09/473,653 Continuation-In-Part US6703015B1 (en) 1997-10-17 1999-12-29 Filamentous bacteriophage displaying an β-amyloid epitope
US62997100A Continuation 1997-10-17 2000-07-31

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US09/830,954 A-371-Of-International US6919075B1 (en) 1999-09-03 2000-08-31 Bacteriophage displaying aβ epitopes and method of use
US10/384,788 Continuation-In-Part US20040013647A1 (en) 1999-09-03 2003-03-11 Methods and compositions for treating a plaque-forming disease
US11/073,526 Continuation US20050152878A1 (en) 1999-09-03 2005-03-08 Agents and compositions and methods utilizing same useful in diagnosing and/or treating or preventing plaque forming diseases

Publications (2)

Publication Number Publication Date
WO2001018169A2 true WO2001018169A2 (en) 2001-03-15
WO2001018169A3 WO2001018169A3 (en) 2001-11-22

Family

ID=27387248

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IL2000/000518 Ceased WO2001018169A2 (en) 1999-09-03 2000-08-31 Agents and compositions and methods for diagnostic and/or treating or preventing plaque forming diseases

Country Status (11)

Country Link
US (4) US6919075B1 (https=)
EP (1) EP1180938B1 (https=)
JP (1) JP2003509020A (https=)
AT (1) ATE461996T1 (https=)
AU (1) AU784568B2 (https=)
CA (1) CA2349434A1 (https=)
DE (1) DE60044057D1 (https=)
ES (1) ES2344189T3 (https=)
HK (1) HK1044564B (https=)
IL (1) IL142948A0 (https=)
WO (1) WO2001018169A2 (https=)

