US20200407445A1 - Anti-tigit antibodies - Google Patents
Anti-tigit antibodies Download PDFInfo
- Publication number
- US20200407445A1 US20200407445A1 US16/634,506 US201816634506A US2020407445A1 US 20200407445 A1 US20200407445 A1 US 20200407445A1 US 201816634506 A US201816634506 A US 201816634506A US 2020407445 A1 US2020407445 A1 US 2020407445A1
- Authority
- US
- United States
- Prior art keywords
- seq
- amino acid
- acid sequence
- comprises seq
- differences
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39541—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
- A61P31/22—Antivirals for DNA viruses for herpes viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2821—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against ICAM molecules, e.g. CD50, CD54, CD102
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/42—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins
- C07K16/4208—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- Cancer immunotherapy relies on the modulation of the immune system to increase recognition and response against tumour cells. Such modulation can be achieved by multiple mechanisms including the activation of co-stimulatory molecules present on immune cells or through the inhibition of co-inhibitory receptors.
- the activation of an immune response is a complex mechanism involving numerous cell populations like antigen-presenting cells important for the initiation of the antigen-specific response and effector cells responsible for tumour cell destruction.
- the mechanisms modulating the activity of effector cells like cytotoxic T cells are numerous and represent target of choice in the context of cancer immunotherapy.
- TIGIT T cell Immunoreceptor with Ig and ITIM domains
- WUCAM WUCAM
- VSIG9 Vstm3
- TIGIT is transmembrane protein containing a known ITIM domain in its intracellular portion, a transmembrane domain and an immunoglobulin variable domain on the extracellular part of the receptor.
- DNAM/CD226, a known co-stimulatory receptor also expressed on NK and T cells competes with TIGIT for CD155 and CD112 binding but with a lower affinity, which suggests a tight control of the activation of these effector cells to avoid uncontrolled cytotoxicity against normal cells expressing CD155 ligand.
- TIGIT expression is increased on tumour infiltrating lymphocytes (TILs) and in disease settings such as HIV infection.
- TIGIT expression marks exhausted T cells that have lower effector function as compared to TIGIT negative counterparts (Kurtulus et al. (2015) J. Clin. Invest. 276:112; Chew et al. (2016) Plos Pathogens. 12).
- Treg cells that express TIGIT show enhanced immunosuppressive activity as compared to TIGIT negative Treg population (Jobber et al. (2014) Immunity. 40:569).
- antagonistic anti-TIGIT antibody may help to turn-on the immune system and better fight cancer cells. It has been suggested that antagonistic anti-TIGIT antibodies in monotherapy or in combination with a-PD1 antibody could achieve strong anti-tumour efficacy in preclinical models (Johnston et al. (2014) Cancer Cell 26:1; WO2016/028656; US2016/0176963; US2016/0376365, all of which are incorporated herein by reference).
- antagonistic antibodies specific for TIGIT that could inhibit TIGIT receptor activity represent an opportunity to decrease the immunosuppressive effect associated with tumour microenvironments and thereby increase antitumor immune response against tumour cells.
- the present invention provides anti-TIGIT antibodies that can decrease the immunosuppressive effect of TIGIT-mediated signalling.
- antibodies or antigen binding fragments of the invention can inhibit TIGIT-mediated immunosuppression through prevention of ligand binding on T cells (conventional ⁇ T cells and non-conventional ⁇ T cells) and NK cells and/or depletion of TIGIT positive Treg cells, and/or by inducing internalisation of the TIGIT receptor.
- the present invention provides an isolated antibody or antigen binding fragment thereof which binds to human TIGIT and which comprises a heavy chain variable domain comprising a heavy chain CDR1 (HCDR1), a heavy chain CDR2 (HCDR2), and a heavy chain CDR3 (HCDR3) selected from the HCDR1, HCDR2 and HCDR3 sequences shown in FIG. 1 and which further comprises a light chain variable domain comprising a light chain CDR1 (LCDR1), a light chain CDR2 (LCDR2), and a light chain CDR3 (LCDR3) selected from the LCDR1, LCDR2, and LCDR3 sequences shown in FIG. 2 .
- HCDR1 heavy chain CDR1
- HCDR2 heavy chain CDR2
- HCDR3 heavy chain CDR3
- the antibody or antigen binding fragment comprises a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, wherein the combination is selected from the group of combinations formed by the HCDRs from each antibody in FIG. 1 taken with the LCDRs from the corresponding antibody in FIG. 2 .
- an antibody or antigen binding fragment according the invention may comprise a heavy chain variable domain having an amino acid sequence selected from the group consisting of: SEQ ID Nos: 211, 213, 215, 217, 219, 221, 223, 225, 227, 229, 231, 233, 235, 237, 239, 327, 329, and 331 and amino acid sequences exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto; and optionally comprise a light chain variable domain having an amino acid sequence selected from the group consisting of: the amino acid sequences of SEQ ID Nos: 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 328, 330, and 332 and amino acid sequences exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto.
- the antibody or antigen binding fragment comprises a combination of a heavy chain variable domain and a light chain variable domain, wherein the combination is selected from the group of combinations formed by the VH from each antibody in FIG. 5 , or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto, taken with the VL from the same antibody in FIG. 5 , or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto.
- the most-preferred antibodies and antigen binding fragments provided herein are those based on the CDRs or complete variable domains of antibody 31282 provided herein.
- these preferred anti-TIGIT antibodies and antigen binding fragments based on antibody 31282 have particularly surprising and advantageous properties. These properties include: a higher affinity for TIGIT expressed on CD8 T cells (from healthy donors or from cancer patients) compared to each previously described anti-TIGIT antibody tested; a better IC50 for competition with CD155/PVR compared to each previously described anti-TIGIT antibody tested; a better EC50 in T cell activation assays compared to each previously described anti-TIGIT antibody tested; and potently increasing activity in T cells from cancer patient peripheral blood, and importantly in tumour infiltrating lymphocytes.
- antibodies and antigen binding fragments according to the invention preferentially deplete Treg cells. That is, TIGIT-expressing Treg cells exposed to the provided anti-TIGIT antibodies undergo lysis to a greater proportion compared to conventional CD4 and CD8 T cells. This is surprising because conventional CD4 and CD8 T cells also express TIGIT, but do not undergo cell lysis to the same extent when contacted with the antibodies. It is further surprisingly shown that antibodies and antigen binding fragments according to the invention, especially those based on antibody 31282 not only promote conventional T cell pro-inflammatory activity, but also increase activity of non-conventional ⁇ T cells.
- an antibody or antigen binding fragment comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 wherein:
- HCDR1 comprises or consists of SEQ ID NO: 16 (YTFTSYYMH)
- HCDR2 comprises or consists of SEQ ID NO: 17 (VIGPSGASTSYAQKFQG)
- HCDR3 comprises or consists of SEQ ID NO: 18 (ARDHSDYWSGIMEV)
- LCDR1 comprises or consists of SEQ ID NO: 61 (RASQSVRSSYLA)
- LCDR2 comprises or consists of SEQ ID NO: 62 (GASSRAT)
- LCDR3 comprises or consists of SEQ ID NO: 63 (QQYFSPPWT).
- the heavy chain variable domain comprises or consists of an amino acid sequence according to SEQ ID NO: 221 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto
- the light chain variable domain comprises or consists of an amino acid sequence according to SEQ ID NO: 222 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto.
- the anti-TIGIT antibody is antibody 31282 described herein.
- the invention provides an isolated antibody or antigen binding fragment thereof, which cross-competes for binding to human TIGIT with an antibody according to the first aspect of the invention, for example an antibody exemplified herein.
- the invention provides an isolated antibody or antigen binding fragment thereof, which binds to the same epitope as an antibody according to the first aspect of the invention, for example an antibody exemplified herein.
- the invention provides an antibody or antigen binding fragment thereof which binds to an epitope of human TIGIT comprising TIGIT residues Q56, and I109, optionally comprising residues Q56, N58 and I109.
