WO1999065183A2 - Accounting in a communications network - Google Patents
Accounting in a communications network Download PDFInfo
- Publication number
- WO1999065183A2 WO1999065183A2 PCT/GB1999/001765 GB9901765W WO9965183A2 WO 1999065183 A2 WO1999065183 A2 WO 1999065183A2 GB 9901765 W GB9901765 W GB 9901765W WO 9965183 A2 WO9965183 A2 WO 9965183A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- network
- tariff
- customer
- customer terminal
- communications
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M15/00—Arrangements for metering, time-control or time indication ; Metering, charging or billing arrangements for voice wireline or wireless communications, e.g. VoIP
- H04M15/81—Dynamic pricing, e.g. change of tariff during call
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L12/00—Data switching networks
- H04L12/02—Details
- H04L12/14—Charging, metering or billing arrangements for data wireline or wireless communications
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L12/00—Data switching networks
- H04L12/02—Details
- H04L12/14—Charging, metering or billing arrangements for data wireline or wireless communications
- H04L12/1403—Architecture for metering, charging or billing
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L12/00—Data switching networks
- H04L12/02—Details
- H04L12/14—Charging, metering or billing arrangements for data wireline or wireless communications
- H04L12/141—Indication of costs
- H04L12/1414—Indication of costs in real-time
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L12/00—Data switching networks
- H04L12/02—Details
- H04L12/14—Charging, metering or billing arrangements for data wireline or wireless communications
- H04L12/1453—Methods or systems for payment or settlement of the charges for data transmission involving significant interaction with the data transmission network
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L12/00—Data switching networks
- H04L12/02—Details
- H04L12/14—Charging, metering or billing arrangements for data wireline or wireless communications
- H04L12/1485—Tariff-related aspects
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L12/00—Data switching networks
- H04L12/02—Details
- H04L12/14—Charging, metering or billing arrangements for data wireline or wireless communications
- H04L12/1485—Tariff-related aspects
- H04L12/1489—Tariff-related aspects dependent on congestion
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L43/00—Arrangements for monitoring or testing data switching networks
- H04L43/08—Monitoring or testing based on specific metrics, e.g. QoS, energy consumption or environmental parameters
- H04L43/0823—Errors, e.g. transmission errors
- H04L43/0829—Packet loss
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M15/00—Arrangements for metering, time-control or time indication ; Metering, charging or billing arrangements for voice wireline or wireless communications, e.g. VoIP
- H04M15/28—Arrangements for metering, time-control or time indication ; Metering, charging or billing arrangements for voice wireline or wireless communications, e.g. VoIP with meter at substation or with calculation of charges at terminal
- H04M15/30—Arrangements for metering, time-control or time indication ; Metering, charging or billing arrangements for voice wireline or wireless communications, e.g. VoIP with meter at substation or with calculation of charges at terminal the meter or calculation of charges not being controlled from an exchange
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M15/00—Arrangements for metering, time-control or time indication ; Metering, charging or billing arrangements for voice wireline or wireless communications, e.g. VoIP
- H04M15/70—Administration or customization aspects; Counter-checking correct charges
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M15/00—Arrangements for metering, time-control or time indication ; Metering, charging or billing arrangements for voice wireline or wireless communications, e.g. VoIP
- H04M15/70—Administration or customization aspects; Counter-checking correct charges
- H04M15/73—Validating charges
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M15/00—Arrangements for metering, time-control or time indication ; Metering, charging or billing arrangements for voice wireline or wireless communications, e.g. VoIP
- H04M15/80—Rating or billing plans; Tariff determination aspects
- H04M15/8027—Rating or billing plans; Tariff determination aspects based on network load situation
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M15/00—Arrangements for metering, time-control or time indication ; Metering, charging or billing arrangements for voice wireline or wireless communications, e.g. VoIP
- H04M15/83—Notification aspects
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L41/00—Arrangements for maintenance, administration or management of data switching networks, e.g. of packet switching networks
- H04L41/50—Network service management, e.g. ensuring proper service fulfilment according to agreements
- H04L41/5003—Managing SLA; Interaction between SLA and QoS
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L43/00—Arrangements for monitoring or testing data switching networks
- H04L43/08—Monitoring or testing based on specific metrics, e.g. QoS, energy consumption or environmental parameters
- H04L43/0852—Delays
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L43/00—Arrangements for monitoring or testing data switching networks
- H04L43/16—Threshold monitoring
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04L—TRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
- H04L63/00—Network architectures or network communication protocols for network security
- H04L63/04—Network architectures or network communication protocols for network security for providing a confidential data exchange among entities communicating through data packet networks
- H04L63/0428—Network architectures or network communication protocols for network security for providing a confidential data exchange among entities communicating through data packet networks wherein the data content is protected, e.g. by encrypting or encapsulating the payload
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M2215/00—Metering arrangements; Time controlling arrangements; Time indicating arrangements
- H04M2215/01—Details of billing arrangements
- H04M2215/0112—Dynamic pricing, e.g. change of tariff during call
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M2215/00—Metering arrangements; Time controlling arrangements; Time indicating arrangements
- H04M2215/22—Bandwidth or usage-sensitve billing
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M2215/00—Metering arrangements; Time controlling arrangements; Time indicating arrangements
- H04M2215/32—Involving wireless systems
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M2215/00—Metering arrangements; Time controlling arrangements; Time indicating arrangements
- H04M2215/70—Administration aspects, modify settings or limits or counter-check correct charges
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M2215/00—Metering arrangements; Time controlling arrangements; Time indicating arrangements
- H04M2215/70—Administration aspects, modify settings or limits or counter-check correct charges
- H04M2215/7072—Validate charges
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M2215/00—Metering arrangements; Time controlling arrangements; Time indicating arrangements
- H04M2215/74—Rating aspects, e.g. rating parameters or tariff determination apects
- H04M2215/7428—Load situation, e.g. Current network load, traffic load or available resources
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M2215/00—Metering arrangements; Time controlling arrangements; Time indicating arrangements
- H04M2215/82—Advice-of-Charge [AOC], i.e. notify subscriber of charges/cumulative charge; meter at the substation
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M2215/00—Metering arrangements; Time controlling arrangements; Time indicating arrangements
- H04M2215/92—Autonomous calculations of charges in terminal, i.e. meter not controlled from exchange
Definitions
- the present invention relates to a communications network, and in particular to charging mechanisms in such a network.
- conventional communications networks such as national PSTNs (public switched telephone networks)
- PSTNs public switched telephone networks
- metering and billing network usage Studies have estimated these resources as consuming as much as 6% of the operational costs of a telecommunications company.
- the Internet does not in general incorporate metering and billing mechanisms for individual customers.
- the absence of the network infrastructure required to support metering and billing reduces the operational costs of the Internet compared to conventional telephony networks, and has facilitated the rapid expansion of the Internet .
- a method of operating a communications network including distributing a tariff via a communications network to a multiplicity of customer terminals connected to the communications network, and calculating, using the said tariff, a charge for use by the customer terminal of the network to which the tariff applies.
- Reference to a terminal "connected to the network” is used here in the description and the claims to encompasses terminals, such as mobile wireless data terminals, which log on to a network temporarily, and other terminals which have a wireless connection to the network, as well as terminals which are permanently connected to a network by a fixed line.
- a mobile terminal may log on to a network to receive the tariff and subsequently calculate the charge while offline, and such an arrangement falls within the scope of this aspect of the invention.
- a method of operating a communications network including; distributing a tariff via the communications network to a multiplicity of customer terminals connected to the communications network, at a customer terminal measuring use by the customer terminal of network resources; and calculating, using the results of the said step of measuring together with the said tariff, a charge for use by the customer terminal of the network to which the tariff applies.
- These aspects of the invention provide a lightweight charging mechanism suitable for use, for example, in the Internet, or as an alternative to conventional billing mechanisms in other networks where the terminals have some data processing capabilities. It removes the burden of metering and billing from the network infrastructure and instead distributes the tariff to the customer terminals, allowing charges to be calculated at the edge of the network. This approach offers far superior scalability by comparison with conventional approaches, and is therefore particularly suitable for use in a rapidly growing network such as the Internet.
- the tariff algorithm is distributed to the multiplicity of customer terminals via the communications network to which the said tariff applies.
- the charging mechanism is designed to function even if some tariff messages distributed via the network are delayed or lost.
- the step of distributing the tariff includes steps of communicating separately a formula for calculation of network usage charges , and coefficients for use in the said formula.
- the network overhead for charging is further reduced by providing users with the tariff algorithm and then updating only the relevant coefficients when the tariff changes.
- the method includes measuring loading of network resources and determining a revised tariff in dependence upon the results of the said step of measuring loading.
- a further significant advantage of the present invention is that it facilitates control of the use of network resources by amending the tariff to reflect the scarcity of a particular resource.
- the steps of measuring loading and determining a revised tariff may be carried out automatically by a network management platform.
- an algorithm for mapping congestion to price rises is distributed in the network, and preferably is located at customer terminals.
- the method includes operating a plurality of different services on the communications network, communicating different tariffs for different respective services to the multiplicity of customer terminals, and selectively varying a respective tariff depending on an operational condition of the respective service.
- the different services may be distinguished only by different levels of QoS, or may be different in kind.
- This aspect of the invention may also be used in otherwise conventional networks, for example where billing is carried out centrally and tariffs are communicated to the end user only for information.
- a method of operating a communications network comprising: operating a plurality of different services on the network; communicating tariffs for the different services to a multiplicity of customer terminals via a common tariff distribution mechanism; and selectively varying a respective tariff depending on an operational condition of a respective service.
- a method of operating a communications network including calculating for each of a multiplicity of customers, using a selected one of a plurality of different tariffs, charges for the use of network resources by a respective customer terminal attached to the network, measuring the loading of network resources, and varying one or more of the plurality of different tariffs in dependence upon the loading of the network resources, and in which different ones of the plurality of different tariffs have different respective volatilities.
- This aspect provides customers with varying tariffs with different degrees of volatility. Then a customer needing greater stability can pay a premium to achieve that stability, while there still remains a band of higher volatility enabling the network operator to manage short term fluctuations in demand until longer term changes in tariff can be made.
- a method of operating a communications network in which at a point of access to the network a single blocking test only is applied to traffic entering the network .
- a network such as the Internet has operated as a single service network.
- the Internet should become a multiservice network. For example, it may support multiple QoS levels for different applications, or might provide both multicast and unicast services to some but not all customers.
- the present inventors have recognised that, using conventional access control methods, this leads to a build up of multiple tests on access to the multi-service network to determine which service is being requested in each packet and then to check if it is a service which has been paid for by the relevant customer.
- This aspect of the invention overcomes this disadvantages by making a single blocking test that checks whether the customer is in a position to be punished for misuse of the network. Provided that this is the case, then the relevant packet is passed onto the network and all other appropriate checks are done in parallel, rather than blocking the packet while waiting for all the tests to be passed. If any subsequent tests are failed, for example if the packet has used a QoS level not paid for by the customer, then an appropriate punishment is imposed, for example by debiting a fine from a deposit lodged by the customer.
- a method of operating a communications network comprising: a) communicating tariff data to a user terminal connected to the network; b) calculating at the user terminal using the tariff data a charge for traffic communicated between the network and the terminal and making a payment; c) sampling part only of the traffic communicated between users and the network and for the sampled traffic comparing any payments made by users and the payment due according to the tariff .
- a method of operating a communications network comprising a) at a customer terminal measuring network usage; b) communicating network usage data from the customer terminal to the network operator; and c) the network operator sampling part only of the traffic communicated between a customer terminal and the network and for the sampled traffic comparing the network usage with the network usage data from the customer terminal and thereby detecting any discrepancy.
- This aspect of the invention may advantageously be used in conjunction with one or more of the preceding aspects, but may also be used independently of them.
- the customer terminal may measure usage data, and may send this data to the network operator, without having access to the current tariff. The network operator might then apply the relevant tariff and bill the user based on the user's own data.
- the data can be compared with the expected usage data based on the network operator's own measurements in a sampled period. If the data are identical, then the data for other periods is assumed to be trustworthy.
- the tariff may be provided to the customer terminals and then, rather than the usage data being communciated explicitly, the customer calculates the usage charge. The payment of the usage charge, or equivalent accounting information is then communicated to the network operator, and the measured usage data is implicitly present in this communication.
- a method of operating a communications network including automatically varying, depending on network loading as detected at a customer terminal, a tariff for network usage by a customer terminal.