Cited By (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2368794B (en) * 1999-05-28 2004-10-20 Neuralab Ltd Prevention and treatment of amyloidogenic disease
WO2002096350A3 (en) * 2001-05-25 2004-11-11 United Biomedical Inc Immunogenic peptide composition for the prevention and treatment of alzheimer's disease
JP2005539025A (ja) * 2002-07-19 2005-12-22 サイトス・バイオテクノロジー・アクチェンゲゼルシャフト アミロイドベータ1−6抗原アレイを含むワクチン組成物
WO2006047670A3 (en) * 2004-10-26 2006-07-13 Wyeth Corp Methods for assessing antibodies to neurodegenerative disease-associated antigens
WO2006005707A3 (en) * 2004-07-13 2006-08-17 Affiris Forschungs & Entwicklungs Gmbh Method for preventing and treating alzheimer´s disease
US7195761B2 (en) 2000-02-24 2007-03-27 Eli Lilly And Company Humanized antibodies that sequester abeta peptide
WO2007068412A3 (en) * 2005-12-12 2007-08-09 Ac Immune Sa A beta 1-42 specific monoclonal antibodies with therapeutic properties
US7318923B2 (en) 2001-04-30 2008-01-15 Eli Lilly And Company Humanized anti-βantibodies
US7320790B2 (en) 2001-04-30 2008-01-22 Eli Lilly And Company Humanized antibodies
US7320793B2 (en) 2001-01-19 2008-01-22 Cytos Biotechnology Ag Molecular antigen array
EP1792911A4 (en) * 2004-09-15 2008-09-17 Univ Yokohama City ESSENTIAL AMINO ACID SEQUENCE FOR NEUROSPECIFIC GENE EXPRESSION
US7494655B2 (en) 2002-03-05 2009-02-24 Ramot At Tel-Aviv University Ltd. Immunizing composition and method for inducing an immune response against the β-secretase cleavage site of amyloid precursor protein
EP1379282A4 (en) * 2001-03-15 2009-06-03 Univ Ramot METHOD AND COMPOSITIONS FOR THE TREATMENT AND / OR DIAGNOSIS OF NEUROLOGICAL DISORDERS AND DISEASES
US7575747B2 (en) 2003-02-10 2009-08-18 Applied Molecular Evolution Aβ binding molecules
US7771722B2 (en) 2001-08-17 2010-08-10 Eli Lilly And Company Assay method for alzheimer's disease
US7867499B2 (en) 2004-11-05 2011-01-11 Novartis Ag Methods of treating dementia by administering virus-like particles coupled to Aβ
US8066999B2 (en) 2007-01-18 2011-11-29 Eli Lilly And Company PEGylated Aβ fab
US8409580B2 (en) 2003-07-25 2013-04-02 Ac Immune Sa Therapeutic vaccine targeted against P-glycoprotein 170 for inhibiting multidrug resistance in the treatment of cancers
CN1826354B (zh) * 2003-01-14 2014-01-08 阿法尔斯研发有限责任公司 预防和治疗阿尔茨海默病(ad)的方法
US8663650B2 (en) 2003-02-21 2014-03-04 Ac Immune Sa Methods and compositions comprising supramolecular constructs
US8906367B2 (en) 2007-01-05 2014-12-09 University Of Zurich Method of providing disease-specific binding molecules and targets
US9062101B2 (en) 2010-08-14 2015-06-23 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US9102752B2 (en) 2013-03-15 2015-08-11 United Biomedical, Inc. Peptide vaccine for prevention and immunotherapy of dementia of the Alzheimer's type
US9175094B2 (en) 2007-06-12 2015-11-03 Ac Immune S.A. Monoclonal antibody
US9289488B2 (en) 2010-08-12 2016-03-22 Ac Immune Sa Vaccine engineering
US9644025B2 (en) 2007-10-17 2017-05-09 Wyeth Llc Immunotherapy regimes dependent on ApoE status
US9670272B2 (en) 2007-01-05 2017-06-06 University Of Zurich Method of providing disease-specific binding molecules and targets
US9687447B2 (en) 2010-10-26 2017-06-27 Ac Immune S.A. Method for preparing liposome-based constructs
US9822171B2 (en) 2010-04-15 2017-11-21 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US9896504B2 (en) 2008-12-19 2018-02-20 Biogen International Neuroscience Gmbh Human anti-alpha-synuclein antibodies
US9951125B2 (en) 2006-11-30 2018-04-24 Abbvie Inc. Aβ conformer selective anti-Aβ globulomer monoclonal antibodies
US9968682B2 (en) 2013-04-25 2018-05-15 Spiber Inc. Polypeptide hydrogel and method for producing same
US9975947B2 (en) 2011-06-23 2018-05-22 Biogen International Neuroscience Gmbh Anti-alpha synuclein binding molecules
US10065997B2 (en) 2013-04-25 2018-09-04 Spiber Inc. Polypeptide porous body and method for producing same
US10208109B2 (en) 2005-11-30 2019-02-19 Abbvie Inc. Monoclonal antibodies against amyloid beta protein and uses thereof
US10464976B2 (en) 2003-01-31 2019-11-05 AbbVie Deutschland GmbH & Co. KG Amyloid β(1-42) oligomers, derivatives thereof and antibodies thereto, methods of preparation thereof and use thereof
US10538581B2 (en) 2005-11-30 2020-01-21 Abbvie Inc. Anti-Aβ globulomer 4D10 antibodies
US10842871B2 (en) 2014-12-02 2020-11-24 Biogen International Neuroscience Gmbh Methods for treating Alzheimer's disease
US11655289B2 (en) 2017-08-22 2023-05-23 Biogen Ma Inc. Pharmaceutical compositions containing anti-beta amyloid antibodies