- an antibody or antigen binding fragment thereof which binds to an epitope of human TIGIT comprising TIGIT residues Q56, N58, E60, 168, L73, H76, and I109.
- the antibody or antigen binding fragment thereof binds to an epitope of human TIGIT consisting of TIGIT residues Q56, N58, E60, 168, L73, H76, and I109.
- the invention provides an isolated antibody or antigen binding fragment thereof which binds to human TIGIT and which does not compete with CD155 for TIGIT binding.
- the antibody or antigen binding fragment which binds to human TIGIT and which does not compete with CD155 for TIGIT binding comprises HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 wherein HCDR1 comprises or consists of SEQ ID NO: 280, HCDR2 comprises or consists of SEQ ID NO: 281, HCDR3 comprises or consists of SEQ ID NO: 282, and LCDR1 comprises or consists of SEQ ID NO: 292, LCDR2 comprises or consists of SEQ ID NO: 293, and LCDR3 comprises or consists of SEQ ID NO: 294.
- the heavy chain variable domain comprises or consists of the amino acid sequence shown as SEQ ID NO: 333 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto
- the light chain variable domain comprises or consists of the amino acid sequence shown as SEQ ID NO: 334 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto.
- the antibody which binds to human TIGIT and which does not compete with CD155 for TIGIT binding comprises a heavy chain variable domain and a light chain variable domain wherein HCDR1 comprises SEQ ID NO: 353, HCDR2 comprises SEQ ID NO: 354, HCDR3 comprises SEQ ID NO: 355, and LCDR1 comprises SEQ ID NO: 356, LCDR2 comprises SEQ ID NO: 357, and LCDR3 comprises SEQ ID NO: 358.
- the heavy chain variable domain may comprise the amino acid sequence shown as SEQ ID NO: 367 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto
- the light chain variable domain may comprise the amino acid sequence shown as SEQ ID NO: 368 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto.
- the invention provides an isolated anti-TIGIT antibody or antigen binding fragment thereof which preferentially depletes TIGIT-expressing Treg cells, optionally wherein the antibody or antigen binding fragment is an antibody or antigen binding fragment according to the first aspect of the invention, for example an antibody exemplified herein.
- the invention provides an affinity variant of an antibody according to other aspects of the invention, for example an antibody exemplified herein.
- the invention provides an isolated polynucleotide or combination of isolated polynucleotides encoding an antibody or antigen binding fragment according to any other aspect of the invention, for example an antibody exemplified herein.
- the invention provides an isolated polynucleotide encoding a VH and/or a VL domain of an anti-TIGIT antibody, wherein the polynucleotide comprises one or more sequences selected from the group consisting of SEQ ID Nos: 241-270, 335-342 and 369-370.
- the invention provides an expression vector comprising a polynucleotide or combination of polynucleotides according to the invention operably linked to regulatory sequences which permit expression of the antigen binding polypeptide in a host cell or cell-free expression system.
- the invention provides a host cell or cell-free expression system containing an expression vector according to the invention.
- the invention provides a method of producing a recombinant antibody or antigen binding fragment thereof which comprises culturing a host cell or cell free expression system according to the invention under conditions which permit expression of the antibody or antigen binding fragment and recovering the expressed antibody or antigen binding fragment.
- the invention provides a pharmaceutical composition
- a pharmaceutical composition comprising an antibody or antigen binding fragment according to the invention, for example an antibody exemplified herein, and at least one pharmaceutically acceptable carrier or excipient.
- the invention provides an antibody or antigen-binding fragment according to the invention or pharmaceutical composition according to the invention for use in therapy.
- the invention provides an antibody or antigen-binding fragment according to the invention (for example an antibody exemplified herein) or pharmaceutical composition according to the invention for use in a method of treating cancer.
- an antibody or antigen-binding fragment according to the invention for example an antibody exemplified herein
- pharmaceutical composition according to the invention for use in a method of treating cancer.
- the invention provides an antibody or antigen-binding fragment according to the invention (for example an antibody exemplified herein) or pharmaceutical composition according to the invention for use in a method of treating viral infection, optionally CMV infection.
- an antibody or antigen-binding fragment according to the invention for example an antibody exemplified herein
- pharmaceutical composition according to the invention for use in a method of treating viral infection, optionally CMV infection.
- the invention provides a method of treating cancer in a subject comprising administering an effective amount of an antibody or antigen-binding fragment according to the invention (for example an antibody exemplified herein) or pharmaceutical composition according to the invention to the subject, thereby treating the cancer.
- an antibody or antigen-binding fragment according to the invention for example an antibody exemplified herein
- pharmaceutical composition according to the invention for example an antibody exemplified herein
- a method of treating viral infection in a subject comprising administering an effective amount of an antibody or antigen-binding fragment according to the invention or pharmaceutical composition according to the invention to the subject, thereby treating the viral infection.
- the viral infection is CMV infection.
- a method of promoting T cell activity comprising contacting a population of T cells with an antibody or antigen binding fragment according to the invention. In certain embodiments the method promotes ⁇ T cell activity. In certain embodiments the method promotes ⁇ T cell activity. In certain embodiments the method is performed in vitro. In certain embodiments the method is performed in vivo, for example in a human subject.
- a method according to the invention or an antibody or antigen-binding fragment or pharmaceutical composition for use in a method according to the invention, wherein the method further comprises administration of one or more additional therapeutic agents.
- the one or more additional agents are selected from: a chemotherapeutic agent, an anti-PD1 antibody, an anti-PD-L1 antibody, an anti-41BB antibody, an anti-OX40 antibody, an anti-GITR antibody, and an anti-ICOS antibody.
- a combination comprising an anti-TIGIT antibody or antigen binding fragment thereof and one or more of a chemotherapeutic agent, an anti-PD1 antibody, an anti-PD-L1 antibody, an anti-41BB antibody, an anti-OX40 antibody, an anti-GITR antibody, and an anti-ICOS antibody.
- a combination according to the invention for use in therapy.
- a combination according to the invention for use in a method of treating cancer or for use in a method of treating viral infection is provided.
- the anti-TIGIT antibody or antigen binding fragment thereof is an antibody of the invention or an antigen binding fragment thereof.
- any subject to be treated is a human subject.
- cells e.g. T cells
- antibodies according to the invention are human cells (e.g. human T cells).
- any preferred embodiment described can optionally be used in combination with one or more of all other preferred embodiments.
- FIG. 1 Table providing heavy chain variable domain (VH) complementarity determining region (CDR) sequences of antibodies of the invention.
- VH variable domain
- CDR complementarity determining region
- FIG. 2 Table providing light chain variable domain (VL) CDR sequences of antibodies of the invention.
- FIG. 3 Table providing heavy chain variable domain (VH) framework (FR) sequences of antibodies of the invention.
- FIG. 4 Table providing light chain variable domain (VL) framework (FR) sequences of antibodies of the invention.
- FIG. 5 Table providing heavy chain variable domain (VH) and light chain variable domain (VL) amino acid sequences of antibodies of the invention.
- FIG. 6 Table providing sequences of polynucleotides encoding VH and VL domains of antibodies according to the invention.
- FIG. 7 Graph showing the results of a competition assay between hCD155 and anti-TIGIT antibody for binding to Jurkat-hTIGIT.
- FIG. 8A Graph showing the proportion of TIGIT positive cells within specific T cell populations of PBMC from 7 healthy human donors.
- FIG. 8B Graph showing the proportion of TIGIT positive cells within different immune populations of PBMC from 7 healthy human donors.
- FIG. 9 Graph showing the results of a binding assay of anti-TIGIT antibody on Jurkat-hTIGIT.
- FIG. 10A and FIG. 10B Graphs showing the results of a binding assay of anti-TIGIT antibody on primary CD8+ T cells from human healthy PBMCs.
- FIG. 10C Graph showing the results of a binding assay of anti-TIGIT antibody on primary memory CD8+ T cells and Treg from human healthy PBMCs.
- FIGS. 11A-11B Graphs showing the results of a binding assay of anti-TIGIT antibody on primary CD8+ T cells from cynomolgus healthy PBMCs.