- the invention also encompasses communication networks, management platforms, routers and customer terminals adapted to operate in accordance with the methods of the invention, and computer-readable storage media bearing programs for implementing the invention in one or more of its different aspects.
- Figure 1 is a schematic showing a network embodying the invention
- Figures 2a and 2b are graphs showing tariff functions;
- Figure 3 shows the format of a differential service byte;
- Figures 4a and 4b are schematics showing the component objects of a charging architecture for use with the network of Figure 1 ;
- Figures 5a and 5b shows data passed between the accounting objects of Figure 4;
- Figure 6 is a schematic showing protocol stacks on a customer terminal and in the network domain
- Figure 7 is a graph showing the variation of tariff with time
- Figures 8a to 8e are class diagrams for software implementing accounting and measurement objects
- FIG 9 is a diagram showing a graphic user interface (GUI) for use with the objects of figures 8a to 8e;
- GUI graphic user interface
- Figure 10 is a class diagram for software implementing tariff objects;
- Figure 1 1 is a diagram showing an alternative embodiment
- Figure 12 shows a user interface supporting a market in tariffs.
- a communications network 1 includes a number of network sub-domains 2A-C.
- the network sub-domains may be under the control of different operators who may not trust each other.
- the network subdomains are interconnected by gateway routers 3, 4.
- the communications network is the Internet and supports both unicast and multicast Internet Protocol (IP) and associated protocols.
- IP Internet Protocol
- a customer terminal 5 is connected via a public switched telephony network (PSTN) 6 and an access router 7 to a subdomain 2A. A single blocking test is applied to traffic at this point of access.
- PSTN public switched telephony network
- the gateway routers 3,4, and access router 7 may be commercially available devices such as CISCO series 7500 routers and CISCO series AS5800 universal access server respectively.
- customer terminals are connected to the network, including a Java-enabled mobile terminal 8 and a data server 9.
- the customer terminal 5 may be connected via a LAN to an accounting server.
- the accounting server may include an accounting object as described below that receives measurement data from the customer terminal.
- a network management platform 10 is connected to each subdomain.
- Each network management platform may comprise, for example, a computing system comprising a SPARC workstation running UNIX (Solaris) together with network management applications.
- the network management platform 10 hosts management entities and tariff entities.
- the network management platform communicates with agents 100 in managed devices connected to the respective subdomain, for example using SNMP (simple network management protocol).
- the management platforms monitors the overall loading of network resources in the respective subdomains, and, as will be further described below, adjust the tariffs for network use accordingly.
- the Net management platform instructs the agent to monitor the device and report aggregated results at regular intervals back to the NMP, so the NMP can monitor the combination of all reports.
- Tariff data is communicated to peer tariff entities in other subdomains and also to the customer terminals.
- the tariff data is multicast using, for example Distance Vector Multicast Routing Protocol (DVMRP) or Protocol Independent Multicast (PIM) dense mode.
- DVMRP Distance Vector Multicast Routing Protocol
- PIM Protocol Independent Multicast
- the tariff data channels are announced and monitored using protocols based on SDP (Session Description Protocol), SAP (Session Announcement Protocol) Charging is carried out on a "pay and display" model.
- SDP Session Description Protocol
- SAP Session Announcement Protocol
- Charging is carried out on a "pay and display" model.
- Each customer terminal monitors its own network usage, for example by counting the number of packets it sends or receives across the network interface and the quantity of data (in bytes) in those packets. It calculates, using a tariff received via the network, the payment due to the network operator, and makes a corresponding payment into an account at the network operator.
- the network operator police
- the tariffs supplied to the customer terminals are divided into bands of different volatilities.
- the tariffs are varied under the control of the network operators to reflect the overall loading of the network. That is to say, if network loading becomes high, then the tariffs may be increased to reflect the scarcity of network resources.
- a service provider may offer different products defined by different service level agreements, and/or by different price volatilities. For example product A might offer best-effort service at a fixed price while another product B might offer best-effort service at a variable price.
- a service provider may adjust product prices on the basis of the following parameters: the price the service provider pays to its wholesale provider: competitors' prices; current resource utilisation; relevant demand for different products.
- tariff adjustments may be effected in one of three ways. Firstly, a tariff may adjust prices on the basis of local observations of network loading, without necessitating explicit communication from the provider. This approach, which is described in further detail below, needs to be built into the tariff at the outset, and is limited to those price variations which are dependent exclusively on local observations.
- the provider may tune a tariff by adjusting some of its parameters. This kind of adjustment is required when the decision is dependent on parameters which cannot be observed directly by the customer, e.g., variation in the wholesale price of network resources.
- the provider may completely replace a tariff. This is required when the existing tariff cannot accommodate the changes that are required.
- the first of the tariff changes described above is necessarily carried out automatically.
- the second type of change may be performed manually, or by an agent that issues adjustments automatically in response to observations made by the service provider system.
- the third type of change is likely to be performed manually, as replacement of a new tariff will in general require an element of design requiring human input.
- an agent might be employed to automatically switch tariffs for a product on the basis of a set of specified rules.
- the prototype consists of a library of general-purpose Java classes and two specific applications, namely:
- a provider system which allows the provider to introduce, replace, and tune tariffs for a number of products; • a customer system that enables customer to keep track of the charges being applied for the products they are using.
- the provider system services multiple instances of the customer system running on different hosts in a multicast-enabled network.
- a multicast announcement protocol is used to communicate tariff changes from the provider system to customer systems.
- the Tariff interface acts as the base class for all tariffs. This defines a single operation get GUI 0 which returns as a Java SWING component that can be incorporated into the customer's GUI (graphical user interface). This GUI component enables the customer to visualise the behaviour of the tariff using techniques appropriate to the tariff.
- Subclasses of the Tarrif interface establish a set of tariff types, each of which is associated with a different set of measurement and input parameters.
- the interface RSVPTarif f defines getcharge ( ) as receiving n RSVP TSPEC, allowing for the definition of tariffs that compute price on the basis of the characteristics of an RSVP reservation BLB98.
- the interface PacketCountTariff defines getcharge ( ) as receiving measurements of packets in, packets out, and current congestion (typically measured as a function of packet drop), allowing for the definition of tariffs that are dependent on packet counts and sensitive to congestion. Other tariffs may be added as new forms of usage-measurement emerge.
- tariffs are defined by providing implementations of the various tariff interfaces described above.
- the tariff PacketCountLinear implements PacketCountTariff to compute charges in proportion to packet counts.
- Another tariff CongestionSensitiveLinear works on a similar basis, but adds a penalty charge if the customer does not stay within a specified traffic limit in the presence of congestion.
- a tariff may make use of other 'helper' classes to assist in its operation, as well as one or more user interface component classes for customer visualisation purposes.
- a provider-side user interface may also be required in order to enable the provider to make tariff adjustments.
- a complete tariff description consists of a set of Java classes, some of which are destined for the customer system and others which are intended for use by the provider system -
- the customer-side classes are bundled into a Java archive (JAR) file to facilitate processing by the provider system.
- JAR Java archive
- the provider system In order to deploy a new tariff, the provider system first loads the tariff classes which it requires into its execution environment. It then loads the customer-side bundle, serialises it, signs it with a private key, and uses an announcement protocol to distribute it to customer systems. The use of a signature makes it possible for customers to verify that received tariffs are authentic.
- each customer system Upon receiving the bundle, each customer system verifies the signature (using the public key matching the provider's private key), and at the activation time specified in the announcement protocol header which may be significantly later, e.g. hours or days, unpacks the bundle, and loads the classes into its execution environment using a purpose-built dynamic class loader. An instance of the received tariff class is created and installed in place of the previous tariff. If the tariff has a user interface component (obtained by calling the tariff object's getGUi ( ) method), then it replaces the user interface of the previous tariff. The change in user interface services to notify the user that the tariff has changed. Tariff adjustment involves the remote invocation of an operation which is specific to the tariff currently in force.
- Idempotency guarantees that a tariff will not be adversely affected if an adjustment is applied more than once. Completeness implies that an adjustment determines the entire parameter set of a tariff object, so that an adjustment completely removed the effects of any previously applied adjustments.
- the customer system may apply a tariff by repeatedly invoking the getcharge ( ) operation supported by that tariff every second, and adding the returned value to the cumulative charge.
- the parameters supplied to getcharge ( ) depend on the kind of tariff currently in force. For example, if the tariff is an implementation of PacketCountTariff, then measurements of inbound packets, outbound packets and congestion over the past second are required.
- CongestionSensitiveLinear tariff the usage parameters supplied to getcharge ( ) are used to update the graphical displays of traffic and congestion.
- the announcement protocol is used to communicate serialised tariffs and adjustments from a provider system to multiple customer systems.
- the number of customer systems is assumed to be large, and a repeated multicast solution is adopted.
- Each product supported by a provider is assigned a multicast channel for announcement purposes.
- Customer systems listen to the channels corresponding to the products that they are using. In the current implementation, it is assumed that each customer system has knowledge of well-known multicast addresses for the products it is interested in. For each product channel, the provider repeatedly announces the current tariff and the most recent adjustment made to it (if any). Each announcement carries a version number, which is incremented each time the announcement is changed. Customer systems only process announcements when a version number change is detected. If a new customer joins a channel, it waits until it receives a tariff before processing any adjustment announcements.
- the tariff algorithms installed on the customer terminals are arranged to respond automatically to congestion in a network resource being used by the terminal.
- Each algorithm includes a function which varies the price for network usage in dependence upon the detected congestion level. This function may be integrated in the main tariff algorithm, or, as in the example described here may be a separate algorithm used to calculate a premium to be added to a price calculated in accordance with the main tariff algorithm.
- the main tariff algorithm calculates a price P as a function of a number of quality parameters, Q u Q 2 , Q 3 where, for example, Q, is a specified latency for packets communicated across the interface between the customer terminal and the network, Q 2 is the reserved bandwidth for the transmission, Q 3 is a specified level of reliability corresponding to a maximum permissible level of packet loss.
- Q is a specified latency for packets communicated across the interface between the customer terminal and the network
- Q 2 is the reserved bandwidth for the transmission
- Q 3 is a specified level of reliability corresponding to a maximum permissible level of packet loss.
- the congestion tariff algorithm calculates a premium ⁇ P which is a function of one or more congestion parameters C:
- the congestion parameters provide a measure of the loading of the resources which a customer terminal is making use of at any given time.
- the ratio of packets lost to packets received is used as the congestion parameter.
- This parameter is readily calculated, for example in the case of packets using TCP (transport control protocol), or RTP (real time protocol) over UDP (user datagram protocol), since such packets include a sequence number.
- Figure 2b shows one example of the function for generating the premium. In this case, the premium increases as an approximately exponential function of the congestion, so that at low congestion levels a small premium is charged, while if congestion increases still further, then at higher levels of congestion the premium increases sharply.
- an explicit congestion signal is added by any congested router within the network to packets transmitted to the customer terminal.
- nodes are arranged to discriminate between packets to provide different levels of service. This capability might be used, for example, to accord delay-sensitive data, such as data generated by an IP telephony client, a higher priority compared to other data, such as email data.
- delay-sensitive data such as data generated by an IP telephony client
- other data such as email data.
- bits in a TOS (type of service) octet contained within each packet header are set to indicate the appropriate service level. Those bits are used by routers within the network to determine how the relevant packets should be handled.
- TOS type of service
- the TOS octet when used in this way is termed the DS (differential service) byte.
- the format of the differential service byte is shown in Figure 3.
- Bit zero, labelled “IN” indicates whether the packet is inside or outside a defined profile.
- Bits 1 to 5 labelled “PHB” define a "per-hop-behaviour” that is they indicate how, for example, a router should handle the packet, e.g. by according it lower or higher priority.
- Bits 6 to 7, in this particular form of the DS byte, are used for explicit congestion notification (ECN).
- One of these bits is set to indicate whether the routers in the path of the packet are capable of setting the ECN field, and the other bit is used as a flag which is set (by ECN capable routers) when congestion, or loading which would potentially lead to congestion, occurs.
- Random Early Detection (RED) algorithms are currently implemented in routers. These algorithms measure average queue length within the packet buffers of a router. An exponential moving average is calculated. When that average queue length exceeds a predetermined threshold, then the router signals that congestion is occurring. Conventionally this signalling has been done simply by dropping a packet. However, in the context of an ECN scheme, the router, instead of dropping a packet, sets an ECN bit in a packet header to indicate that congestion is occurring.