Families Citing this family (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080050367A1 (en) 1998-04-07 2008-02-28 Guriq Basi Humanized antibodies that recognize beta amyloid peptide
US7588766B1 (en) 2000-05-26 2009-09-15 Elan Pharma International Limited Treatment of amyloidogenic disease
US6905686B1 (en) 1997-12-02 2005-06-14 Neuralab Limited Active immunization for treatment of alzheimer's disease
TWI239847B (en) 1997-12-02 2005-09-21 Elan Pharm Inc N-terminal fragment of Abeta peptide and an adjuvant for preventing and treating amyloidogenic disease
US7179892B2 (en) 2000-12-06 2007-02-20 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
US7790856B2 (en) 1998-04-07 2010-09-07 Janssen Alzheimer Immunotherapy Humanized antibodies that recognize beta amyloid peptide
US6787523B1 (en) * 1997-12-02 2004-09-07 Neuralab Limited Prevention and treatment of amyloidogenic disease
US6913745B1 (en) 1997-12-02 2005-07-05 Neuralab Limited Passive immunization of Alzheimer's disease
US6761888B1 (en) 2000-05-26 2004-07-13 Neuralab Limited Passive immunization treatment of Alzheimer's disease
US20050059802A1 (en) * 1998-04-07 2005-03-17 Neuralab Ltd Prevention and treatment of amyloidogenic disease
JP2003516929A (ja) * 2000-06-01 2003-05-20 ニユーララブ・リミテツド アミロイド形成性疾患の予防および治療
PE20020574A1 (es) 2000-12-06 2002-07-02 Wyeth Corp Anticuerpos humanizados que reconocen el peptido amiloideo beta
US7700751B2 (en) 2000-12-06 2010-04-20 Janssen Alzheimer Immunotherapy Humanized antibodies that recognize β-amyloid peptide
MY139983A (en) 2002-03-12 2009-11-30 Janssen Alzheimer Immunotherap Humanized antibodies that recognize beta amyloid peptide
NZ567324A (en) * 2003-02-01 2009-08-28 Wyeth Corp Active immunization to generate antibodies to soluble A-beta
TWI306458B (en) 2003-05-30 2009-02-21 Elan Pharma Int Ltd Humanized antibodies that recognize beta amyloid peptide
US20050225165A1 (en) * 2004-04-13 2005-10-13 Naik Sanjeev M Brake by-wire control system
CN101039691B (zh) * 2004-06-25 2013-07-31 魁北克益得生物医学公司 用于治疗神经疾病的组合物和方法
CA2576405A1 (en) * 2004-08-11 2006-02-16 Mitsubishi Chemical Corporation Antibody and utilization of the same
EP1838348B1 (en) 2004-12-15 2013-06-26 Janssen Alzheimer Immunotherapy Humanized amyloid beta antibodies for use in improving cognition
US7625560B2 (en) 2004-12-15 2009-12-01 Janssen Alzheimer Immunotherapy Humanized antibodies that recognize beta amyloid peptide
DK1853285T3 (da) * 2005-02-01 2011-06-27 Univ Ramot Fremgangsmåde til behandling af inflammation forbundet med amyloidaflejringer og hjerneinflammation som involverer aktiverede mikroglia
US20090304726A1 (en) * 2006-02-15 2009-12-10 Ramot At Tel Aviv University Ltd. Viral display vehicles for treating multiple sclerosis
US8784810B2 (en) 2006-04-18 2014-07-22 Janssen Alzheimer Immunotherapy Treatment of amyloidogenic diseases
EP2046833B9 (en) 2006-07-14 2014-02-19 AC Immune S.A. Humanized antibody against amyloid beta