- FIGS. 12A-12C Graphs showing the effect of anti-TIGIT antibodies in a CHO-TCR-CD155 and Jurkat-hTIGIT Bioassay.
- FIGS. 13A-13C Graphs showing the effect of anti-TIGIT antibodies to increase IFNg secretion in a functional assay on human primary CD8 T cells from healthy donors activated with CHO-TCR-CD155 cells.
- FIG. 14 Histogram plots showing the effect of anti-TIGIT antibody to increase IFNg secretion in a functional assay on human primary CD8+ TILs from an ovarian ascites activated with CHO-TCR-CD155 cells.
- FIG. 15A Graph showing the results of a competition assay between mouse CD155 and anti-TIGIT antibody for binding to Jurkat-mTIGIT.
- FIG. 15B Graph showing the effect of anti-TIGIT antibody to increase IFNg secretion in a functional assay on mouse OT-1 T cells.
- FIG. 15C Graph showing the effect of anti-TIGIT antibody to increase cytotoxicity in a functional assay on mouse OT-1 T cells.
- FIG. 16A Graph showing the anti-tumor efficacy of anti-TIGIT antibody in monotherapy in a CT26 tumor model.
- FIG. 16B and FIG. 16C Graphs showing the anti-tumor efficacy of anti-TIGIT antibody in combination with anti-PD1 in a CT26 tumor model.
- FIG. 17A Graph showing the isotype dependant anti-tumor efficacy of anti-TIGIT antibody in monotherapy in a CT26 tumor model.
- FIG. 17B Graph showing the isotype dependant anti-tumor efficacy of anti-TIGIT antibody in combination with anti-PD1 in a CT26 tumor model.
- FIG. 18A and FIG. 18G Graphs showing the modulation of proportion of Treg cell within total CD4+ T cell population in CT26 tumor treated with anti-TIGIT antibody in monotherapy or combination with anti-PD1.
- FIG. 18B and FIG. 18H Graphs showing the modulation of proportion of CD8+ T cell within total CD45+ population in CT26 tumor treated with anti-TIGIT antibody in monotherapy or combination with anti-PD1.
- FIG. 18C and FIG. 18I Graphs showing the modulation of CD8+/Treg T cell ratio in CT26 tumor treated with anti-TIGIT antibody in monotherapy or combination with anti-PD1.
- FIG. 18J Graph showing the modulation of IFNg secreting CD4+ T cells in CT26 tumor treated with anti-TIGIT antibody in monotherapy or combination with anti-PD1.
- FIG. 18E Graph showing the modulation of IFNg secreting CD8+ T cells in CT26 tumor treated with anti-TIGIT antibody.
- FIG. 18L and FIG. 18F Graphs showing the ratio of IFNg/IL-10 secreting CD4+ T cells in CT26 tumor treated with anti-TIGIT antibody in monotherapy or combination with anti-PD1.
- FIG. 18K Graph showing the modulation of IL-10 secreting CD4+ T cells in CT26 tumor treated by anti-TIGIT antibody in combination with anti-PD1 antibody.
- FIG. 19A Volcano plot showing the effect of anti-TIGIT antibody treatment to modulate gene expression in CT26 tumor and measured by NanoString analysis.
- FIG. 19B Box plot showing the modulation of cytotoxic score in CT26 tumor treated with anti-TIGIT antibody in monotherapy or combination with anti-PD1.
- FIG. 19C Box plot showing the modulation of CD8+ T cell score in CT26 tumor treated with anti-TIGIT antibody in monotherapy or combination with anti-PD1.
- FIG. 20A Histogram plots showing the proportion of TIGIT+CD4+, CD8+ T cell and Treg populations in PBMC from human healthy volunteers.
- FIG. 20B Graph showing the in vitro cytotoxicity effect of anti-TIGIT antibody on conventional CD4+, CD8+ T cell and Treg populations in PBMC from human healthy volunteers.
- FIG. 21 Graph showing the ex-vivo cytotoxicity effect of anti-TIGIT antibody on conventional CD4+, CD8+ T cell and Treg populations in CT26 tumour.
- FIG. 22A Graph showing the results of a binding assay of anti-TIGIT antibody clones on Jurkat-hTIGIT cells.
- FIG. 22B Graph showing the results of a binding assay of anti-TIGIT antibody clones on primary CD8+ T cells from healthy human PBMCs.
- FIG. 22C Graph showing the results of a binding assay of anti-TIGIT antibody clones on primary CD8+ T cells from cancer patients PBMCs.
- FIG. 23 Graph showing the results of a competition assay between human CD155 and anti-TIGIT antibody clones for binding to Jurkat-hTIGIT.
- FIGS. 24A-C Graphs showing the functional characterization of antagonist a-TIGIT clones.
- FIG. 24A Graph showing the effect of anti-TIGIT antibodies in a functional assay using Jurkat-hTIGIT effector cells (Luciferase reporter assay).
- FIG. 24B Graph showing the effect of anti-TIGIT antibodies in a functional assay measuring IFNg secretion by human primary CD8+ T cell from healthy volunteers.
- FIG. 24C Graph showing the effect of anti-TIGIT antibody clone 31282 in functional assay measuring IFNg secretion by cancer patient CD3+ T cell from PBMC.
- FIG. 24D Graph showing the effect of anti-TIGIT antibody clone 31282 in functional assay measuring intracellular cytokine staining in cancer patient TILs or PBMCs.
- FIG. 25 Cytotoxic activity of a-TIGIT clone 31282 on total memory CD4+ or CD8+ T cells and Treg populations in PBMC from cancer patient.
- FIGS. 26A-26B Graphs showing the characterization of TIGIT expression on immune populations from cancer patients.
- FIG. 26A Frequency of TIGIT expression on immune populations from cancer patient PBMC and TILs.
- FIG. 26B Absolute quantification of TIGIT expression on immune populations from cancer patient PBMC and TILs.
- FIG. 27A Structure of the Fab:TIGIT complex shown as ribbon diagram; FIG. 27B Full binding interface between clone 31282 and TIGIT; FIG. 27C Binding interface between clone 31282 and TIGIT showing contacted residues.
- FIG. 28 Competition assay between anti-TIGIT clones 31282 and 32959.
- FIG. 29 Measure of plasma concentration of anti-TIGIT clone 31282 after i.v. injection of a single dose at 0.1 mg/kg (top row), 1 mg/kg (middle row) or 10 mg/kg (bottom row) in Cynomolgus monkey.
- FIGS. 30A-30B Plots showing the characterization of TIGIT expression on malignant and normal CD4+ T cell populations from patient with Sézary Syndrome.
- FIG. 30A Gating strategy to separate malignant and normal CD4+ T cells.
- FIG. 30B MFI for TIGIT staining on the 2 distinct populations.
- FIGS. 31A-31B Plots showing the characterization of TIGIT expression on malignant and normal B cell populations from patient with CLL.
- FIG. 31A Gating strategy to separate malignant and normal B cells.
- FIG. 31B MFI for TIGIT staining on the 2 distinct populations.
- FIGS. 32A-32C Graph showing the tumor growth curves in mice inoculated with EL4-mTIGIT tumors.
- FIG. 32A Median tumor growth curves.
- FIG. 32B Individual tumor growth curves in mice treated with hIgG1 isotype control antibody.
- FIG. 32C Individual tumor growth curves in mice treated with mouse surrogate antagonist a-TIGIT antibody (hIgG1).
- FIGS. 32D-32F Graph showing the tumor growth curves in mice inoculated with EL4-GFP tumors.
- FIG. 32D Median tumor growth curves.
- FIG. 32E Individual tumor growth curves in mice treated with hIgG1 isotype control antibody.
- FIG. 32F Individual tumor growth curves in mice treated with surrogate antagonist a-TIGIT (hIgG1).
- FIGS. 33A-33D Graphs showing the tumor growth curves in mice inoculated with CT26 tumors.
- FIG. 33A Median and individual tumor growth curves for mice treated with anti-TIGIT and anti-4-1BB antibodies.