- some of the packets from the server 9 en route to the client terminal have the ECN bit of the DS byte set by the router 9 to mark the fact that congestion is occurring.
- the DS byte in the headers of incoming packets is read.
- a moving average of the number of packets containing an ECN bit which is marked is calculated. This average then provides the congestion parameter C , which is used to calculate the premium:
- This total price is passed to a cost decision agent running on the client terminal.
- This cost decision agent is programmed with user defined rules. These might state, for example, that the cost decision agent should authorise the system to proceed with a connection as long as the total cost averaged over a certain time period falls below a predetermined threshold, e.g. of £0.01 per minute, and that the cost decision agent should suspend a connection and alert the user if the cost rises above that threshold.
- the cost decision agent may handle several applications simultaneously, and may be programmed to slow down one of the applications as the premium for using a data source accessed by that application increases.
- the network borrows capacity from lower levels of service (lower in the context of the relevant dimension(s) of QoS) including the best effort service 3.the network introduces extra capacity (possibly automatically) 4. the end-system establishes that the congestion is on the shared network and not just on the access links or end systems
- the end-system sets QoS requirements to a "higher" level (if cheaper than the fine for ignoring congestion at the current level) 6. the end-system decides it is essential to ignore the congestion, given the fine for doing so might be quite high 7. both (all) end-systems agree to ignore the congestion.
- Step 4 it is at step 4 that an ECN signal is generated. Steps 1 to 3 precede the generation of this signal and steps 5 to 7 follow the generation of the ECN signal.
- the last step prior to proceeding with a connection and paying the premium for doing so is establishing agreement by both parties. Accordingly, when the customer terminal detects congestion, either through receiving explicit congestion notification, or through detection of a relevant parameter such as packet loss, the customer terminal signals this fact back to the or each other end system. In the present example therefore, the client terminal 5 signals to the data server 9 that congestion is occurring.
- the data server is programmed with rules, which as at the customer may be implemented as an agent, which determine the response to such a signal. For example, the server may refuse service in these conditions.
- tariffs are multicast through the network from network operators to the customer terminals, and charging is carried out using a "pay and display" process.
- Figures 4a and 4b shows the objects used to implement the charging architecture in this case.
- Figure 4a shows the higher level objects and 4b shows the component objects used in a software implementation of the architecture of Figure 4b.
- objects on the client terminal are shown in the half of the Figure labelled "customer” and objects on the access router 7 and the corresponding network sub-domain are shown in the half of the Figure labelled "edge network".
- the objects on the customer terminal include a session control object S, a customer business rules object B c , a customer pricing object Pr c , a QoS manager Q, a customer accounting object Act, and a customer measurement object M c .
- the business rules object B c receives information on those aspects of the session which involve liability for payment and receives current pricing data from the pricing object Pr c .
- the customer business object makes decisions, under the customer's policy control on which chargeable services are utilised, and how much of the chargeable services are utilised. These decisions are fed to the QoS manager Q, which decides which mechanisms are used to achieve the requirements.
- the QoS manager then controls the customer measurement object M c to determine which aspects of traffic and service to measure and which aspects to ignore.
- the measurement object then records the selected aspects of the traffic, for example counting the number of packets received by the customer terminal and the QoS levels for those packets.
- the measurement object M c is also programmed with instructions which determine the frequency with which it passes data to the customer accounting object Act, .
- the customer accounting object Act- passes payments to an accounting object Act p in the network provider's domain.
- the accounting objects on the customer terminal may be implemented using a small encrypted flat-file database.
- the equivalent objects On the network provider's side, the equivalent objects may be implemented using a larger database that is scaleable to handle e.g., tens of thousands of customer accounts.
- An object request broker (ORB) is used for communication between the customer-side objects and the network-side objects, implemented using commercially available tools such as ORBIX (TradeMark) from lona Technologies pic.
- M p On the network provider's side, that is to say within the subdomain to which the customer terminal is connected, the customer's traffic is measured by a version of M, denoted M p , but only on a sampling basis determined by the policing function, Po. That is to say, the network operator samples the customer's traffic only intermittently. Po controls where in the network measurements are made in order to capture all of any particular customer's traffic.
- a bulk measurement function, M b is responsible for reporting aggregate traffic levels, as reflected in the moving average of the router queue lengths, to the pricing object, Pr p . Bulk measurements would typically be collected from across the provider's domain to a centralised pricing function (which would be replicated for reliability).
- Pr p sets prices taking into account the business rules from the network provider's business object, B p , as well as the current traffic levels reported by Mb and pricing from neighbouring providers (see below).
- the policing function, Po compares sample measurements from M p with accounting messages received at Act p as a result of the customers own measurements . If it establishes that the accounts are insufficient it might restrict service at the access control gateway, Acs, or initiate some other punishment. Encapsulated within the accounting object another policing object checks the accounts match the payments within the contracted time for payment.
- the identity mapping function, I provides a mapping between a customer's identity (account, digital signature, etc.) and their current network address (typically allocated by the ISP, whether unicast or multicast).
- Figure 5 shows the data which are passed between the accounting objects.
- the account data comprises: account identity; bill record identity; service type identifier; source address; destination address; tariff identity; time; period (i.e. the period covered by the bill record); units; cost; and currency.
- the payment data comprises the amount of money and the currency of payment.
- Figure 6 shows the measurement region within protocol stacks on the customer terminal and in the network domain.
- there would be two measurement points within this region one trusted by the customer and one trusted by the network, for example at the two points referenced (a) in the Figure.
- a single measurement point (b) trusted by both parties may be used. This might be implemented, for example within a secure module such as a cryptographic card on the client terminal.
- measurements may be made at different points with some possibility of discrepancies between measurements.
- the practical measurement point is at the first access device(s) that, for each customer, inspects network layer headers (c)(IP in this case). ISPs should not measure any deeper into their network (d) because their access network and systems will introduce delays and losses.
- a practical point at which to measure would also be alongside the network layer but in their end- system's stack (e). Ideally these measurement points would be lower in each stack to be closer to the interface between the two parties and less likely to be affected by contention in the stack.
- measuring at the link layer (f-f) would be inappropriate because only some chargeable parameters set at the network layer will ever be reflected in link layer frames; network level multicast, end-end latency requirements etc. may never be visible at the link layer.
- link layer headers would need to be ignored when measuring packet sizes for bandwidth calculations to avoid apparent discrepancies where different link technologies are chained together.
- this choice of measurement points implies that the lower layers must be dimensioned (buffer sizes, interrupt and thread scheduling priorities) to cope with the most stringent QoS requirements of higher layers.
- the machine must be able to pass data up the stack without any chance that usage-charged data gets discarded (e.g. due to buffer overflow caused by interrupt contention) before it gets to the network layer. It is at the network layer where the ISP's service is to be measured and where it is most convenient for QoS requirements to control correct differential treatment of the various flows as they are passed further up the stack (on end-systems) or forwarded (on routers).
- the measurement objects described above may be implemented using, with appropriate modifications, publicly available network metering software such as Nevil Brownlee's NeTraMet system.
- This is a software meter which conforms to the IETF internet accounting architecture described in RFC 2063 and RFC 2064.
- the meter builds up, using "packet sniffing", packet and byte counts for traffic flows, which are defined by their end-point addresses.
- Addresses can be ethernet addresses, protocol addresses (IP, DECnet, EtherTalk, IPX or CLNS) or 'transport' addresses (IP port numbers, etc), or any combination of these, in the present implementation IP addresses only are used.
- the traffic flows to be observed are specified by a set of rules, which are downloaded to NeTraMet by a 'manager' program. Traffic flow data is collected via SNMP (Simple Network Management Protocol) from a 'collector' program.
- SNMP Simple Network Management Protocol
- Figure 7 shows how the main tariff determined by the network operator varies in time.
- curve A is the spot price calculated to reflect the loading of the network at any instant.
- Curve B is one of a number of different tariff bands. Different tariff bands have different volatilities, and the customer pays a premium for bands offering greater stability.
- Tariffs are communicated to the customer terminals using a hierarchy of channels carried by the network.
- An initial contract between a customer and a service provider a single channel address that might typically hold new announcements distributed some months apart (e.g. for contract variations or for new services specifying which second level channel to listen to for tariffs or for downloading new code to handle new tariff structures).
- the second level channels might deliver updates hours apart which simply announce the addresses of third level channels for the most volatile information.
- These third level channels may carry updates at intervals of less than a second.
- prices for many services may be carried on one channel.
- this one channel may be split into several channels at times of highest volatility, and re-aggregated into a single channel in more stable periods.
- the provider instead of Charging a standard tariff for each customer based on their usage, the provider might wish to sell an individual service level agreement (SLA) to each customer.
- SLA service level agreement
- customers might be able to choose to accept service under one of a (possibly large) range of SLAs.
- Such an SLA might include obligations on the provider to provide a certain percentage service availability and other aspects of quality not directly to do with communications traffic.
- the SLA might also include a traffic conditioning agreement (TCA), such as is envisaged between providers and between providers and major customers in the proposed IETF differentiated services architecture.
- TCA traffic conditioning agreement
- a TCA contains obligations on the provider's quality of service on condition that the customer's traffic is within a certain profile. Often, if traffic is outside the profile, the TCA still applies to the balance of traffic within profile.
- a profile might stiplate the maximum size and duration of bursts the customer should generate, or the peak rate, or the moving average rate under specified parameters.
- TCAs can also be applied to received traffic on the assumption the customer can control the rate of remote senders using rate control protocols.
- TCAs are policed by a traffic policer installed at the entrance to the provider's network.
- Traffic policers either drop or mark any traffic outside the agreed profile which is configured into the policer. The choice of which packets to mark is random.
- the first 6 bits of the DS-byte are termed the code-point. If the last five bits of the code-point are within a certain range, the first bit of the DS byte can be used as a flag to indicate whether the packet is out of profile. Packets out of profile are still forwarded, but they take first precedence for dropping in any congested queue of any downstream router.
- the diffserv proposals also suggest that customers might also operate policers in series with the provider policer to mark packets that are out of profile. If done under the control of the customer's application, this enables the customer to choose which packets are marked based on their importance to the application.
- Tables 1 to 7 below list Java source code used to implement two different tariffs.
- the code of table 1 establishes the operations used for communication between a customer system and a tariff algorithm downloaded by the customer system.
- Table 2 shows a linear tariff algorithm, in which the tariff depends on the total of the packets sent and packets received by the customer together with a congestion parameter.
- Table 3 shows the code for generating the customer display in this case.
- Table 4 shows the code used to display the tariff at the network operator's server.
- Table 5 shows an exponential tariff algorithm.
- Table 6 generates the customer display and Table 7 the operator display for the exponential tariff algorithm.
- FIG. 1 2 shows a modified user interface adopted at the customer terminal in this case.
- This user interface might be adopted, for example, when the customer requires a multicast audio-video conference involving data, audio and video applications.
- a slider control interface is used to set the required quality Q level for each of the component data streams.
- the underlying application then translates the Q parameter into appropriate performance parameters such as required bandwidth, packet loss and latency.
- the customer terminal receives multicast tariffs from two different service providers or network operators, SP1 and SP2.
- the user interface in addition to displaying the cost with the currently selected service provider, SP1 , also displays the cost were the other service provider, SP2 to be selected.
- the user may opt to switch to the second service provider SP2 for one or all of the data streams.
- the current costs of the video data stream in the example shown in the Figure is substantially reduced by switching to the second service provider.
- the decision to switch may be made manually by the user, or might be automated through a software agent running on the customer terminal.
- the switch to a different provider may be made by dialling a different number using the customer terminal modem so that the PPP connection is made via a different access router, possibly on a different network domain.
- Such switching between service providers is facilitated when using a protocol such as Internet Protocol version 6 which, in a proposed implementation, offers both host and site addresses, where host addresses may remain stable even when a site IP address changes. In this case, the customer terminal would have both a host address and a site address and while the site address would change on switching service providers, the host IP address remains constant.
- FIG. 1 1 shows an example of the invention applied in this context.
- customer terminals 81 which are in this example so-called intelligent phones, that is telephones incorporating a microprocessor and a data interface, are connected via local exchanges 82 and trunk exchanges 3 to the telephony networks.
- the trunk exchanges 83 are connected via a common channel SS7 (signalling system number 7) signalling network to a service control point 85 that is responsible for the execution of advanced call control functions.
- SS7 signalling system number 7
- the service control point 85 is also connected to an operational support server 86 that is responsible for billing operations, and that, in this example, controls the setting of tariffs for the network.