AU2007275258A1 (en) * 2006-07-21 2008-01-24 Ramot At Tel Aviv University Ltd. Use of a phage displaying a peptide from an adhesion protein for treating a disease associated with intracellular formation of protein fibrillar inclusions or aggregates
CA2667466A1 (en) * 2006-10-27 2008-05-02 Ablynx N.V. Intranasal delivery of polypeptides and proteins
US8895004B2 (en) 2007-02-27 2014-11-25 AbbVie Deutschland GmbH & Co. KG Method for the treatment of amyloidoses
US8003097B2 (en) 2007-04-18 2011-08-23 Janssen Alzheimer Immunotherapy Treatment of cerebral amyloid angiopathy
US8048420B2 (en) 2007-06-12 2011-11-01 Ac Immune S.A. Monoclonal antibody
DK2182983T3 (da) 2007-07-27 2014-07-14 Janssen Alzheimer Immunotherap Behandling af amyloidogene sygdomme med humaniserede anti-abeta antistoffer
AU2008311367B2 (en) 2007-10-05 2014-11-13 Ac Immune S.A. Use of anti-amyloid beta antibody in ocular diseases
EP2207568B1 (en) * 2007-11-16 2017-05-31 The Rockefeller University Antibodies specific for the protofibril form of beta-amyloid protein
ITNA20080006A1 (it) * 2008-01-28 2009-07-29 Consiglio Nazionale Ricerche Proteine chimeriche capaci di formare particelle virus-like, che contengono sequenze peptidiche del beta-amiloide e la componente e2 della alfachetoacido deidrogenasi di "geobacillus stearothermophilus", utili per l'induzione di una risposta anticorp
EP2321348A2 (en) * 2008-07-09 2011-05-18 University of Zürich Method of promoting neurogenesis
US9067981B1 (en) 2008-10-30 2015-06-30 Janssen Sciences Ireland Uc Hybrid amyloid-beta antibodies
NZ592928A (en) * 2008-11-24 2012-12-21 Univ Ramot Method for treating parkinson' s disease using filamentous bacteriophage
US20130122033A1 (en) * 2010-07-02 2013-05-16 Rita De Santis Fimh vaccine against urinary tract infections (uti)
EP2598882B1 (en) 2010-07-30 2017-07-26 AC Immune S.A. Safe and functional humanized antibodies for use in treating an amyloidosis
US8877446B2 (en) * 2011-08-26 2014-11-04 Korea Research Institute Of Bioscience And Biotechnology Method for detecting protein-protein interactions in cells
JP2012102131A (ja) * 2012-01-05 2012-05-31 Elan Pharma Internatl Ltd アミロイド形成性疾患の予防および治療
CN104918950B (zh) * 2012-12-27 2018-10-12 丝芭博株式会社 亲水性重组蛋白的部分精制方法
EP2940032B1 (en) * 2012-12-27 2018-04-25 Spiber Inc. Extraction method for hydrophilic recombinant protein
WO2014150870A2 (en) 2013-03-15 2014-09-25 Altria Client Services Inc. Bacteriophage and methods of making and using
US9781929B2 (en) 2015-01-29 2017-10-10 Altria Client Services Llc Bacteriophage and methods of using
US10357056B2 (en) 2015-01-29 2019-07-23 Altria Client Services Llc Endolysin from bacteriophage against Geobacillus and methods of using
CN111201030B (zh) 2017-07-25 2024-11-01 真和制药有限公司 通过阻断tim-3和其配体的相互作用治疗癌症
WO2020160156A2 (en) 2019-01-30 2020-08-06 Immutics, Inc. Anti-gal3 antibodies and uses thereof
EP4157338A4 (en) 2020-05-26 2024-11-13 TrueBinding, Inc. METHOD FOR TREATING INFLAMMATORY DISEASES BY GALECTIN-3 BLOCKING