- FIG. 33B Median and individual tumor growth curves for mice treated with anti-TIGIT and anti-OX-40 antibodies.
- FIG. 33C Median and individual tumor growth curves for mice treated with anti-TIGIT and anti-GITR antibodies.
- FIG. 33D Median and individual tumor growth curves for mice treated with anti-TIGIT and anti-ICOS antibodies.
- FIG. 34A-34C Graphs showing the effect of anti-TIGIT antibodies on ⁇ T cells.
- FIG. 34A Median proportion of TIGIT positive cells and TIGIT MFI signal within V ⁇ 2- ⁇ T cell populations of PBMC from CMV positive and negative human donors.
- FIG. 34B Graph showing the activity of anti-TIGIT Ab to increase IFNg secretion in a functional assay on isolated human primary V ⁇ 1+ ⁇ T cells.
- FIG. 34C Graph showing the activity of anti-TIGIT Ab to increase IFNg secretion in a functional assay on total PBMC.
- immunoglobulin includes a polypeptide having a combination of two heavy and two light chains whether or not it possesses any relevant specific immunoreactivity.
- Antibodies refers to such assemblies which have significant known specific immunoreactive activity to an antigen of interest (e.g. TIGIT).
- TIGIT antibodies or “anti-TIGIT antibodies” are used herein to refer to antibodies which exhibit immunological specificity for TIGIT protein.
- Antibodies and immunoglobulins comprise light and heavy chains, with or without an interchain covalent linkage between them. Basic immunoglobulin structures in vertebrate systems are relatively well understood.
- immunoglobulin comprises five distinct classes of antibody that can be distinguished biochemically. Although all five classes of antibodies are within the scope of the present invention, the following discussion will generally be directed to the IgG class of immunoglobulin molecules.
- immunoglobulins comprise two identical light polypeptide chains of molecular weight approximately 23,000 Daltons, and two identical heavy chains of molecular weight 53,000-70,000. The four chains are joined by disulfide bonds in a “Y” configuration wherein the light chains bracket the heavy chains starting at the mouth of the “Y” and continuing through the variable region.
- the light chains of an antibody are classified as either kappa or lambda ( ⁇ , ⁇ ). Each heavy chain class may be bound with either a kappa or lambda light chain.
- the light and heavy chains are covalently bonded to each other, and the “tail” portions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are generated by B cells or genetically engineered host cells.
- the amino acid sequences run from an N-terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain.
- heavy chains are classified as gamma, mu, alpha, delta, or epsilon, ( ⁇ , ⁇ , ⁇ , ⁇ , ⁇ ) with some subclasses among them (e.g., ⁇ 1- ⁇ 4). It is the nature of this chain that determines the “class” of the antibody as IgG, IgM, IgA, IgD or IgE, respectively.
- the immunoglobulin subclasses e.g., IgG1, IgG2, IgG3, IgG4, IgA1, etc. are well characterized and are known to confer functional specialization. Modified versions of each of these classes and isotypes are readily discernible to the skilled artisan in view of the instant disclosure and, accordingly, are within the scope of the instant invention.
- variable region of an antibody allows the antibody to selectively recognize and specifically bind epitopes on antigens. That is, the VL domain and VH domain of an antibody combine to form the variable region that defines a three dimensional antigen binding site.
- This quaternary antibody structure forms the antigen binding site present at the end of each arm of the Y. More specifically, the antigen binding site is defined by three complementary determining regions (CDRs) on each of the VH and VL chains.
- CDRs complementary determining regions
- TIGIT protein or “TIGIT antigen” or “TIGIT” are used interchangeably and refer to the human T-cell immunoreceptor (GenBank accession number: NM_173799) that binds the poliovirus receptor (PVR—also known as CD155).
- PVR also known as CD155
- TIGIT is also known as VSIG9, VSTM3, or WUCAM.
- Reference to TIGIT includes the native human TIGIT protein naturally expressed in the human host and/or on the surface of human cultured cell lines, as well as recombinant forms and fragments thereof and also naturally occurring mutant forms.
- binding site comprises a region of a polypeptide which is responsible for selectively binding to a target antigen of interest (e.g. TIGIT). Binding domains comprise at least one binding site. Exemplary binding domains include an antibody variable domain.
- the antibody molecules of the invention may comprise a single binding site or multiple (e.g., two, three or four) binding sites.
- the term “derived from” a designated protein refers to the origin of the polypeptide.
- the polypeptide or amino acid sequence which is derived from a particular starting polypeptide is a CDR sequence or sequence related thereto.
- the amino acid sequence which is derived from a particular starting polypeptide is not contiguous. For example, in one embodiment, one, two, three, four, five, or six CDRs are derived from a starting antibody.
- the polypeptide or amino acid sequence which is derived from a particular starting polypeptide or amino acid sequence has an amino acid sequence that is essentially identical to that of the starting sequence, or a portion thereof wherein the portion consists of at least 3-5 amino acids, at least 5-10 amino acids, at least 10-20 amino acids, at least 20-30 amino acids, or at least 30-50 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the starting sequence.
- the one or more CDR sequences derived from the starting antibody are altered to produce variant CDR sequences, e.g. affinity variants, wherein the variant CDR sequences maintain TIGIT binding activity.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains
- a nonessential amino acid residue in an immunoglobulin polypeptide may be replaced with another amino acid residue from the same side chain family.
- a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
- the term “heavy chain portion” includes amino acid sequences derived from the constant domains of an immunoglobulin heavy chain.
- a polypeptide comprising a heavy chain portion comprises at least one of: a CH1 domain, a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant or fragment thereof.
- an antibody or antigen binding fragment of the invention may comprise the Fc portion of an immunoglobulin heavy chain (e.g., a hinge portion, a CH2 domain, and a CH3 domain).
- an antibody or antigen binding fragment of the invention may lack at least a portion of a constant domain (e.g., all or part of a CH2 domain).
- a constant domain e.g., all or part of a CH2 domain.
- at least one, and preferably all, of the constant domains are derived from a human immunoglobulin heavy chain.
- the heavy chain portion comprises a fully human hinge domain.
- the heavy chain portion comprises a fully human Fc portion (e.g., hinge, CH2 and CH3 domain sequences from a human immunoglobulin).
- the constituent constant domains of the heavy chain portion are from different immunoglobulin molecules.
- a heavy chain portion of a polypeptide may comprise a CH2 domain derived from an IgG1 molecule and a hinge region derived from an IgG3 or IgG4 molecule.
- the constant domains are chimeric domains comprising portions of different immunoglobulin molecules.
- a hinge may comprise a first portion from an IgG1 molecule and a second portion from an IgG3 or IgG4 molecule.
- the constant domains of the heavy chain portion may be modified such that they vary in amino acid sequence from the naturally occurring (wild-type) immunoglobulin molecule. That is, the polypeptides of the invention disclosed herein may comprise alterations or modifications to one or more of the heavy chain constant domains (CH1, hinge, CH2 or CH3) and/or to the light chain constant region domain (CL). Exemplary modifications include additions, deletions or substitutions of one or more amino acids in one or more domains.
- variable region and “variable domain” are used interchangeably and are intended to have equivalent meaning.
- variable refers to the fact that certain portions of the variable domains VH and VL differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its target antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called “hypervariable loops” in each of the VL domain and the VH domain which form part of the antigen binding site.
- the first, second and third hypervariable loops of the VLambda light chain domain are referred to herein as L1( ⁇ ), L2( ⁇ ) and L3( ⁇ ) and may be defined as comprising residues 24-33 (L1( ⁇ ), consisting of 9, 10 or 11 amino acid residues), 49-53 (L2( ⁇ ), consisting of 3 residues) and 90-96 (L3( ⁇ ), consisting of 5 residues) in the VL domain (Morea et al., Methods 20, 267-279, 2000).