- the OSS server and customer terminals include tariff entities (TE).
- the fixed PSTN network is also interconnected via a gateway 87 to a cellular GSM network 88.
- Base Stations BS in the cellular network communicate signals to intelligent mobile phones 89.
- network tariffs are distributed to customer terminals via the PSTN network and via the GSM network.
- the tariff may again take the form of Java functions which are executed on processors in the customer terminals.
- the Java functions may be streamed as Internet packets. In one implementation, these Internet packets may be distributed via the PSTN networks and GSM networks themselves.
- the packets may be encapsulated and transported to the trunk exchanges using the MTP (message transport part) transport layer and may be communicated onwards to the customer terminals using out-of-band signalling.
- MTP message transport part
- a separate data connection may be established between the OSS server and the customer terminals via the public internet.
- the network operator monitors the loading of resources within the network and may transmit signals to the tariff entities in the customer terminals to change the tariff to reflect the scarceness or otherwise of relevant resources.
- Customer terminals may themselves monitor network loading and automatically generate variations in the tariffs. Usage of network resources may be measured locally by the customer terminals instead of conventional billing carried out within the network.
- the network operator may police the measurement of usage data by carrying out sampling, as described previously. Table 1
- Box vbox Box.createVerticalBox ( ) ;
- Box hbox Box.createHorizontalBox ( ) hbox.add (Box.createHorizontalGlue ( )) ; hbox.add (new Jlabel ("Rate:”)); hbox.add (Box.createHorizontalGlue( )); hbox.add (tfRate); tfRate. setEditable (false); hbox.add (Box.createHorizontalGlue( )) vbox. add (hbox); add (vboxO);
- Box hbox Box.createHorizontalBox ( ); hbox.add (new Jlabel ("Rate:”)); hbox.add (Box.createHorizontalGlue( )); hbox.add (tfRate); hbox.add (Box.createHorizontalGlue( )); hbox.add (hbox);
- JButton bTransmit new JButton ("Transmit”); bTransmit. addActionListener ( new ActionListener ( ) ⁇ public void actionPerformed (ActionEvent e) ⁇ transmit ( ) ;
- hbox Box.createHorizontalBox( ); hbox.add. (Box.createHorizontalGlue( )); hbox.add (bTransmit); hbox.add (Box.createHorizontalGlue( )); vbox. add (hbox); add (vbox);
- Jpanel panel new JPanel (new GridLayout (3,2)); panel. add (new JLabel ("Minimum”)); panel. add (tfMin); tfMin. addActionListener ( new ActionListener ( ) ⁇ public void actionPerformed (ActionEvent e) ⁇ transmit ("setMin", tfMin);
Landscapes
- Engineering & Computer Science (AREA)
- Computer Networks & Wireless Communication (AREA)
- Signal Processing (AREA)
- Environmental & Geological Engineering (AREA)
- Data Exchanges In Wide-Area Networks (AREA)
- Meter Arrangements (AREA)
- Telephonic Communication Services (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU41575/99A AU4157599A (en) | 1998-06-05 | 1999-06-04 | Communications network |
| CA002333362A CA2333362C (en) | 1998-06-05 | 1999-06-04 | Communications network |
| DE69934898T DE69934898T2 (de) | 1998-06-05 | 1999-06-04 | Abrechnung in einem kommunikationsnetz |
| US09/674,717 US7319673B1 (en) | 1998-06-05 | 1999-06-04 | Communications network |
| JP2000554088A JP4455758B2 (ja) | 1998-06-05 | 1999-06-04 | 通信ネットワーク |
| EP99925195A EP1119943B1 (en) | 1998-06-05 | 1999-06-04 | Accounting in a communications network |
| US11/216,349 US7535853B2 (en) | 1998-06-05 | 2005-09-01 | Communications network |
Applications Claiming Priority (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB9812161.9 | 1998-06-05 | ||
| GBGB9812161.9A GB9812161D0 (en) | 1998-06-05 | 1998-06-05 | Communications network |
| GB9825723.1 | 1998-11-24 | ||
| EP98309609.0 | 1998-11-24 | ||
| GBGB9825723.1A GB9825723D0 (en) | 1998-11-24 | 1998-11-24 | Communications network |
| EP98309609 | 1998-11-24 | ||
| GB9902052.1 | 1999-01-29 | ||
| GBGB9902052.1A GB9902052D0 (en) | 1999-01-29 | 1999-01-29 | Communications network |
| GB9902648.6 | 1999-02-05 | ||
| GBGB9902648.6A GB9902648D0 (en) | 1999-02-05 | 1999-02-05 | Communications network |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US09/674,717 A-371-Of-International US7319673B1 (en) | 1998-06-05 | 1999-06-04 | Communications network |
| US11/216,349 Division US7535853B2 (en) | 1998-06-05 | 2005-09-01 | Communications network |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO1999065183A2 true WO1999065183A2 (en) | 1999-12-16 |
| WO1999065183A3 WO1999065183A3 (en) | 2001-05-03 |
Family
ID=27514488
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB1999/001765 Ceased WO1999065183A2 (en) | 1998-06-05 | 1999-06-04 | Accounting in a communications network |
| PCT/GB1999/001773 Ceased WO1999065185A2 (en) | 1998-06-05 | 1999-06-04 | Communications network with tariff based on network load |
| PCT/GB1999/001772 Ceased WO1999065184A2 (en) | 1998-06-05 | 1999-06-04 | Accounting in a communications network |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB1999/001773 Ceased WO1999065185A2 (en) | 1998-06-05 | 1999-06-04 | Communications network with tariff based on network load |
| PCT/GB1999/001772 Ceased WO1999065184A2 (en) | 1998-06-05 | 1999-06-04 | Accounting in a communications network |
Country Status (8)
| Country | Link |
|---|---|
| US (4) | US7426471B1 (enExample) |
| EP (3) | EP1119943B1 (enExample) |
| JP (3) | JP4455758B2 (enExample) |
| CN (3) | CN1222135C (enExample) |
| AU (3) | AU770571B2 (enExample) |
| CA (3) | CA2333361C (enExample) |
| DE (3) | DE69919190T2 (enExample) |
| WO (3) | WO1999065183A2 (enExample) |
Cited By (37)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR2799910A1 (fr) * | 1999-10-19 | 2001-04-20 | Motorola Inc | Elements securises d'un systeme a largeur de bande repartie |
| WO2001069453A1 (en) * | 2000-03-15 | 2001-09-20 | Aware, Inc. | Systems and methods for information management over a distributed network |
| WO2001099348A1 (en) * | 2000-06-15 | 2001-12-27 | British Telecommunications Public Limited Company | Protocol for multicast communication |
| WO2002009408A1 (en) | 2000-07-21 | 2002-01-31 | Telemac Corporation | A method and system for data rating for wireless devices |
| WO2001031883A3 (en) * | 1999-10-22 | 2002-06-27 | Nomadix Inc | Information and control console for use with a network gateway interface |
| WO2001086933A3 (en) * | 2000-05-10 | 2002-08-01 | Hewlett Packard Co | Distributed pre-paid communications infrastructure |
| WO2001099400A3 (en) * | 2000-06-16 | 2002-08-01 | British Telecomm | Network charging |
| WO2002039671A3 (en) * | 2000-11-07 | 2002-11-28 | Casio Computer Co Ltd | Data communication terminal |
| WO2003013123A1 (en) * | 2001-07-30 | 2003-02-13 | Msafe Inc. | Prepaid communication system and method |
| EP1284551A1 (de) * | 2001-08-08 | 2003-02-19 | Siemens Aktiengesellschaft | Kennzeichnung der Dienstgüte einer Informationsübermittlung in einem Kommunikationsnetz |
| US6615137B2 (en) | 2001-06-26 | 2003-09-02 | Medius, Inc. | Method and apparatus for transferring information between vehicles |
| US6629033B2 (en) | 2001-04-24 | 2003-09-30 | Medius, Inc. | Open communication system for real-time multiprocessor applications |
| WO2003100688A1 (en) * | 2002-05-24 | 2003-12-04 | Medius, Inc. | Method and apparatus for monitoring packet based communications in a mobile environment |
| WO2004006501A1 (en) * | 2002-07-03 | 2004-01-15 | British Telecommunications Public Limited Company | Trust establishment for multi-party communications |
| WO2003105447A3 (de) * | 2002-06-05 | 2004-03-11 | Siemens Ag | Verfahren und system zum vergebühren von diensten |
| US6771208B2 (en) | 2002-04-24 | 2004-08-03 | Medius, Inc. | Multi-sensor system |
| EP1443437A1 (en) * | 2002-12-18 | 2004-08-04 | Alcatel | A method, a mobile telecommunication device, a base station, and a computer software product for guiding a user of a mobile when intending invoking a service |
| US6778073B2 (en) | 2001-06-26 | 2004-08-17 | Medius, Inc. | Method and apparatus for managing audio devices |
| US6792351B2 (en) | 2001-06-26 | 2004-09-14 | Medius, Inc. | Method and apparatus for multi-vehicle communication |
| GB2399429A (en) * | 2003-03-14 | 2004-09-15 | Vodafone Plc | Providing cost data to users of a communication network |
| EP1465399A1 (en) * | 2003-04-02 | 2004-10-06 | Orange S.A. | Telecommunications apparatus and method |
| WO2005046196A1 (de) * | 2003-11-06 | 2005-05-19 | Giesecke & Devrient Gmbh | Verfahren zum betreiben eines mobilteils in einem mobilfunknetz |
| EP1285369A4 (en) * | 2000-05-25 | 2006-01-18 | Lead Ip Systems Ltd | EXPERIENCE AND SYSTEM FOR CHARGING CALCULATION IN A NETWORK |
| WO2006040020A1 (en) * | 2004-10-15 | 2006-04-20 | Siemens Aktiengesellschaft | Customer telecommunications apparatus providing billing information to network |
| EP1703668A1 (en) * | 2005-03-18 | 2006-09-20 | Nederlandse Organisatie voor toegepast-natuurwetenschappelijk Onderzoek TNO | System for processing quality-of-service parameters in a communication network |
| US7146260B2 (en) | 2001-04-24 | 2006-12-05 | Medius, Inc. | Method and apparatus for dynamic configuration of multiprocessor system |
| US7178049B2 (en) | 2002-04-24 | 2007-02-13 | Medius, Inc. | Method for multi-tasking multiple Java virtual machines in a secure environment |
| US7319673B1 (en) | 1998-06-05 | 2008-01-15 | British Telecommunications Plc | Communications network |
| US7436942B2 (en) | 2001-11-21 | 2008-10-14 | Telefonaktiebolaget Lm Ericsson (Publ) | System and method for charging in a communication network |
| US7689716B2 (en) | 1998-12-08 | 2010-03-30 | Nomadix, Inc. | Systems and methods for providing dynamic network authorization, authentication and accounting |
| WO2010141009A1 (en) | 2009-06-01 | 2010-12-09 | Alcatel-Lucent Usa Inc | Notification of charging rate adjustments in regions of a mobile network to control bandwidth usage in the regions |
| EP2403226A1 (en) * | 2010-06-30 | 2012-01-04 | Runs NV | Method for real-time monitoring of packet-based telecom services, and corresponding server and client device |
| US8266266B2 (en) | 1998-12-08 | 2012-09-11 | Nomadix, Inc. | Systems and methods for providing dynamic network authorization, authentication and accounting |
| US8713641B1 (en) | 1998-12-08 | 2014-04-29 | Nomadix, Inc. | Systems and methods for authorizing, authenticating and accounting users having transparent computer access to a network using a gateway device |
| US9358924B1 (en) | 2009-05-08 | 2016-06-07 | Eagle Harbor Holdings, Llc | System and method for modeling advanced automotive safety systems |
| US10298735B2 (en) | 2001-04-24 | 2019-05-21 | Northwater Intellectual Property Fund L.P. 2 | Method and apparatus for dynamic configuration of a multiprocessor health data system |
| US10361802B1 (en) | 1999-02-01 | 2019-07-23 | Blanding Hovenweep, Llc | Adaptive pattern recognition based control system and method |
Families Citing this family (156)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8352400B2 (en) | 1991-12-23 | 2013-01-08 | Hoffberg Steven M | Adaptive pattern recognition based controller apparatus and method and human-factored interface therefore |