Family Cites Families (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9022190D0 (en) 1990-10-12 1990-11-28 Perham Richard N Immunogenic material
US5811093A (en) 1994-04-05 1998-09-22 Exponential Biotherapies, Inc. Bacteriophage genotypically modified to delay inactivations by the host defense system
US5688651A (en) * 1994-12-16 1997-11-18 Ramot University Authority For Applied Research And Development Ltd. Prevention of protein aggregation
US5622699A (en) * 1995-09-11 1997-04-22 La Jolla Cancer Research Foundation Method of identifying molecules that home to a selected organ in vivo
BR9610580A (pt) * 1995-09-14 2000-10-24 Univ California Anticorpos especìficos para prpse nativos
GB9626675D0 (en) * 1996-12-23 1997-02-12 Procter & Gamble Hair coloring compositions
US6703015B1 (en) * 1999-09-03 2004-03-09 Ramot At Tel-Aviv University Ltd. Filamentous bacteriophage displaying an β-amyloid epitope
US6905686B1 (en) * 1997-12-02 2005-06-14 Neuralab Limited Active immunization for treatment of alzheimer's disease
TWI239847B (en) * 1997-12-02 2005-09-21 Elan Pharm Inc N-terminal fragment of Abeta peptide and an adjuvant for preventing and treating amyloidogenic disease
US7964192B1 (en) * 1997-12-02 2011-06-21 Janssen Alzheimer Immunotherapy Prevention and treatment of amyloidgenic disease
US6211149B1 (en) * 1998-08-03 2001-04-03 The United States Of America As Represented By The Department Of Health And Human Services Inhibitors of formation of protease resistant prion protein
US20020140675A1 (en) * 1999-01-25 2002-10-03 Ali Ammar Al System and method for altering a display mode based on a gravity-responsive sensor
EP1209969A2 (en) * 1999-08-31 2002-06-05 RAMOT UNIVERSITY AUTHORITY FOR APPLIED RESEARCH & INDUSTRIAL DEVELOPMENT LTD. Peptides and substances, methods and devices using same for diagnosing and treating neurodegenerative disorders
US20040013647A1 (en) * 1999-09-03 2004-01-22 Ramot At Tel-Aviv University Ltd. Methods and compositions for treating a plaque-forming disease
US20020052311A1 (en) * 1999-09-03 2002-05-02 Beka Solomon Methods and compostions for the treatment and/or diagnosis of neurological diseases and disorders
US6597384B1 (en) * 1999-12-22 2003-07-22 Intel Corporation Automatic reorienting of screen orientation using touch sensitive system
US6621508B1 (en) * 2000-01-18 2003-09-16 Seiko Epson Corporation Information processing system
US20030148404A1 (en) * 2000-07-27 2003-08-07 Ramot University Authority For Applied Research & Industrial Development Ltd. Peptides and substances, methods and devices using same for diagnosing and treating neurodegenerative disorders