- the first, second and third hypervariable loops of the VKappa light chain domain are referred to herein as L1( ⁇ ), L2( ⁇ ) and L3( ⁇ ) and may be defined as comprising residues 25-33 (L1( ⁇ ), consisting of 6, 7, 8, 11, 12 or 13 residues), 49-53 (L2( ⁇ ), consisting of 3 residues) and 90-97 (L3( ⁇ ), consisting of 6 residues) in the VL domain (Morea et al., Methods 20, 267-279, 2000).
- the first, second and third hypervariable loops of the VH domain are referred to herein as H1, H2 and H3 and may be defined as comprising residues 25-33 (H1, consisting of 7, 8 or 9 residues), 52-56 (H2, consisting of 3 or 4 residues) and 91-105 (H3, highly variable in length) in the VH domain (Morea et al., Methods 20, 267-279, 2000).
- L1, L2 and L3 respectively refer to the first, second and third hypervariable loops of a VL domain, and encompass hypervariable loops obtained from both VKappa and VLambda isotypes.
- H1, H2 and H3 respectively refer to the first, second and third hypervariable loops of the VH domain, and encompass hypervariable loops obtained from any of the known heavy chain isotypes, including ⁇ , ⁇ , ⁇ , ⁇ or ⁇ .
- the hypervariable loops L1, L2, L3, H1, H2 and H3 may each comprise part of a “complementarity determining region” or “CDR”, as defined below.
- CDR complementarity determining region
- the terms “hypervariable loop” and “complementarity determining region” are not strictly synonymous, since the hypervariable loops (HVs) are defined on the basis of structure, whereas complementarity determining regions (CDRs) are defined based on sequence variability (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991) and the limits of the HVs and the CDRs may be different in some VH and VL domains.
- the CDRs of the VL and VH domains can typically be defined as comprising the following amino acids: residues 24-34 (LCDR1), 50-56 (LCDR2) and 89-97 (LCDR3) in the light chain variable domain, and residues 31-35 or 31-35b (HCDR1), 50-65 (HCDR2) and 95-102 (HCDR3) in the heavy chain variable domain; (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991).
- the HVs may be comprised within the corresponding CDRs and references herein to the “hypervariable loops” of VH and VL domains should be interpreted as also encompassing the corresponding CDRs, and vice versa, unless otherwise indicated.
- variable domains The more highly conserved portions of variable domains are called the framework region (FR), as defined below.
- the variable domains of native heavy and light chains each comprise four FRs (FR1, FR2, FR3 and FR4, respectively), largely adopting a ⁇ -sheet configuration, connected by the three hypervariable loops.
- the hypervariable loops in each chain are held together in close proximity by the FRs and, with the hypervariable loops from the other chain, contribute to the formation of the antigen-binding site of antibodies.
- Structural analysis of antibodies revealed the relationship between the sequence and the shape of the binding site formed by the complementarity determining regions (Chothia et al., J. Mol. Biol.
- CDR complementarity determining region
- CDR is a CDR as defined by Kabat based on sequence comparisons.
- variable region includes the amino acid residues that are part of the variable region, but are not part of the CDRs (e.g., using the Kabat definition of CDRs). Therefore, a variable region framework is between about 100-120 amino acids in length but includes only those amino acids outside of the CDRs.
- the framework regions for the light chain are similarly separated by each of the light claim variable region CDRs.
- the framework region boundaries are separated by the respective CDR termini as described above. In preferred embodiments the CDRs are as defined by Kabat.
- the six CDRs present on each monomeric antibody are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen binding site as the antibody assumes its three dimensional configuration in an aqueous environment.
- the remainder of the heavy and light variable domains show less inter-molecular variability in amino acid sequence and are termed the framework regions.
- the framework regions largely adopt a ⁇ -sheet conformation and the CDRs form loops which connect, and in some cases form part of, the ⁇ -sheet structure. Thus, these framework regions act to form a scaffold that provides for positioning the six CDRs in correct orientation by inter-chain, non-covalent interactions.
- the antigen binding site formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non-covalent binding of the antibody to the immunoreactive antigen epitope.
- the position of CDRs can be readily identified by one of ordinary skill in the art.
- fragment refers to a part or portion of an antibody or antibody chain comprising fewer amino acid residues than an intact or complete antibody or antibody chain.
- antigen-binding fragment refers to a polypeptide fragment of an immunoglobulin or antibody that binds antigen or competes with intact antibody (i.e., with the intact antibody from which they were derived) for antigen binding (i.e., specific binding to TIGIT).
- fragment of an antibody molecule includes antigen-binding fragments of antibodies, for example, an antibody light chain variable domain (VL), an antibody heavy chain variable domain (VH), a single chain antibody (scFv), a F(ab′)2 fragment, a Fab fragment, an Fd fragment, an Fv fragment, and a single domain antibody fragment (DAb). Fragments can be obtained, e.g., via chemical or enzymatic treatment of an intact or complete antibody or antibody chain or by recombinant means.
- valency refers to the number of potential target binding sites in a polypeptide. Each target binding site specifically binds one target molecule or specific site on a target molecule. When a polypeptide comprises more than one target binding site, each target binding site may specifically bind the same or different molecules (e.g., may bind to different ligands or different antigens, or different epitopes on the same antigen).
- the subject binding molecules have at least one binding site specific for TIGIT.
- the term “specificity” refers to the ability to bind (e.g., immunoreact with) a given target, e.g., TIGIT.
- a polypeptide may be monospecific and contain one or more binding sites which specifically bind a target or a polypeptide may be multispecific and contain two or more binding sites which specifically bind the same or different targets.
- an antibody of the invention is specific for more than one target.
- a multispecific binding molecule of the invention binds TIGIT and a second target molecule.
- the second target molecule is a molecule other than TIGIT.
- polypeptides which comprise an amino acid sequence that is not naturally occurring.
- non-naturally occurring polypeptides which are modified forms of naturally occurring polypeptides (e.g., comprising a mutation such as an addition, substitution or deletion) or which comprise a first amino acid sequence (which may or may not be naturally occurring) that is linked in a linear sequence of amino acids to a second amino acid sequence (which may or may not be naturally occurring) to which it is not naturally linked in nature.
- the term “engineered” includes manipulation of nucleic acid or polypeptide molecules by synthetic means (e.g. by recombinant techniques, in vitro peptide synthesis, by enzymatic or chemical coupling of peptides or some combination of these techniques).
- the antibodies of the invention have been engineered to improve one or more properties, such as antigen binding, stability/half-life or effector function.
- modified antibody includes synthetic forms of antibodies which are altered such that they are not naturally occurring, e.g., antibodies that comprise at least two heavy chain portions but not two complete heavy chains (such as, domain deleted antibodies or minibodies); multispecific forms of antibodies (e.g., bispecific, trispecific, etc.) altered to bind to two or more different antigens or to different epitopes on a single antigen; heavy chain molecules joined to scFv molecules and the like. ScFv molecules are known in the art and are described, e.g., in U.S. Pat. No. 5,892,019.
- modified antibody includes multivalent forms of antibodies (e.g., trivalent, tetravalent, etc., antibodies that bind to three or more copies of the same antigen).
- a modified antibody of the invention is a fusion protein comprising at least one heavy chain portion lacking a CH2 domain and comprising a binding domain of a polypeptide comprising the binding portion of one member of a receptor ligand pair.
- modified antibody may also be used herein to refer to amino acid sequence variants of a TIGIT antibody of the invention. It will be understood by one of ordinary skill in the art that a TIGIT antibody of the invention may be modified to produce a variant TIGIT antibody which varies in amino acid sequence in comparison to the TIGIT antibody from which it was derived. For example, nucleotide or amino acid substitutions leading to conservative substitutions or changes at “non-essential” amino acid residues may be made (e.g., in CDR and/or framework residues). Amino acid substitutions can include replacement of one or more amino acids with a naturally occurring or non-natural amino acid.
- Antibody fragments comprise a portion of a full length antibody, generally the antigen binding or variable domain thereof.