| BR9808014B1 (pt) | 1997-03-12 | 2013-06-25 | Mídia legível por computador, não transitória e sistema de rede externa | |
| US7966078B2 (en) | 1999-02-01 | 2011-06-21 | Steven Hoffberg | Network media appliance system and method |
| US6563809B1 (en) * | 1999-04-28 | 2003-05-13 | Tantivy Communications, Inc. | Subscriber-controlled registration technique in a CDMA system |
| US7246154B1 (en) * | 1999-05-06 | 2007-07-17 | Cisco Technology, Inc. | Directing data network communications based on geographic location of a user |
| AU1224101A (en) | 1999-10-22 | 2001-05-08 | Nomadix, Inc. | Gateway device having an xml interface and associated method |
| US7280492B2 (en) * | 2000-02-22 | 2007-10-09 | Ncast Corporation | Videoconferencing system |
| US20020054205A1 (en) * | 2000-02-22 | 2002-05-09 | Magnuski Henry S. | Videoconferencing terminal |
| EP1260055A1 (en) * | 2000-02-23 | 2002-11-27 | Nokia Corporation | Method and system for preparing reports in a communication system comprising at least two networks |
| GB0006230D0 (en) * | 2000-03-16 | 2000-05-03 | Univ Strathclyde | Mobile communications newworks |
| US20020022483A1 (en) * | 2000-04-18 | 2002-02-21 | Wayport, Inc. | Distributed network communication system which allows multiple wireless service providers to share a common network infrastructure |
| EP1297345A2 (en) * | 2000-06-22 | 2003-04-02 | Jimmi Limited | Tariff generation, invoicing and contract management |
| US8325761B2 (en) * | 2000-06-26 | 2012-12-04 | Massivley Parallel Technologies, Inc. | System and method for establishing sufficient virtual channel performance in a parallel computing network |
| US7111163B1 (en) | 2000-07-10 | 2006-09-19 | Alterwan, Inc. | Wide area network using internet with quality of service |
| WO2002006972A1 (en) * | 2000-07-13 | 2002-01-24 | Aprisma Management Technologies, Inc. | Method and apparatus for monitoring and maintaining user-perceived quality of service in a communications network |
| AU2001293598A1 (en) * | 2000-10-05 | 2002-04-15 | Certicom Corp. | A method for providing information security for wireless transmissions |
| US6934256B1 (en) * | 2001-01-25 | 2005-08-23 | Cisco Technology, Inc. | Method of detecting non-responsive network flows |
| EP1251669A1 (en) | 2001-04-19 | 2002-10-23 | BRITISH TELECOMMUNICATIONS public limited company | Communications network |
| US7035294B2 (en) * | 2001-06-04 | 2006-04-25 | Calix Networks, Inc. | Backplane bus |
| US20030014532A1 (en) * | 2001-07-16 | 2003-01-16 | Shean-Guang Chang | Method and apparatus for multicast support |
| EP1449312B1 (en) * | 2001-11-30 | 2012-03-21 | BRITISH TELECOMMUNICATIONS public limited company | Method of resource control in a wireless network |
| EP1454456B1 (en) * | 2001-12-11 | 2012-12-26 | BRITISH TELECOMMUNICATIONS public limited company | Event notification over a communications network |
| US7054940B2 (en) * | 2002-01-25 | 2006-05-30 | Thomson Licensing | Adaptive cost of service for communication network based on level of network congestion |
| EP1335535A1 (en) | 2002-01-31 | 2003-08-13 | BRITISH TELECOMMUNICATIONS public limited company | Network service selection |
| EP1345402A1 (en) * | 2002-03-14 | 2003-09-17 | TELEFONAKTIEBOLAGET L M ERICSSON (publ) | Method and system for access and accounting of point-to-multipoint services |
| GB2387064B (en) * | 2002-03-26 | 2004-06-16 | Motorola Inc | Method and system for construction and communication of data on network access and service transactions in a telecommunication network |
| GB0216728D0 (en) * | 2002-07-18 | 2002-08-28 | British Telecomm | Network resource control |
| US20040244033A1 (en) * | 2003-04-07 | 2004-12-02 | Norman Ostensoe | Multi-format digital video fiber-optic link |
| US7644153B2 (en) * | 2003-07-31 | 2010-01-05 | Hewlett-Packard Development Company, L.P. | Resource allocation management in interactive grid computing systems |
| US7376154B2 (en) * | 2003-08-29 | 2008-05-20 | Agilent Technologies, Inc. | Non-intrusive method for routing policy discovery |
| GB0321570D0 (en) * | 2003-09-15 | 2003-10-15 | British Telecomm | Inter-domain congestion charging |
| JP2005150983A (ja) * | 2003-11-12 | 2005-06-09 | Ntt Docomo Inc | サーバ装置 |
| FR2866498A1 (fr) * | 2004-02-17 | 2005-08-19 | Thomson Licensing Sa | Methode de transmission d'un flux multipoint dans un reseau local et dispositif de connexion implementant la methode |
| US7337650B1 (en) | 2004-11-09 | 2008-03-04 | Medius Inc. | System and method for aligning sensors on a vehicle |
| US8108510B2 (en) * | 2005-01-28 | 2012-01-31 | Jds Uniphase Corporation | Method for implementing TopN measurements in operations support systems |
| CN101189839A (zh) * | 2005-04-29 | 2008-05-28 | 艾利森电话股份有限公司 | 用于控制分组交换数据流中的实时连续数据的方法、系统及其使用,用所述方法提供的实时连续数据服务 |
| US8005457B2 (en) | 2005-09-02 | 2011-08-23 | Adrian Jones | Method and system for verifying network resource usage records |
| US7962633B1 (en) * | 2005-10-13 | 2011-06-14 | Juniper Networks, Inc. | Network service management using customizable business-level rules |
| EP1873968A1 (en) * | 2006-06-26 | 2008-01-02 | BRITISH TELECOMMUNICATIONS public limited company | Monitoring networks |
| JPWO2008053954A1 (ja) * | 2006-11-01 | 2010-02-25 | パナソニック株式会社 | 通信制御方法、通信システム、ホームエージェント割り当てサーバ及びモバイルノード |
| US8438229B2 (en) | 2007-03-07 | 2013-05-07 | True Engineering Technology, Llc | System and method of supporting constructive discourse on computers and mobile devices |
| US7796510B2 (en) * | 2007-03-12 | 2010-09-14 | Citrix Systems, Inc. | Systems and methods for providing virtual fair queueing of network traffic |
| US7760642B2 (en) | 2007-03-12 | 2010-07-20 | Citrix Systems, Inc. | Systems and methods for providing quality of service precedence in TCP congestion control |
| US9209982B2 (en) * | 2007-05-18 | 2015-12-08 | Cisco Technology, Inc. | Charging for network services based on delivered quality of service |
| US9106800B2 (en) * | 2007-08-31 | 2015-08-11 | At&T Intellectual Property I, L.P. | System and method of monitoring video data packet delivery |
| GB2470134A (en) * | 2008-01-02 | 2010-11-10 | True Engineering Technology Ll | Statement-based computing system |
| US8031721B2 (en) * | 2008-02-12 | 2011-10-04 | Alcatel Lucent | Method and apparatus for marking and scheduling packets for transmission |
| EP2101503A1 (en) * | 2008-03-11 | 2009-09-16 | British Telecommunications Public Limited Company | Video coding |
| US7636759B1 (en) | 2008-09-29 | 2009-12-22 | Gene Fein | Rotating encryption in data forwarding storage |
| US7599997B1 (en) | 2008-08-01 | 2009-10-06 | Gene Fein | Multi-homed data forwarding storage |
| US7636761B1 (en) | 2008-09-29 | 2009-12-22 | Gene Fein | Measurement in data forwarding storage |
| US9203928B2 (en) | 2008-03-20 | 2015-12-01 | Callahan Cellular L.L.C. | Data storage and retrieval |
| US8458285B2 (en) | 2008-03-20 | 2013-06-04 | Post Dahl Co. Limited Liability Company | Redundant data forwarding storage |
| US8386585B2 (en) | 2008-04-25 | 2013-02-26 | Tajitshu Transfer Limited Liability Company | Real-time communications over data forwarding framework |
| US8452844B2 (en) | 2008-05-07 | 2013-05-28 | Tajitshu Transfer Limited Liability Company | Deletion in data file forwarding framework |
| US8340634B2 (en) | 2009-01-28 | 2012-12-25 | Headwater Partners I, Llc | Enhanced roaming services and converged carrier networks with device assisted services and a proxy |
| US9137739B2 (en) | 2009-01-28 | 2015-09-15 | Headwater Partners I Llc | Network based service policy implementation with network neutrality and user privacy |
| US8548428B2 (en) | 2009-01-28 | 2013-10-01 | Headwater Partners I Llc | Device group partitions and settlement platform |
| US8725123B2 (en) | 2008-06-05 | 2014-05-13 | Headwater Partners I Llc | Communications device with secure data path processing agents |
| US8346225B2 (en) | 2009-01-28 | 2013-01-01 | Headwater Partners I, Llc | Quality of service for device assisted services |
| US8402111B2 (en) | 2009-01-28 | 2013-03-19 | Headwater Partners I, Llc | Device assisted services install |
| US8898293B2 (en) | 2009-01-28 | 2014-11-25 | Headwater Partners I Llc | Service offer set publishing to device agent with on-device service selection |
| US8589541B2 (en) | 2009-01-28 | 2013-11-19 | Headwater Partners I Llc | Device-assisted services for protecting network capacity |
| US8626115B2 (en) | 2009-01-28 | 2014-01-07 | Headwater Partners I Llc | Wireless network service interfaces |
| US8924469B2 (en) | 2008-12-18 | 2014-12-30 | Headwater Partners I Llc | Enterprise access control and accounting allocation for access networks |
| US8275830B2 (en) | 2009-01-28 | 2012-09-25 | Headwater Partners I Llc | Device assisted CDR creation, aggregation, mediation and billing |
| US8924543B2 (en) | 2009-01-28 | 2014-12-30 | Headwater Partners I Llc | Service design center for device assisted services |
| US8832777B2 (en) | 2009-03-02 | 2014-09-09 | Headwater Partners I Llc | Adapting network policies based on device service processor configuration |
| US8635335B2 (en) | 2009-01-28 | 2014-01-21 | Headwater Partners I Llc | System and method for wireless network offloading |
| US8391834B2 (en) | 2009-01-28 | 2013-03-05 | Headwater Partners I Llc | Security techniques for device assisted services |
| US8406748B2 (en) | 2009-01-28 | 2013-03-26 | Headwater Partners I Llc | Adaptive ambient services |
| US8599678B2 (en) | 2008-07-10 | 2013-12-03 | Tajitshu Transfer Limited Liability Company | Media delivery in data forwarding storage network |
| US8370446B2 (en) | 2008-07-10 | 2013-02-05 | Tajitshu Transfer Limited Liability Company | Advertisement forwarding storage and retrieval network |
| US8055237B2 (en) | 2008-08-06 | 2011-11-08 | Bridgewater Systems Corp. | Usage measurement collection and analysis to dynamically regulate customer network usage |
| US8352635B2 (en) | 2008-09-29 | 2013-01-08 | Tajitshu Transfer Limited Liability Company | Geolocation assisted data forwarding storage |
| US8478823B2 (en) * | 2008-09-29 | 2013-07-02 | Tajitshu Transfer Limited Liability Company | Selective data forwarding storage |
| JP2010109418A (ja) | 2008-10-28 | 2010-05-13 | Sony Ericsson Mobile Communications Ab | 無線通信制御装置、無線通信システム、および無線通信端末 |
| EP2200319A1 (en) | 2008-12-10 | 2010-06-23 | BRITISH TELECOMMUNICATIONS public limited company | Multiplexed video streaming |
| US10248996B2 (en) | 2009-01-28 | 2019-04-02 | Headwater Research Llc | Method for operating a wireless end-user device mobile payment agent |
| US10779177B2 (en) | 2009-01-28 | 2020-09-15 | Headwater Research Llc | Device group partitions and settlement platform |
| US9392462B2 (en) | 2009-01-28 | 2016-07-12 | Headwater Partners I Llc | Mobile end-user device with agent limiting wireless data communication for specified background applications based on a stored policy |
| US10057775B2 (en) | 2009-01-28 | 2018-08-21 | Headwater Research Llc | Virtualized policy and charging system |
| US10715342B2 (en) | 2009-01-28 | 2020-07-14 | Headwater Research Llc | Managing service user discovery and service launch object placement on a device |