Cited By (68)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2368794B (en) * 1999-05-28 2004-10-20 Neuralab Ltd Prevention and treatment of amyloidogenic disease
US7892545B2 (en) 2000-02-24 2011-02-22 Eli Lilly And Company Humanized antibodies that sequester amyloid beta peptide
US7195761B2 (en) 2000-02-24 2007-03-27 Eli Lilly And Company Humanized antibodies that sequester abeta peptide
US8591894B2 (en) 2000-02-24 2013-11-26 Eli Lilly And Company Humanized antibodies that sequester amyloid beta peptide
US7320793B2 (en) 2001-01-19 2008-01-22 Cytos Biotechnology Ag Molecular antigen array
EP1379282A4 (en) * 2001-03-15 2009-06-03 Univ Ramot METHOD AND COMPOSITIONS FOR THE TREATMENT AND / OR DIAGNOSIS OF NEUROLOGICAL DISORDERS AND DISEASES
US7318923B2 (en) 2001-04-30 2008-01-15 Eli Lilly And Company Humanized anti-βantibodies
US7320790B2 (en) 2001-04-30 2008-01-22 Eli Lilly And Company Humanized antibodies
WO2002096350A3 (en) * 2001-05-25 2004-11-11 United Biomedical Inc Immunogenic peptide composition for the prevention and treatment of alzheimer's disease
US7951909B2 (en) 2001-05-25 2011-05-31 United Biomedical, Inc. Immunogenic peptide composition comprising a promiscuous helper T cell epitope and an N-terminal fragment of Aβ1-42 peptide
US8232373B2 (en) 2001-05-25 2012-07-31 United Biomedical, Inc. Immunogenic peptide composition for the prevention and treatment of alzheimer's disease
US8444977B2 (en) 2001-08-17 2013-05-21 Eli Lilly And Company Assay method for Alzheimer's disease
US7771722B2 (en) 2001-08-17 2010-08-10 Eli Lilly And Company Assay method for alzheimer's disease
US7494655B2 (en) 2002-03-05 2009-02-24 Ramot At Tel-Aviv University Ltd. Immunizing composition and method for inducing an immune response against the β-secretase cleavage site of amyloid precursor protein
US8613928B2 (en) 2002-03-05 2013-12-24 Ramot At Tel-Aviv University Ltd. Immunizing composition and method for inducing an immune response against the β-secretase cleavage site of amyloid precursor protein
US7854931B2 (en) 2002-03-05 2010-12-21 Ramot At Tel-Aviv University Ltd. Immunizing compostion and method for inducing an immune response against the beta-secretase cleavage site of amyloid precursor protein
EP2338510A1 (en) 2002-07-19 2011-06-29 Novartis Pharma AG Vaccine compositions containing amyloid beta1-6 antigen arrays
JP2005539025A (ja) * 2002-07-19 2005-12-22 サイトス・バイオテクノロジー・アクチェンゲゼルシャフト アミロイドベータ1−6抗原アレイを含むワクチン組成物
CN1826354B (zh) * 2003-01-14 2014-01-08 阿法尔斯研发有限责任公司 预防和治疗阿尔茨海默病(ad)的方法
US10464976B2 (en) 2003-01-31 2019-11-05 AbbVie Deutschland GmbH & Co. KG Amyloid β(1-42) oligomers, derivatives thereof and antibodies thereto, methods of preparation thereof and use thereof
US8623365B2 (en) 2003-02-10 2014-01-07 Applied Molecular Evolution, Inc. Aβ binding molecules
US7575747B2 (en) 2003-02-10 2009-08-18 Applied Molecular Evolution Aβ binding molecules
US8105597B2 (en) 2003-02-10 2012-01-31 Applied Molecular Evolution, Inc. Aβ binding molecules
US8926983B2 (en) 2003-02-21 2015-01-06 Ac Immune Sa Method for improving memory in AD patients
US8663650B2 (en) 2003-02-21 2014-03-04 Ac Immune Sa Methods and compositions comprising supramolecular constructs
US8409580B2 (en) 2003-07-25 2013-04-02 Ac Immune Sa Therapeutic vaccine targeted against P-glycoprotein 170 for inhibiting multidrug resistance in the treatment of cancers
US9975946B2 (en) 2004-02-20 2018-05-22 Ac Immune Sa Antibodies obtainable using supramolecular constructs
US8022180B2 (en) 2004-07-13 2011-09-20 Affiris Forschungs-Und Entwicklungs Gmbh Method for preventing and treating Alzheimer's disease
KR101228409B1 (ko) 2004-07-13 2013-01-31 아피리스 아게 알츠하이머 질환의 예방 및 치료 방법
AU2005261688B2 (en) * 2004-07-13 2010-11-11 Affiris Forschungs-Und Entwicklungs Gmbh Method for preventing and treating Alzheimer´s disease
WO2006005707A3 (en) * 2004-07-13 2006-08-17 Affiris Forschungs & Entwicklungs Gmbh Method for preventing and treating alzheimer´s disease
EP1792911A4 (en) * 2004-09-15 2008-09-17 Univ Yokohama City ESSENTIAL AMINO ACID SEQUENCE FOR NEUROSPECIFIC GENE EXPRESSION