- antigen binding antibody fragments include Fab, Fab′, F(ab′)2, bi-specific Fab's, and Fv fragments, diabodies, linear antibodies, single-chain antibody molecules, a single chain variable fragment (scFv) and multispecific antibodies formed from antibody fragments (see Holliger and Hudson, Nature Biotechnol. 23:1126-1136, 2005, the contents of which are incorporated herein by reference).
- affinity variant refers to a variant antibody which exhibits one or more changes in amino acid sequence compared to a reference TIGIT antibody of the invention, wherein the affinity variant exhibits an altered affinity for TIGIT in comparison to the reference antibody.
- the affinity variant will exhibit improved affinity for TIGIT, as compared to the reference TIGIT antibody. The improvement may be apparent as a lower KD for TIGIT, or a slower off-rate for TIGIT.
- Affinity variants typically exhibit one or more changes in amino acid sequence in the CDRs, as compared to the reference TIGIT antibody.
- Such substitutions may result in replacement of the original amino acid present at a given position in the CDRs with a different amino acid residue, which may be a naturally occurring amino acid residue or a non-naturally occurring amino acid residue.
- the amino acid substitutions may be conservative or non-conservative.
- affinity or “binding affinity” should be understood based on the usual meaning in the art in the context of antibody binding, and reflects the strength and/or stability of binding between an antigen and a binding site on an antibody or antigen binding fragment thereof.
- the anti-TIGIT antibodies provided herein are characterised by high affinity binding to human TIGIT. Binding affinity for TIGIT may be assessed using standard techniques known to persons of skill in the art.
- Binding affinity may also be expressed as the dissociation constant for a particular antibody, or the K D .
- K D the dissociation constant for a particular antibody
- binding affinity of a Fab clone comprising a defined VH/VL pairing may be assessed by using methods known in the art, for example by the ForteBioTM system, by MSD-solution equilibrium titration (SET), or by surface plasmon resonance, e.g. using the BiacoreTM system as described in the accompanying examples.
- Fab fragments of the antibodies according to the invention typically exhibit a K D for TIGIT measured by ForteBioTM in the range of from 1 ⁇ 10 ⁇ 1 ° to 5 ⁇ 10 ⁇ 8 M, optionally 7 ⁇ 10 ⁇ 10 to 4 ⁇ 10 ⁇ 8 M.
- a K D within this range may be taken as an indication that the Fab, and a corresponding bivalent mAb, exhibit high affinity binding to hTIGIT.
- Bivalent mAbs comprising two Fabs that (individually) exhibit K D for hTIGIT within the stated ranges are also taken to exhibit high affinity binding to hTIGIT.
- a MSD K D in the range of from 1 ⁇ 10 ⁇ 11 to 5 ⁇ 10 ⁇ 9 , optionally 2 ⁇ 10 ⁇ 11 to 1 ⁇ 10 ⁇ 9 may be taken as an indication of high affinity binding to hTIGIT.
- Fab fragments of the antibodies according to the invention typically exhibit a K D for TIGIT measured by BiacoreTM in the range of from 1 ⁇ 10 ⁇ 10 M to 1 ⁇ 10 ⁇ 9 M, optionally from 1 ⁇ 10 ⁇ 10 to 7 ⁇ 10 10 , optionally 2 ⁇ 10 ⁇ 10 to 7 ⁇ 10 ⁇ 10 M.
- a K D within this range may be taken as an indication that the Fab, and a corresponding bivalent mAb, exhibit high affinity binding to hTIGIT.
- Binding affinity to human TIGIT can also be assessed using a cell-based system as described in the accompanying examples, in which mAbs are tested for binding to mammalian cells (cell lines or ex vivo cells that express TIGIT), for example using ELISA or flow cytometry.
- High affinity for TIGIT may be indicated, for example, by an EC 50 of no more than 0.5 nM by flow cytometric (e.g. FACS) analysis such as that described in Example 10.
- flow cytometric e.g. FACS
- antibodies of the invention exhibit a cell binding EC 50 of no more than 0.5 nM, optionally no more than 0.2 nM.
- Cell-based determination of affinity expressed as EC 50 is preferably determined using Jurkat cells expressing hTIGIT or primary CD8 T cells from human peripheral blood mononuclear cells (PBMCs).
- Treg cells refer to regulatory CD4+ T cells—that is, T cells that decrease the effector function(s) of conventional T cells (CD8 or CD4 T cells). Tregs can be identified according to methods known in the art, for example using flow cytometry to identify CD4 cells expressing high levels of CD25 and low levels or absence of CD127.
- the invention relates, at least in part, to antibodies, and antigen binding fragments thereof, that bind to TIGIT.
- TIGIT antibodies, and antibody fragments thereof, that bind to TIGIT.
- the present invention provides an isolated antibody or antigen binding fragment thereof which binds to human TIGIT and which comprises a heavy chain variable domain comprising a heavy chain CDR1 (HCDR1), a heavy chain CDR2 (HCDR2), and a heavy chain CDR3 (HCDR3) selected from the HCDR1, HCDR2 and HCDR3 sequences shown in FIG. 1 and which further comprises a light chain variable domain comprising a light chain CDR1 (LCDR1), a light chain CDR2 (LCDR2), and a light chain CDR3 (LCDR3) selected from the LCDR1, LCDR2, and LCDR3 sequences shown in FIG. 2 .
- HCDR1 heavy chain CDR1
- HCDR2 heavy chain CDR2
- HCDR3 heavy chain CDR3
- the invention provides an isolated antibody or antigen binding fragment thereof which binds to human TIGIT and which comprises a heavy chain variable domain comprising a heavy chain CDR1 (HCDR1), a heavy chain CDR2 (HCDR2), and a heavy chain CDR3 (HCDR3), wherein:
- HCDR1 is selected from the group consisting of SEQ ID Nos: 1, 4, 7, 10, 13, 16, 19, 22, 25, 28, 31, 34, 37, 40, 43, 271, 274, and 277;
- HCDR2 is selected from the group consisting of SEQ ID Nos: 2, 5, 8, 11, 14, 17, 20, 23, 26, 29, 32, 35, 38, 41, 44, 272, 275, and 278;
- HCDR3 is selected from the group consisting of SEQ ID Nos: 3, 6, 9, 12, 15, 18, 21, 24, 27, 30, 33, 36, 39, 42, 45, 273, 276, and 279;
- LCDR1 light chain CDR1
- LCDR2 light chain CDR2
- LCDR3 light chain CDR3
- LCDR1 is selected from the group consisting of SEQ ID Nos: 46, 49, 52, 55, 58, 61, 64, 67, 70, 73, 76, 79, 82, 85, 88, 283, 286, and 289;
- LCDR2 is selected from the group consisting of SEQ ID Nos: 47, 50, 53, 56, 59, 62, 65, 68, 71, 74, 77, 80, 83, 86, 89, 284, 287, and 290; and
- LCDR3 is selected from the group consisting of SEQ ID Nos: 48, 51, 54, 57, 60, 63, 66, 69, 72, 75, 78, 81, 84, 87, 90, 285, 288, and 291.
- any given anti-TIGIT antibody or antigen binding fragment thereof comprising a VH domain paired with a VL domain to form a binding site for antigen will comprise a combination of 6 CDRs: variable heavy chain CDR3 (HCDR3), variable heavy chain CDR2 (HCDR2), variable heavy chain CDR1 (HCDR1), variable light chain CDR3 (LCDR3), variable light chain CDR2 (LCDR2) and variable light chain CDR1 (LCDR1).
- 6 CDRs selected from the CDR sequence groups listed above are permissible, and within the scope of the invention, certain combinations of 6 CDRs are particularly preferred; these being the “native” combinations within a single mAb exhibiting high affinity binding to human TIGIT.
- the antibody or antigen binding fragment comprises a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, wherein the combination is selected from the group of combinations formed by the HCDRs from each antibody in FIG. 1 taken with the LCDRs from the corresponding antibody in FIG. 2 .