| US10798252B2 (en) | 2009-01-28 | 2020-10-06 | Headwater Research Llc | System and method for providing user notifications |
| US8893009B2 (en) | 2009-01-28 | 2014-11-18 | Headwater Partners I Llc | End user device that secures an association of application to service policy with an application certificate check |
| US8606911B2 (en) | 2009-03-02 | 2013-12-10 | Headwater Partners I Llc | Flow tagging for service policy implementation |
| US9351193B2 (en) | 2009-01-28 | 2016-05-24 | Headwater Partners I Llc | Intermediate networking devices |
| US8793758B2 (en) | 2009-01-28 | 2014-07-29 | Headwater Partners I Llc | Security, fraud detection, and fraud mitigation in device-assisted services systems |
| US9270559B2 (en) | 2009-01-28 | 2016-02-23 | Headwater Partners I Llc | Service policy implementation for an end-user device having a control application or a proxy agent for routing an application traffic flow |
| US10064055B2 (en) | 2009-01-28 | 2018-08-28 | Headwater Research Llc | Security, fraud detection, and fraud mitigation in device-assisted services systems |
| US10492102B2 (en) | 2009-01-28 | 2019-11-26 | Headwater Research Llc | Intermediate networking devices |
| US9565707B2 (en) | 2009-01-28 | 2017-02-07 | Headwater Partners I Llc | Wireless end-user device with wireless data attribution to multiple personas |
| US12166596B2 (en) | 2009-01-28 | 2024-12-10 | Disney Enterprises, Inc. | Device-assisted services for protecting network capacity |
| US12452377B2 (en) | 2009-01-28 | 2025-10-21 | Headwater Research Llc | Service design center for device assisted services |
| US10326800B2 (en) | 2009-01-28 | 2019-06-18 | Headwater Research Llc | Wireless network service interfaces |
| US9706061B2 (en) | 2009-01-28 | 2017-07-11 | Headwater Partners I Llc | Service design center for device assisted services |
| US10237757B2 (en) | 2009-01-28 | 2019-03-19 | Headwater Research Llc | System and method for wireless network offloading |
| US9571559B2 (en) | 2009-01-28 | 2017-02-14 | Headwater Partners I Llc | Enhanced curfew and protection associated with a device group |
| US9955332B2 (en) | 2009-01-28 | 2018-04-24 | Headwater Research Llc | Method for child wireless device activation to subscriber account of a master wireless device |
| US9647918B2 (en) | 2009-01-28 | 2017-05-09 | Headwater Research Llc | Mobile device and method attributing media services network usage to requesting application |
| US10783581B2 (en) | 2009-01-28 | 2020-09-22 | Headwater Research Llc | Wireless end-user device providing ambient or sponsored services |
| US9578182B2 (en) | 2009-01-28 | 2017-02-21 | Headwater Partners I Llc | Mobile device and service management |
| US12389218B2 (en) | 2009-01-28 | 2025-08-12 | Headwater Research Llc | Service selection set publishing to device agent with on-device service selection |
| US11218854B2 (en) | 2009-01-28 | 2022-01-04 | Headwater Research Llc | Service plan design, user interfaces, application programming interfaces, and device management |
| US9253663B2 (en) | 2009-01-28 | 2016-02-02 | Headwater Partners I Llc | Controlling mobile device communications on a roaming network based on device state |
| US10264138B2 (en) | 2009-01-28 | 2019-04-16 | Headwater Research Llc | Mobile device and service management |
| US11985155B2 (en) | 2009-01-28 | 2024-05-14 | Headwater Research Llc | Communications device with secure data path processing agents |
| US9954975B2 (en) | 2009-01-28 | 2018-04-24 | Headwater Research Llc | Enhanced curfew and protection associated with a device group |
| US10841839B2 (en) | 2009-01-28 | 2020-11-17 | Headwater Research Llc | Security, fraud detection, and fraud mitigation in device-assisted services systems |
| US9572019B2 (en) | 2009-01-28 | 2017-02-14 | Headwater Partners LLC | Service selection set published to device agent with on-device service selection |
| US12388810B2 (en) | 2009-01-28 | 2025-08-12 | Headwater Research Llc | End user device that secures an association of application to service policy with an application certificate check |
| US12432130B2 (en) | 2009-01-28 | 2025-09-30 | Headwater Research Llc | Flow tagging for service policy implementation |
| US9557889B2 (en) | 2009-01-28 | 2017-01-31 | Headwater Partners I Llc | Service plan design, user interfaces, application programming interfaces, and device management |
| US10200541B2 (en) | 2009-01-28 | 2019-02-05 | Headwater Research Llc | Wireless end-user device with divided user space/kernel space traffic policy system |
| US9980146B2 (en) | 2009-01-28 | 2018-05-22 | Headwater Research Llc | Communications device with secure data path processing agents |
| US9858559B2 (en) | 2009-01-28 | 2018-01-02 | Headwater Research Llc | Network service plan design |
| US11973804B2 (en) | 2009-01-28 | 2024-04-30 | Headwater Research Llc | Network service plan design |
| US8745191B2 (en) | 2009-01-28 | 2014-06-03 | Headwater Partners I Llc | System and method for providing user notifications |
| US9755842B2 (en) | 2009-01-28 | 2017-09-05 | Headwater Research Llc | Managing service user discovery and service launch object placement on a device |
| US8351898B2 (en) | 2009-01-28 | 2013-01-08 | Headwater Partners I Llc | Verifiable device assisted service usage billing with integrated accounting, mediation accounting, and multi-account |
| US10484858B2 (en) | 2009-01-28 | 2019-11-19 | Headwater Research Llc | Enhanced roaming services and converged carrier networks with device assisted services and a proxy |
| US8531978B2 (en) * | 2009-02-02 | 2013-09-10 | Level 3 Communications, Llc | Network cost analysis |
| WO2010088622A1 (en) | 2009-02-02 | 2010-08-05 | Level 3 Communications, Llc | Analysis of network traffic |
| EP2219343A1 (en) * | 2009-02-12 | 2010-08-18 | BRITISH TELECOMMUNICATIONS public limited company | Modification of explicit congestion notification (ECN) by skipping congestion experienced (CE) events |
| US8320246B2 (en) | 2009-02-19 | 2012-11-27 | Bridgewater Systems Corp. | Adaptive window size for network fair usage controls |
| US20100251259A1 (en) * | 2009-03-31 | 2010-09-30 | Howard Kevin D | System And Method For Recruitment And Management Of Processors For High Performance Parallel Processing Using Multiple Distributed Networked Heterogeneous Computing Elements |
| US9203629B2 (en) | 2009-05-04 | 2015-12-01 | Bridgewater Systems Corp. | System and methods for user-centric mobile device-based data communications cost monitoring and control |
| US8577329B2 (en) | 2009-05-04 | 2013-11-05 | Bridgewater Systems Corp. | System and methods for carrier-centric mobile device data communications cost monitoring and control |
| US20110077986A1 (en) * | 2009-09-30 | 2011-03-31 | Motorola, Inc. | Decision cost analysis for enterprise strategic decision management |
| US8837308B2 (en) * | 2009-11-04 | 2014-09-16 | Electronics And Telecommunications Research Institute | Power efficient link group communication apparatus and method |
| US8892068B2 (en) * | 2010-06-04 | 2014-11-18 | Verizon Patent And Licensing Inc. | Real-time usage monitoring for communication devices |
| US8982694B2 (en) * | 2010-09-01 | 2015-03-17 | Telefonaktiebolaget L M Ericsson (Publ) | Localized congestion exposure |
| US9154826B2 (en) | 2011-04-06 | 2015-10-06 | Headwater Partners Ii Llc | Distributing content and service launch objects to mobile devices |
| JP2013046336A (ja) * | 2011-08-26 | 2013-03-04 | Sony Corp | 情報処理装置、通信システムおよび情報処理方法 |
| US9100854B2 (en) * | 2011-12-06 | 2015-08-04 | T-Mobile Usa, Inc. | Quality of service application controller and user equipment application profiler |
| JP5821624B2 (ja) * | 2011-12-27 | 2015-11-24 | 富士通株式会社 | 通信制御装置、並列計算機システム及び通信制御方法 |
| JP6094047B2 (ja) * | 2012-02-13 | 2017-03-15 | ソニー株式会社 | 給電装置、受電装置、課金方法、およびプログラム |
| US9374476B2 (en) * | 2012-02-24 | 2016-06-21 | Alcatel Lucent | System and method for network access vending |
| US9596697B2 (en) | 2012-04-03 | 2017-03-14 | T-Mobile Usa, Inc. | Application controller for quality-of-service configuration of a telecommunication device radio |
| CN102946554B (zh) * | 2012-09-29 | 2016-06-15 | 合一网络技术(北京)有限公司 | 一种按照网络视频播放量进行计费分成的方法及其系统 |
| CN103716766A (zh) * | 2012-09-29 | 2014-04-09 | 华为技术有限公司 | 计费信息处理方法、装置及系统 |
| WO2014159862A1 (en) | 2013-03-14 | 2014-10-02 | Headwater Partners I Llc | Automated credential porting for mobile devices |
| US9432520B2 (en) | 2013-03-14 | 2016-08-30 | Tracfone Wireless, Inc. | Proxy-based usage tracking for a wireless device |
| US9471393B2 (en) | 2013-06-25 | 2016-10-18 | Amazon Technologies, Inc. | Burst-mode admission control using token buckets |
| US9553821B2 (en) | 2013-06-25 | 2017-01-24 | Amazon Technologies, Inc. | Equitable distribution of excess shared-resource throughput capacity |
| US10764185B2 (en) | 2013-06-25 | 2020-09-01 | Amazon Technologies, Inc. | Token-based policies burst-mode operations |
| KR101865318B1 (ko) * | 2013-06-25 | 2018-06-08 | 아마존 테크놀로지스, 인크. | 버스트 모드 제어 |
| US9473931B2 (en) * | 2013-07-17 | 2016-10-18 | Qualcomm Incorporated | Methods to achieve modem-assisted-service-classification functionality in a device with multiple subscriptions |
| CN104754650B (zh) * | 2013-12-26 | 2019-02-19 | 华为技术有限公司 | 网络的分流方法及装置 |
| US9705808B2 (en) * | 2014-03-21 | 2017-07-11 | Cisco Technology, Inc. | Flow aware buffer management for data center switches |
| CN105991299B (zh) * | 2015-03-04 | 2021-04-13 | 阿尔卡特朗讯 | 在sdn网络中对数据流进行计费的方法、装置与系统 |
| US10135921B2 (en) * | 2016-09-20 | 2018-11-20 | Keir Finlow-Bates | System and method for announcing cryptographic keys on a blockchain |
| US11070446B2 (en) * | 2017-10-24 | 2021-07-20 | At&T Intellectual Property I, L.P. | Intelligent network resource orchestration system and method for internet enabled device applications and services |
| CN112511323B (zh) * | 2019-09-16 | 2022-06-14 | 华为技术有限公司 | 处理网络拥塞的方法和相关装置 |
| US11438940B2 (en) * | 2020-04-21 | 2022-09-06 | At&T Intellectual Property I, L.P. | Selectively enabling identifier resources for connections in a fifth generation (5G) or other next generation wireless network |
| US11818050B2 (en) * | 2021-05-28 | 2023-11-14 | Microsoft Technology Licensing, Llc | Nonlinear traffic shaper with automatically adjustable cost parameters |
Family Cites Families (73)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA1235224A (en) * | 1983-08-19 | 1988-04-12 | Eiji Okamoto | Device for calculating a charge for a charged information signal with errors avoided in a report of the charge |
| US4756019A (en) | 1986-08-27 | 1988-07-05 | Edmund Szybicki | Traffic routing and automatic network management system for telecommunication networks |
| US5067149A (en) | 1987-10-05 | 1991-11-19 | Ambassador College | Telephone line communications control system with dynamic call streaming |
| US4896319A (en) * | 1988-03-31 | 1990-01-23 | American Telephone And Telegraph Company, At&T Bell Laboratories | Identification and authentication of end user systems for packet communications network services |
| JP2513049B2 (ja) | 1989-12-05 | 1996-07-03 | 日本電気株式会社 | 呼接続制御方式 |
| US5303297A (en) * | 1991-07-25 | 1994-04-12 | Motorola, Inc. | Dynamic pricing method and apparatus for communication systems |
| JPH066349A (ja) | 1992-06-22 | 1994-01-14 | Toshiba Corp | 通信システム |
| JPH0662035A (ja) | 1992-08-04 | 1994-03-04 | Hitachi Ltd | 通信網の経路制御方法 |