WO2006047670A3 (en) * 2004-10-26 2006-07-13 Wyeth Corp Methods for assessing antibodies to neurodegenerative disease-associated antigens
US7867499B2 (en) 2004-11-05 2011-01-11 Novartis Ag Methods of treating dementia by administering virus-like particles coupled to Aβ
US8617566B2 (en) 2004-11-05 2013-12-31 Novartis Ag Composition comprising VLP and amyloid beta peptide
US8460676B2 (en) 2004-11-05 2013-06-11 Novartis Ag Composition comprising VLP and amyloid beta peptide
US10208109B2 (en) 2005-11-30 2019-02-19 Abbvie Inc. Monoclonal antibodies against amyloid beta protein and uses thereof
US10323084B2 (en) 2005-11-30 2019-06-18 Abbvie Inc. Monoclonal antibodies against amyloid beta protein and uses thereof
US10538581B2 (en) 2005-11-30 2020-01-21 Abbvie Inc. Anti-Aβ globulomer 4D10 antibodies
EP2808032A1 (en) * 2005-12-12 2014-12-03 AC Immune S.A. A beta 1-42 specific monoclonal antibodies with therapeutic properties
AU2006326284B2 (en) * 2005-12-12 2013-06-06 Ac Immune S.A. A beta 1-42 specific monoclonal antibodies with therapeutic properties
EP2361638A1 (en) * 2005-12-12 2011-08-31 AC Immune S.A. A beta 1-42 specific monoclonal antibodies with therapeutic properties
NO345996B1 (no) * 2005-12-12 2021-12-13 Ac Immune Sa A beta 1-42-spesifikke monoklonale antistoffer med terapeutiske egenskaper.
WO2007068412A3 (en) * 2005-12-12 2007-08-09 Ac Immune Sa A beta 1-42 specific monoclonal antibodies with therapeutic properties
US9951125B2 (en) 2006-11-30 2018-04-24 Abbvie Inc. Aβ conformer selective anti-Aβ globulomer monoclonal antibodies
US9828420B2 (en) 2007-01-05 2017-11-28 University Of Zürich Method of providing disease-specific binding molecules and targets
US9670272B2 (en) 2007-01-05 2017-06-06 University Of Zurich Method of providing disease-specific binding molecules and targets
US8906367B2 (en) 2007-01-05 2014-12-09 University Of Zurich Method of providing disease-specific binding molecules and targets
US10202445B2 (en) 2007-01-05 2019-02-12 University Of Zurich Method of providing disease-specific binding molecules and targets
US10131708B2 (en) 2007-01-05 2018-11-20 University Of Zürich Methods of treating Alzheimer's disease
US8066999B2 (en) 2007-01-18 2011-11-29 Eli Lilly And Company PEGylated Aβ fab
US9585956B2 (en) 2007-06-12 2017-03-07 Ac Immune S.A. Polynucleotides encoding anti-amyloid beta monoclonal antibodies
US9175094B2 (en) 2007-06-12 2015-11-03 Ac Immune S.A. Monoclonal antibody
US9644025B2 (en) 2007-10-17 2017-05-09 Wyeth Llc Immunotherapy regimes dependent on ApoE status
US9896504B2 (en) 2008-12-19 2018-02-20 Biogen International Neuroscience Gmbh Human anti-alpha-synuclein antibodies
US10703808B2 (en) 2008-12-19 2020-07-07 Biogen International Neuroscience Gmbh Human anti-alpha-synuclein antibodies
US9822171B2 (en) 2010-04-15 2017-11-21 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US9289488B2 (en) 2010-08-12 2016-03-22 Ac Immune Sa Vaccine engineering
US10047121B2 (en) 2010-08-14 2018-08-14 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US9062101B2 (en) 2010-08-14 2015-06-23 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US9687447B2 (en) 2010-10-26 2017-06-27 Ac Immune S.A. Method for preparing liposome-based constructs
US10301381B2 (en) 2011-06-23 2019-05-28 Biogen International Neuroscience Gmbh Anti-alpha synuclein binding molecules
US9975947B2 (en) 2011-06-23 2018-05-22 Biogen International Neuroscience Gmbh Anti-alpha synuclein binding molecules
US9102752B2 (en) 2013-03-15 2015-08-11 United Biomedical, Inc. Peptide vaccine for prevention and immunotherapy of dementia of the Alzheimer's type
US9968682B2 (en) 2013-04-25 2018-05-15 Spiber Inc. Polypeptide hydrogel and method for producing same
US10065997B2 (en) 2013-04-25 2018-09-04 Spiber Inc. Polypeptide porous body and method for producing same
US10842871B2 (en) 2014-12-02 2020-11-24 Biogen International Neuroscience Gmbh Methods for treating Alzheimer's disease
US11655289B2 (en) 2017-08-22 2023-05-23 Biogen Ma Inc. Pharmaceutical compositions containing anti-beta amyloid antibodies