- the antibody or antigen binding fragment comprises a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, wherein the combination is selected from the group consisting of:
- HCDR1 comprising SEQ ID NO:1, HCDR2 comprising SEQ ID NO:2, HCDR3 comprising SEQ ID NO:3, LCDR1 comprising SEQ ID NO:46, LCDR2 comprising SEQ ID NO:47, and LCDR3 comprising SEQ ID NO:48;
- HCDR1 comprising SEQ ID NO:4, HCDR2 comprising SEQ ID NO:5, HCDR3 comprising SEQ ID NO:6, LCDR1 comprising SEQ ID NO:49, LCDR2 comprising SEQ ID NO:50, and LCDR3 comprising SEQ ID NO:51;
- HCDR1 comprising SEQ ID NO:7
- HCDR2 comprising SEQ ID NO:8
- HCDR3 comprising SEQ ID NO:9
- LCDR1 comprising SEQ ID NO:52
- LCDR2 comprising SEQ ID NO:53
- LCDR3 comprising SEQ ID NO:54;
- HCDR1 comprising SEQ ID NO:10, HCDR2 comprising SEQ ID NO:11, HCDR3 comprising SEQ ID NO:12, LCDR1 comprising SEQ ID NO:55, LCDR2 comprising SEQ ID NO:56, and LCDR3 comprising SEQ ID NO:57;
- HCDR1 comprising SEQ ID NO:13, HCDR2 comprising SEQ ID NO:14, HCDR3 comprising SEQ ID NO:15, LCDR1 comprising SEQ ID NO:58, LCDR2 comprising SEQ ID NO:59, and LCDR3 comprising SEQ ID NO:60;
- HCDR1 comprising SEQ ID NO:16, HCDR2 comprising SEQ ID NO:17, HCDR3 comprising SEQ ID NO:18, LCDR1 comprising SEQ ID NO:61, LCDR2 comprising SEQ ID NO:62, and LCDR3 comprising SEQ ID NO:63;
- HCDR1 comprising SEQ ID NO:19, HCDR2 comprising SEQ ID NO:20, HCDR3 comprising SEQ ID NO:21, LCDR1 comprising SEQ ID NO:64, LCDR2 comprising SEQ ID NO:65, and LCDR3 comprising SEQ ID NO:66;
- HCDR1 comprising SEQ ID NO:22, HCDR2 comprising SEQ ID NO:23, HCDR3 comprising SEQ ID NO:24, LCDR1 comprising SEQ ID NO:67, LCDR2 comprising SEQ ID NO:68, and LCDR3 comprising SEQ ID NO:69;
- HCDR1 comprising SEQ ID NO:25, HCDR2 comprising SEQ ID NO:26, HCDR3 comprising SEQ ID NO:27, LCDR1 comprising SEQ ID NO:70, LCDR2 comprising SEQ ID NO:71, and LCDR3 comprising SEQ ID NO:72;
- HCDR1 comprising SEQ ID NO:28, HCDR2 comprising SEQ ID NO:29, HCDR3 comprising SEQ ID NO:30, LCDR1 comprising SEQ ID NO:73, LCDR2 comprising SEQ ID NO:74, and LCDR3 comprising SEQ ID NO:75;
- HCDR1 comprising SEQ ID NO:31
- HCDR2 comprising SEQ ID NO:32
- HCDR3 comprising SEQ ID NO:33
- LCDR1 comprising SEQ ID NO:76
- LCDR2 comprising SEQ ID NO:77
- LCDR3 comprising SEQ ID NO:78;
- HCDR1 comprising SEQ ID NO:34, HCDR2 comprising SEQ ID NO:35, HCDR3 comprising SEQ ID NO:36, LCDR1 comprising SEQ ID NO:79, LCDR2 comprising SEQ ID NO:80, and LCDR3 comprising SEQ ID NO:81;
- HCDR1 comprising SEQ ID NO:37, HCDR2 comprising SEQ ID NO:38, HCDR3 comprising SEQ ID NO:39, LCDR1 comprising SEQ ID NO:82, LCDR2 comprising SEQ ID NO:83, and LCDR3 comprising SEQ ID NO:84;
- HCDR1 comprising SEQ ID NO:40, HCDR2 comprising SEQ ID NO:41, HCDR3 comprising SEQ ID NO:42, LCDR1 comprising SEQ ID NO:85, LCDR2 comprising SEQ ID NO:86, and LCDR3 comprising SEQ ID NO:87;
- HCDR1 comprising SEQ ID NO:43, HCDR2 comprising SEQ ID NO:44, HCDR3 comprising SEQ ID NO:45, LCDR1 comprising SEQ ID NO:88, LCDR2 comprising SEQ ID NO:89, and LCDR3 comprising SEQ ID NO:90;
- HCDR1 comprising SEQ ID NO:271, HCDR2 comprising SEQ ID NO:272, HCDR3 comprising SEQ ID NO:273, LCDR1 comprising SEQ ID NO:283, LCDR2 comprising SEQ ID NO:284, and LCDR3 comprising SEQ ID NO:285;
- HCDR1 comprising SEQ ID NO:274, HCDR2 comprising SEQ ID NO:275, HCDR3 comprising SEQ ID NO:276, LCDR1 comprising SEQ ID NO:286, LCDR2 comprising SEQ ID NO:287, and LCDR3 comprising SEQ ID NO:288;
- HCDR1 comprising SEQ ID NO:277, HCDR2 comprising SEQ ID NO:278, HCDR3 comprising SEQ ID NO:279, LCDR1 comprising SEQ ID NO:289, LCDR2 comprising SEQ ID NO:290, and LCDR3 comprising SEQ ID NO:291.
- the antibody or antigen binding fragment comprises a heavy chain variable domain having an amino acid sequence selected from the group consisting of: SEQ ID Nos: 211, 213, 215, 217, 219, 221, 223, 225, 227, 229, 231, 233, 235, 237, 239, 327, 329, and 331 and amino acid sequences exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto; and optionally comprising a light chain variable domain having an amino acid sequence selected from the group consisting of: the amino acid sequences of SEQ ID Nos: 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 328, 330, and 332 and amino acid sequences exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto.
- VH domains and VL domains selected from the VH and VL domain sequence groups listed above are permissible, and within the scope of the invention, certain combinations VH and VL are particularly preferred; these being the “native” combinations within a single mAb exhibiting high affinity binding to human TIGIT.
- the antibody or antigen binding fragment comprises a combination of a heavy chain variable domain and a light chain variable domain, wherein the combination is selected from the group of combinations formed by the VH from each antibody in FIG. 5 , or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto, taken with the VL from the same antibody in FIG. 5 , or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto.
- the antibody or antigen binding fragment comprises a combination of a heavy chain variable domain and a light chain variable domain, wherein the combination is selected from the group consisting of:
- a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:327 or an amino acid sequence at least 90% identical thereto and a light chain variable domain comprising the amino acid sequence of SEQ ID NO:328 or an amino acid sequence at least 90% identical thereto;
- a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:331 or an amino acid sequence at least 90% identical thereto and a light chain variable domain comprising the amino acid sequence of SEQ ID NO:332 or an amino acid sequence at least 90% identical thereto.
- VH domain having an amino acid sequence at least 90%, 92%, 95%, 97% or 99% identical to the recited VH domain sequence
- VL domain having an amino acid sequence at least 90%, 92%, 95%, 97% or 99% identical to the recited VL domain sequence.
- Embodiments wherein the amino acid sequence of the VH domain exhibits less than 100% sequence identity with a given reference VH sequence may nevertheless comprise heavy chain CDRs which are identical to HCDR1, HCDR2 and HCDR3 of the reference sequence whilst exhibiting amino acid sequence variation within the framework regions.
- embodiments wherein the amino acid sequence of the VL domain exhibits less than 100% sequence identity with a given reference sequence may nevertheless comprise light chain CDRs which are identical to LCDR1, LCDR2 and LCDR3 of the reference sequence whilst exhibiting amino acid sequence variation within the framework regions.
- the structure of the antibodies/antigen binding fragments is defined on the basis of % sequence identity with a recited reference sequence (with a given SEQ ID NO).