| DE4241434C2 (de) | 1992-12-09 | 2001-03-29 | Reinhard Georg | Verfahren zum Betreiben eines Fernmeldenetzes |
| JPH06237316A (ja) | 1992-12-28 | 1994-08-23 | Matsushita Electric Ind Co Ltd | Isdn通信処理装置 |
| JPH06318951A (ja) | 1993-01-07 | 1994-11-15 | Toshiba Corp | セル転送方法およびセル転送システム |
| JP2852845B2 (ja) | 1993-04-27 | 1999-02-03 | 株式会社田村電機製作所 | 公衆電話システム |
| US5631897A (en) | 1993-10-01 | 1997-05-20 | Nec America, Inc. | Apparatus and method for incorporating a large number of destinations over circuit-switched wide area network connections |
| US6434537B1 (en) | 1993-10-04 | 2002-08-13 | Lucent Technologies Inc. | Cellular telephone billing management system |
| EP0647055A1 (en) | 1993-10-04 | 1995-04-05 | AT&T Corp. | Cellular telephone billing management system |
| JP3287511B2 (ja) | 1994-02-17 | 2002-06-04 | 富士通株式会社 | データ交換網におけるデータ通信時の課金方法及び課金装置 |
| WO1995027385A2 (en) * | 1994-03-31 | 1995-10-12 | Telco Systems Inc | Method and apparatus for controlling transmission systems |
| US6005926A (en) | 1997-08-29 | 1999-12-21 | Anip, Inc. | Method and system for global communications network management |
| US6226365B1 (en) * | 1997-08-29 | 2001-05-01 | Anip, Inc. | Method and system for global communications network management and display of market-price information |
| US6144727A (en) | 1997-08-29 | 2000-11-07 | Anip, Inc. | Method and system for global telecommunications network management and display of market-price information |
| US5978456A (en) | 1994-10-25 | 1999-11-02 | Kokusai Denshin Denwa Co., Ltd. | Charging unit price determination/information apparatus and communication system having charging unit price information function |
| NZ513722A (en) * | 1994-12-02 | 2001-09-28 | British Telecomm | Communications terminal |
| EP0734144A3 (de) | 1995-03-20 | 1999-08-18 | Siemens Aktiengesellschaft | Verfahren und Anordnung zum Ermitteln der Benutzergebühr in einer Teilnehmereinrichtung |
| JPH08331123A (ja) | 1995-05-31 | 1996-12-13 | Mitsubishi Electric Corp | 通信課金処理方法 |
| US5799072A (en) | 1995-07-21 | 1998-08-25 | Callmanage | Telecommunications call management system |
| GB9608306D0 (en) | 1995-08-08 | 1996-06-26 | Williams Paul | Measurement apportionment system |
| US5852812A (en) | 1995-08-23 | 1998-12-22 | Microsoft Corporation | Billing system for a network |
| FI105746B (fi) * | 1995-09-29 | 2000-09-29 | Nokia Mobile Phones Ltd | Integroitu radioviestintäjärjestelmä |
| US5828737A (en) * | 1995-10-24 | 1998-10-27 | Telefonaktiebolaget L M Ericsson | Communications service billing based on bandwidth use |
| DE69533760T2 (de) | 1995-12-13 | 2005-11-03 | International Business Machines Corp. | Verbindungszulassungssteuerung in einem hochgeschwindigkeits-paketvermittlungsnetz |
| ES2242199T3 (es) * | 1995-12-19 | 2005-11-01 | Koninklijke Philips Electronics N.V. | Dispositivo para facturacion y servicio, en una red de telecomunicaciones, para proporcionar servicios de valor añadido. |
| US5732127A (en) | 1995-12-21 | 1998-03-24 | Erricson, Inc. | Real-time network for distributed telecommunication accounting systems |
| FI102232B1 (fi) | 1996-01-15 | 1998-10-30 | Nokia Telecommunications Oy | Pakettiradioverkko |
| GB2311439A (en) | 1996-03-21 | 1997-09-24 | Northern Telecom Ltd | Data communication network |
| WO1997040634A2 (de) * | 1996-04-18 | 1997-10-30 | Siemens Aktiengesellschaft | Verfahren zur flexiblen vergebührung bestehender verbindungen |
| US6154445A (en) | 1996-04-18 | 2000-11-28 | Bell Atlantic Network Services, Inc. | Telephony communication via varied redundant networks |
| NO304960B1 (no) | 1996-06-12 | 1999-03-08 | Ericsson Telefon Ab L M | FremgangsmÕte for unders°kelse av trafikkanalyse, spesielt i ATM (Asyncronous Transfer Mode) nett |
| US5873030A (en) * | 1996-06-28 | 1999-02-16 | Mci Communications Corporation | Method and system for nationwide mobile telecommunications billing |
| US5970477A (en) | 1996-07-15 | 1999-10-19 | Bellsouth Intellectual Property Management Corporation | Method and system for allocating costs in a distributed computing network |
| US5970126A (en) * | 1996-08-09 | 1999-10-19 | International Business Machines Corporation | Communication method and system |
| JPH1065684A (ja) | 1996-08-20 | 1998-03-06 | Fujitsu Ltd | 付加サービスの課金方法及び付加サービス通信システム |
| TW344054B (en) * | 1996-09-20 | 1998-11-01 | Ibm | System and method for measuring and accounting for data traffic on networks |
| FI113224B (fi) | 1996-11-11 | 2004-03-15 | Nokia Corp | Laskutuksen toteuttaminen tietoliikennejärjestelmässä |
| US6137869A (en) | 1997-09-16 | 2000-10-24 | Bell Atlantic Network Services, Inc. | Network session management |
| DE19709240B4 (de) | 1997-03-06 | 2005-05-04 | Deutsche Telekom Ag | Verfahren und Schaltungsanordnung zum Betreiben eines Telekommunikationsnetzwerkes |
| US6408174B1 (en) | 1997-05-13 | 2002-06-18 | Telefonaktiebolaget Lm Ericsson (Publ) | Communication method, system, and device for reducing processor load at tariff switch |
| US6134589A (en) | 1997-06-16 | 2000-10-17 | Telefonaktiebolaget Lm Ericsson | Dynamic quality control network routing |
| US6035281A (en) * | 1997-06-16 | 2000-03-07 | International Business Machines Corporation | System and method of multiparty billing for Web access |
| EP0898430B1 (en) * | 1997-08-15 | 2012-08-01 | Time Warner Cable, Inc. | Communications system |
| US5987430A (en) * | 1997-08-28 | 1999-11-16 | Atcom, Inc. | Communications network connection system and method |
| US6088659A (en) | 1997-09-11 | 2000-07-11 | Abb Power T&D Company Inc. | Automated meter reading system |
| WO1999014698A1 (en) | 1997-09-15 | 1999-03-25 | Maintenet Corporation | Electronic information network for inventory control and transfer |
| US6118768A (en) | 1997-09-26 | 2000-09-12 | 3Com Corporation | Apparatus and methods for use therein for an ISDN LAN modem utilizing browser-based configuration with adaptation of network parameters |
| US6108330A (en) | 1997-09-26 | 2000-08-22 | 3Com Corporation | Apparatus and methods for use therein for an ISDN LAN modem that selects among a plurality of DNS servers for responding to a DNS query |
| US6714979B1 (en) | 1997-09-26 | 2004-03-30 | Worldcom, Inc. | Data warehousing infrastructure for web based reporting tool |
| US6338046B1 (en) * | 1997-10-06 | 2002-01-08 | Nokia Telecommunications, Oy | System and method for determining charges for usage of a network connection |
| DE19750290A1 (de) | 1997-11-13 | 1999-05-20 | Ibm | Dynamisches Tarifvergleichs- und Auswahlsystem zur Ermittlung des günstigsten Telekommunikationsanbieters |
| US6618709B1 (en) | 1998-04-03 | 2003-09-09 | Enerwise Global Technologies, Inc. | Computer assisted and/or implemented process and architecture for web-based monitoring of energy related usage, and client accessibility therefor |
| US6246870B1 (en) * | 1998-04-30 | 2001-06-12 | Ericsson Inc. | Tariff management apparatus and methods for multiple-mode communications terminals |
| US6098878A (en) | 1998-04-30 | 2000-08-08 | Ericsson Inc. | Tariff management apparatus and method for communications terminals using smart cards |
| US6667956B2 (en) | 1998-05-01 | 2003-12-23 | Nortel Networks Limited | Multi-class network |
| AU770571B2 (en) | 1998-06-05 | 2004-02-26 | British Telecommunications Public Limited Company | Communications network |
| US6032132A (en) | 1998-06-12 | 2000-02-29 | Csg Systems, Inc. | Telecommunications access cost management system |
| US6278442B1 (en) | 1998-06-26 | 2001-08-21 | Research In Motion Limited | Hand-held electronic device with a keyboard optimized for use with the thumbs |
| US6625657B1 (en) * | 1999-03-25 | 2003-09-23 | Nortel Networks Limited | System for requesting missing network accounting records if there is a break in sequence numbers while the records are transmitting from a source device |
| US6556817B1 (en) * | 1999-12-13 | 2003-04-29 | Motorola, Inc. | Method and apparatus for selectively communicating in a wireless communication system based on varying time incremental costs of communication |
| JP2001188841A (ja) | 1999-12-28 | 2001-07-10 | Ibm Japan Ltd | 料金計算を行なうためのデータ処理システム |
| EP1264250A1 (en) | 2000-03-15 | 2002-12-11 | Aware, Inc. | Systems and methods for information management over a distributed network |
| US20020091574A1 (en) | 2000-05-30 | 2002-07-11 | Lefebvre Guy V. | Master universal tariff system and method |
| EP1290864A2 (en) | 2000-06-16 | 2003-03-12 | BRITISH TELECOMMUNICATIONS public limited company | Network charging |
| US6973038B1 (en) | 2000-07-28 | 2005-12-06 | Tactical Networks A.S. | System and method for real-time buying and selling of internet protocol (IP) transit |
| US7336613B2 (en) * | 2000-10-17 | 2008-02-26 | Avaya Technology Corp. | Method and apparatus for the assessment and optimization of network traffic |
| GB0410254D0 (en) * | 2004-05-07 | 2004-06-09 | British Telecomm | Processing of data in networks |
-
1999
- 1999-06-04 AU AU41581/99A patent/AU770571B2/en not_active Ceased
- 1999-06-04 AU AU41575/99A patent/AU4157599A/en not_active Abandoned
- 1999-06-04 CN CNB998088692A patent/CN1222135C/zh not_active Expired - Fee Related
- 1999-06-04 US US09/674,720 patent/US7426471B1/en not_active Expired - Fee Related
- 1999-06-04 EP EP99925195A patent/EP1119943B1/en not_active Expired - Lifetime
- 1999-06-04 US US09/674,717 patent/US7319673B1/en not_active Expired - Fee Related
- 1999-06-04 CA CA002333361A patent/CA2333361C/en not_active Expired - Fee Related
- 1999-06-04 AU AU41580/99A patent/AU763659B2/en not_active Ceased
- 1999-06-04 WO PCT/GB1999/001765 patent/WO1999065183A2/en not_active Ceased
- 1999-06-04 CA CA002333712A patent/CA2333712C/en not_active Expired - Fee Related
- 1999-06-04 WO PCT/GB1999/001773 patent/WO1999065185A2/en not_active Ceased
- 1999-06-04 EP EP99925201A patent/EP1123604B1/en not_active Expired - Lifetime
- 1999-06-04 WO PCT/GB1999/001772 patent/WO1999065184A2/en not_active Ceased
- 1999-06-04 JP JP2000554088A patent/JP4455758B2/ja not_active Expired - Fee Related
- 1999-06-04 CN CN998092789A patent/CN1217510C/zh not_active Expired - Fee Related
- 1999-06-04 CA CA002333362A patent/CA2333362C/en not_active Expired - Fee Related
- 1999-06-04 DE DE69919190T patent/DE69919190T2/de not_active Expired - Lifetime
- 1999-06-04 DE DE69934898T patent/DE69934898T2/de not_active Expired - Lifetime
- 1999-06-04 DE DE69933130T patent/DE69933130T2/de not_active Expired - Lifetime
- 1999-06-04 EP EP99925200A patent/EP1119944B1/en not_active Expired - Lifetime
- 1999-06-04 US US09/674,706 patent/US7747240B1/en not_active Expired - Fee Related
- 1999-06-04 CN CNB998088684A patent/CN100385851C/zh not_active Expired - Fee Related
- 1999-06-04 JP JP2000554089A patent/JP4386582B2/ja not_active Expired - Lifetime
- 1999-06-04 JP JP2000554090A patent/JP4361214B2/ja not_active Expired - Fee Related
-
2005
- 2005-09-01 US US11/216,349 patent/US7535853B2/en not_active Expired - Fee Related
Cited By (64)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7319673B1 (en) | 1998-06-05 | 2008-01-15 | British Telecommunications Plc | Communications network |
| US7426471B1 (en) | 1998-06-05 | 2008-09-16 | British Telecommunications Public Limited Company | Communications network |