Also Published As

Publication number Publication date
AU6723200A (en) 2001-04-10
EP1180938B1 (en) 2010-03-24
US20050152878A1 (en) 2005-07-14
HK1044564A1 (en) 2002-10-25
ES2344189T3 (es) 2010-08-20
US6919075B1 (en) 2005-07-19
EP1180938A2 (en) 2002-02-27
ATE461996T1 (de) 2010-04-15
IL142948A0 (en) 2002-04-21
CA2349434A1 (en) 2001-03-15
US20050089510A1 (en) 2005-04-28
JP2003509020A (ja) 2003-03-11
US20030077252A1 (en) 2003-04-24
EP1180938A4 (en) 2005-03-16
HK1044564B (en) 2010-05-28
DE60044057D1 (de) 2010-05-06
WO2001018169A3 (en) 2001-11-22
AU784568B2 (en) 2006-05-04

Similar Documents

Publication Publication Date Title
AU784568B2 (en) Agents and compositions and methods utilizing same useful in diagnosing and/or treating or preventing plaque forming diseases
US6703015B1 (en) Filamentous bacteriophage displaying an β-amyloid epitope
US20040013647A1 (en) Methods and compositions for treating a plaque-forming disease
US20020052311A1 (en) Methods and compostions for the treatment and/or diagnosis of neurological diseases and disorders
DK2450056T3 (en) Prevention and treatment of synucleinopathic and amyloidogenic disease
JP5211290B2 (ja) シヌクレイノパシー(synucleinopathic)およびアミロイド生成性疾患の予防および処置
US8361458B2 (en) Method and filamentous phage for treating inflammation associated with amyloid deposits and brain inflammation involving activated microglia
CN102858796A (zh) 寡聚体特异性淀粉样蛋白β表位和抗体
JP2007522119A (ja) アミロイド関連疾患用ワクチンとしてのアミロイドタンパク質のコンジュゲート
CN110759987B (zh) 构象特异性的重组Aβ1-42样寡聚体抗原、其制备方法和应用
IL142948A (en) Agents and compositions and methods utilizing same useful in diagnosing and/or treating or preventing plaque forming diseases
Gevorkian et al. Mimotopes of conformational epitopes in fibrillar β-amyloid
EP2300499B1 (en) Anti-prion protein antibody fragment
CN110684122B (zh) 重组Tau表位嵌合多聚体抗原、其制备方法和应用
Solomon Peptide Vaccine for Alzheimer's Disease
HK1110790B (en) Method for treating inflammation associated with amyloid deposits and brain inflammation involving activated microglia

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
ENP Entry into the national phase

Ref country code: JP

Ref document number: 2001 522381

Kind code of ref document: A

Format of ref document f/p: F

ENP Entry into the national phase

Ref document number: 2349434

Country of ref document: CA

Ref country code: CA

Ref document number: 2349434

Kind code of ref document: A

Format of ref document f/p: F

WWE Wipo information: entry into national phase

Ref document number: 142948

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 67232/00

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2000954883

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 09830954

Country of ref document: US

AK Designated states

Kind code of ref document: A3

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A3

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

WWP Wipo information: published in national office

Ref document number: 2000954883

Country of ref document: EP