| US7535853B2 (en) | 1998-06-05 | 2009-05-19 | British Telecommunications Public Limited Company | Communications network |
| US7747240B1 (en) | 1998-06-05 | 2010-06-29 | British Telecommunications Public Limited Company | Method of charging in a communications network |
| US10341243B2 (en) | 1998-12-08 | 2019-07-02 | Nomadix, Inc. | Systems and methods for providing content and services on a network system |
| US7689716B2 (en) | 1998-12-08 | 2010-03-30 | Nomadix, Inc. | Systems and methods for providing dynamic network authorization, authentication and accounting |
| US8266266B2 (en) | 1998-12-08 | 2012-09-11 | Nomadix, Inc. | Systems and methods for providing dynamic network authorization, authentication and accounting |
| US8713641B1 (en) | 1998-12-08 | 2014-04-29 | Nomadix, Inc. | Systems and methods for authorizing, authenticating and accounting users having transparent computer access to a network using a gateway device |
| US10110436B2 (en) | 1998-12-08 | 2018-10-23 | Nomadix, Inc. | Systems and methods for providing content and services on a network system |
| US10361802B1 (en) | 1999-02-01 | 2019-07-23 | Blanding Hovenweep, Llc | Adaptive pattern recognition based control system and method |
| US6574610B1 (en) * | 1999-10-19 | 2003-06-03 | Motorola, Inc. | Trusted elements within a distributed bandwidth system |
| FR2799910A1 (fr) * | 1999-10-19 | 2001-04-20 | Motorola Inc | Elements securises d'un systeme a largeur de bande repartie |
| WO2001030061A1 (en) * | 1999-10-19 | 2001-04-26 | Motorola Inc. | Trusted elements within a distributed bandwidth system |
| WO2001031883A3 (en) * | 1999-10-22 | 2002-06-27 | Nomadix Inc | Information and control console for use with a network gateway interface |
| US6789110B1 (en) | 1999-10-22 | 2004-09-07 | Nomadix, Inc. | Information and control console for use with a network gateway interface |
| WO2001069453A1 (en) * | 2000-03-15 | 2001-09-20 | Aware, Inc. | Systems and methods for information management over a distributed network |
| WO2001086933A3 (en) * | 2000-05-10 | 2002-08-01 | Hewlett Packard Co | Distributed pre-paid communications infrastructure |
| US8024270B2 (en) | 2000-05-10 | 2011-09-20 | Hewlett-Packard Development Company, L.P. | Operating a communications infrastructure on a pre-payment basis |
| EP1285369A4 (en) * | 2000-05-25 | 2006-01-18 | Lead Ip Systems Ltd | EXPERIENCE AND SYSTEM FOR CHARGING CALCULATION IN A NETWORK |
| WO2001099348A1 (en) * | 2000-06-15 | 2001-12-27 | British Telecommunications Public Limited Company | Protocol for multicast communication |
| US7400625B2 (en) | 2000-06-15 | 2008-07-15 | British Telecommunications Public Limited Company | Protocol for multicast communication |
| WO2001099400A3 (en) * | 2000-06-16 | 2002-08-01 | British Telecomm | Network charging |
| WO2002009408A1 (en) | 2000-07-21 | 2002-01-31 | Telemac Corporation | A method and system for data rating for wireless devices |
| EP1312201A4 (en) * | 2000-07-21 | 2008-04-23 | Telemac Corp | METHOD AND SYSTEM FOR DATA PROVISION FOR WIRELESS DEVICES |
| WO2002039671A3 (en) * | 2000-11-07 | 2002-11-28 | Casio Computer Co Ltd | Data communication terminal |
| US7403480B2 (en) | 2000-11-07 | 2008-07-22 | Casio Computer Co., Ltd. | Data communication terminal for conducting data communication for a set of objective data to be transmitted/received |
| US8583292B2 (en) | 2001-04-24 | 2013-11-12 | Eagle Harbor Holdings, Llc | System and method for restricting access to vehicle software systems |
| US6629033B2 (en) | 2001-04-24 | 2003-09-30 | Medius, Inc. | Open communication system for real-time multiprocessor applications |
| US11042385B2 (en) | 2001-04-24 | 2021-06-22 | Micropairing Technologies Llc. | Method and system for dynamic configuration of multiprocessor system |
| US10387166B2 (en) | 2001-04-24 | 2019-08-20 | Northwater Intellectual Property Fund L.P. 2 | Dynamic configuration of a multiprocessor system |
| US7146260B2 (en) | 2001-04-24 | 2006-12-05 | Medius, Inc. | Method and apparatus for dynamic configuration of multiprocessor system |
| US10298735B2 (en) | 2001-04-24 | 2019-05-21 | Northwater Intellectual Property Fund L.P. 2 | Method and apparatus for dynamic configuration of a multiprocessor health data system |
| US10102013B2 (en) | 2001-04-24 | 2018-10-16 | Northwater Intellectual Property Fund, L.P. 2 | Method and system for dynamic configuration of multiprocessor system |
| US9811354B2 (en) | 2001-04-24 | 2017-11-07 | Eagle Harbor Holdings, Llc | Home audio system for operating different types of audio sources |
| US9697015B2 (en) | 2001-04-24 | 2017-07-04 | Eagle Harbor Holdings, Llc | Vehicle audio application management system using logic circuitry |
| US9652257B2 (en) | 2001-04-24 | 2017-05-16 | Eagle Harbor Holdings, Llc | Vehicle safety system |
| US9645832B2 (en) | 2001-04-24 | 2017-05-09 | Dan A. Preston | Dynamic configuration of a home multiprocessor system |
| US6778073B2 (en) | 2001-06-26 | 2004-08-17 | Medius, Inc. | Method and apparatus for managing audio devices |
| US6615137B2 (en) | 2001-06-26 | 2003-09-02 | Medius, Inc. | Method and apparatus for transferring information between vehicles |
| US6792351B2 (en) | 2001-06-26 | 2004-09-14 | Medius, Inc. | Method and apparatus for multi-vehicle communication |
| WO2003013123A1 (en) * | 2001-07-30 | 2003-02-13 | Msafe Inc. | Prepaid communication system and method |
| EP1284551A1 (de) * | 2001-08-08 | 2003-02-19 | Siemens Aktiengesellschaft | Kennzeichnung der Dienstgüte einer Informationsübermittlung in einem Kommunikationsnetz |
| WO2003015350A1 (de) * | 2001-08-08 | 2003-02-20 | Siemens Aktiengesellschaft | Kennzeichnung der dienstgüte einer informationsübermittlung in einem kommunikationsnetz |
| US7436942B2 (en) | 2001-11-21 | 2008-10-14 | Telefonaktiebolaget Lm Ericsson (Publ) | System and method for charging in a communication network |
| US8020028B1 (en) | 2002-04-24 | 2011-09-13 | Eagle Harbor Holdings | Application management system for mobile devices |
| US7178049B2 (en) | 2002-04-24 | 2007-02-13 | Medius, Inc. | Method for multi-tasking multiple Java virtual machines in a secure environment |
| US6771208B2 (en) | 2002-04-24 | 2004-08-03 | Medius, Inc. | Multi-sensor system |
| WO2003100688A1 (en) * | 2002-05-24 | 2003-12-04 | Medius, Inc. | Method and apparatus for monitoring packet based communications in a mobile environment |
| WO2003105447A3 (de) * | 2002-06-05 | 2004-03-11 | Siemens Ag | Verfahren und system zum vergebühren von diensten |
| WO2004006501A1 (en) * | 2002-07-03 | 2004-01-15 | British Telecommunications Public Limited Company | Trust establishment for multi-party communications |
| EP1443437A1 (en) * | 2002-12-18 | 2004-08-04 | Alcatel | A method, a mobile telecommunication device, a base station, and a computer software product for guiding a user of a mobile when intending invoking a service |
| GB2399429A (en) * | 2003-03-14 | 2004-09-15 | Vodafone Plc | Providing cost data to users of a communication network |
| EP1465399A1 (en) * | 2003-04-02 | 2004-10-06 | Orange S.A. | Telecommunications apparatus and method |
| WO2005046196A1 (de) * | 2003-11-06 | 2005-05-19 | Giesecke & Devrient Gmbh | Verfahren zum betreiben eines mobilteils in einem mobilfunknetz |
| WO2006040020A1 (en) * | 2004-10-15 | 2006-04-20 | Siemens Aktiengesellschaft | Customer telecommunications apparatus providing billing information to network |
| US8046489B2 (en) | 2005-03-18 | 2011-10-25 | Nederlandse Organisatie Voor Toegepast-Natuurwetenschappelijk Onderzoek Tno | System and method for processing quality-of-service parameters in a communication network |
| WO2006098622A1 (en) * | 2005-03-18 | 2006-09-21 | Nederlandse Organisatie Voor Toegepast-Natuurwetenschappelijk Onderzoek Tno | System and method for processing quality-of-service parameters in a communication network |
| EP1703668A1 (en) * | 2005-03-18 | 2006-09-20 | Nederlandse Organisatie voor toegepast-natuurwetenschappelijk Onderzoek TNO | System for processing quality-of-service parameters in a communication network |
| US9358924B1 (en) | 2009-05-08 | 2016-06-07 | Eagle Harbor Holdings, Llc | System and method for modeling advanced automotive safety systems |
| US8792857B2 (en) | 2009-06-01 | 2014-07-29 | Alcatel Lucent | Notification of charging rate adjustments in regions of a mobile network to control bandwidth usage in the regions |
| WO2010141009A1 (en) | 2009-06-01 | 2010-12-09 | Alcatel-Lucent Usa Inc | Notification of charging rate adjustments in regions of a mobile network to control bandwidth usage in the regions |
| WO2012001108A3 (en) * | 2010-06-30 | 2012-08-16 | Runs Nv | Method for real-time monitoring of packet-based telecom services, and corresponding server and client device |
| WO2012001108A2 (en) | 2010-06-30 | 2012-01-05 | Runs Nv | Method for real-time monitoring of packet-based telecom services, and corresponding server and client device |
| EP2403226A1 (en) * | 2010-06-30 | 2012-01-04 | Runs NV | Method for real-time monitoring of packet-based telecom services, and corresponding server and client device |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7319673B1 (en) | Communications network | |
| Roberts | Internet traffic, QoS, and pricing | |
| US20030154174A1 (en) | Network charging | |
| Briscoe et al. | Commercial models for IP quality of service interconnect | |
| AU2004200250B2 (en) | Communications network | |
| Ruutu et al. | Simple integrated media access—a comprehensive service for future internet | |
| Stiller et al. | Charging of Multimedia Flows in an Integrated Services Network | |
| Stiller et al. | Pricing and qos | |
| Aguiar et al. | New services on an advanced internet | |
| Joshi et al. | Integrated quality of service and network management. | |
| Haddad et al. | 3-Tier service level agreement with automatic class upgrades | |
| Trajkovic | IP Marking, Metering, and Management | |
| Crossing et al. | D1. 3: Intermediate-Results based Protocol and Algorithm Specification (Public Part) | |
| Major et al. | Accounting Technologies for the Network Management |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 99808869.2 Country of ref document: CN |
|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZA ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW SD SL SZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 09674717 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1999925195 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 508342 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 41575/99 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2333362 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: IN/PCT/2000/756/CHE Country of ref document: IN |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
| AK | Designated states |
Kind code of ref document: A3 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZA ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A3 Designated state(s): GH GM KE LS MW SD SL SZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| WWP | Wipo information: published in national office |
Ref document number: 1999925195 Country of ref document: EP |
|
| WWG | Wipo information: grant in national office |
Ref document number: 1999925195 Country of ref document: EP |