- % sequence identity between two amino acid sequences may be determined by comparing these two sequences aligned in an optimum manner and in which the amino acid sequence to be compared can comprise additions or deletions with respect to the reference sequence for an optimum alignment between these two sequences.
- the percentage of identity is calculated by determining the number of identical positions for which the amino acid residue is identical between the two sequences, by dividing this number of identical positions by the total number of positions in the comparison window and by multiplying the result obtained by 100 in order to obtain the percentage of identity between these two sequences.
- the comparison window with correspond to the full length of the sequence being compared.
- BLAST 2 sequences “Tatusova et al, “Blast 2 sequences—a new tool for comparing protein and nucleotide sequences”, FEMS Microbiol Lett.
- sequence identity of a query sequence to a reference sequence is within the ability of the skilled person and can be performed using commercially available analysis software such as BLASTTM.
- the antibody or antigen binding fragment may comprise a heavy chain variable domain and a light chain variable domain wherein HCDR1 comprises SEQ ID NO: 16, HCDR2 comprises SEQ ID NO: 17, HCDR3 comprises SEQ ID NO: 18, and LCDR1 comprises SEQ ID NO: 61, LCDR2 comprises SEQ ID NO: 62, and LCDR3 comprises SEQ ID NO: 63.
- the heavy chain variable domain may comprise the amino acid sequence shown as SEQ ID NO: 221 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto
- the light chain variable domain may comprise the amino acid sequence shown as SEQ ID NO: 222 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto.
- the heavy chain variable domain and light chain variable domain are the VH and VL domain of antibody 31282 provided herein.
- Antibody 31282 provided herein is derived from antibody 29489.
- Antibody 31282 was produced from 29489 by an M-T substitution at amino acid 116 in VH FR4 region. This substitution is understood to remove a potential oxidation site of the antibody and thereby improve stability without affecting function.
- Antibodies 31282 and 29489 thus share identical HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3 sequences, differing only in the framework.
- the heavy chain variable domain may comprise the amino acid sequence shown as SEQ ID NO: 219 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto
- the light chain variable domain may comprise the amino acid sequence shown as SEQ ID NO: 220 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto.
- the heavy chain variable domain and light chain variable domain are the VH and VL domain of antibody 29489 provided herein.
- Embodiments wherein the amino acid sequence of the VH domain exhibits less than 100% sequence identity with the sequence shown as SEQ ID NO: 221 or 219 may nevertheless comprise heavy chain CDRs which are identical to HCDR1, HCDR2 and HCDR3 of SEQ ID NO:221 and 219 (SEQ ID NOs:16, 17 and 18, respectively) whilst exhibiting amino acid sequence variation within the framework regions.
- embodiments wherein the amino acid sequence of the VL domain exhibits less than 100% sequence identity with the sequence shown as SEQ ID NO: 222 or 220 may nevertheless comprise light chain CDRs which are identical to LCDR1, LCDR2 and LCDR3 of SEQ ID NO:222 and 220 (SEQ ID NOs:61, 62 and 63, respectively) whilst exhibiting amino acid sequence variation within the framework regions.
- Exemplary TIGIT antibodies described herein and having the sequences set out in FIG. 1-5 were developed from 5 parent antibody clones. Table 2 summarises the lineage of the antibodies described herein. Na ⁇ ve parent human anti-TIGIT antibodies were expressed in yeast and those exhibiting high functional activity against TIGIT were selected (grey rows, named 26 . . . ), and underwent affinity maturation. Selected affinity-matured antibodies then were expressed in mammalian cells (white rows beneath each parent, named 29 . . . or 3 . . . ). In addition, antibody 31282 was produced from 29489 by an M-T substitution at amino acid 116 in VH FR4 region.
- antibody 31288 was produced from 29494 by a V-L substitution at amino acid 2 in VH FR1 region and by an M-T substitution at amino acid 120 in VH FR4 region.
- the V-L substitution is understood to restore the sequence of VH4-39 germline and the M-T substitution to remove a potential oxidation site of the antibody and thereby improve stability without affecting function.
- the second generation antibodies exhibit higher affinity than the respective parent antibodies.
- the invention provides anti-TIGIT antibodies or antigen binding fragments thereof wherein the VH domain is derived from a human V region germline sequence selected from: VH3-07, VH3-30, VH1-46, VH4-0B, VH4-39, VH1-69, VH3-09, VH3-33, VH3-30.
- the antibody or antigen binding fragment thereof comprises a VH domain derived from human V region germline VH1-46.
- a VH domain is “derived from” a particular V region germline sequence if the sequence of the heavy chain variable region is more likely derived from the given germline than from any other.
- the invention also provides an antibody or antigen binding fragment thereof which binds to human TIGIT at an epitope comprising residues Q56 and I109.
- the antibody or antigen binding fragment thereof binds human TIGIT at least at residues Q56, N58 and I109.
- the antibody or antigen binding fragment thereof binds human TIGIT at an epitope comprising residues Q56, N58 and I109 and optionally one or more of residues E60, 168, L73 and H76.
- the antibody or antigen binding fragment thereof binds human TIGIT at an epitope comprising residues Q56, N58, E60, 168, L73, H76, and I109.
- the antibody or antigen binding fragment thereof binds to human TIGIT at an epitope consisting of TIGIT residues Q56, N58, E60, 168, L73, H76, and 1109. In certain embodiments, the antibody or antigen binding fragment thereof binds the same epitope as antibody 31282.
- the antibody or antigen binding fragment binds an epitope of human TIGIT comprising the indicated TIGIT residues
- the antibody binds each of these residues and optionally other residues of TIGIT.
- the antibody or antigen binding fragment binds an epitope of human TIGIT consisting of TIGIT residues Q56, N58, E60, 168, L73, H76, and I109
- the antibody binds each of these residues and no other residues of TIGIT.
- an antibody or antigen binding fragment binds to human TIGIT at a given epitope if it contacts the indicated TIGIT amino acid residue(s) when bound to TIGIT.
- an antibody contacts a TIGIT residue if, when in the protein complex formed by antibody-TIGIT binding, the residue meets each of the following criteria: (i) it has a calculated binding free energy contribution greater than 0.3 kcal/mol, (ii) it has an experimental averaged B-factor lower than the mean B-factor of all residues in the X-ray structure, (iii) it makes at least 3 pairs of heavy-atom interatomic contacts with antibody atoms at a distance less than or equal to 4.0 Angstroms, (iv) it does not make only solvent-exposed hydrogen bond or ionic interactions, (v) if it is a non-aromatic polar residue (Asn, Gln, Ser, Thr, Asp, Glu, Lys, or Arg), it makes at least one hydrogen bond or ionic interaction with the
- binding free energy is calculated using an empirical force field, preferably FoldX.
- FoldX would be familiar to the skilled person and is publicly available at http://foldxsuite.crg.eu/. Calculation of binding free energy using FoldX is also described in Guerois et al. J. Mol. Biol. 2002; 320(2):369-87, which is incorporated herein by reference.
- heavy atoms are all non-hydrogen atoms (including C, N, O, S).
- the invention also provides an antibody or antigen binding fragment thereof which contacts human TIGIT at least at residues Q56 and I109.
- the antibody or antigen binding fragment thereof contacts human TIGIT at least at residues Q56, N58 and I109.
- the antibody or antigen binding fragment thereof contacts human TIGIT at least at residues Q56, N58 and I109 and optionally one or more of residues E60, 168, L73 and H76.
- the antibody or antigen binding fragment thereof contacts human TIGIT at least at residues Q56, N58, E60, 168 L73, H76, and I109.
- the antibody or antigen binding fragment thereof contacts human TIGIT only at residues Q56, N58, E60, 168, L73, H76, and I109.
- Means for determining which residues of TIGIT are contacted by an antibody or antigen-binding fragment are familiar to the skilled person, including X-Ray crystallography, such as that described in Example 23.
- an isolated antibody or antigen binding fragment thereof which binds to the same epitope as an antibody or antigen-binding fragment described herein.
- TIGIT antibodies can take various different embodiments in which both a VH domain and a VL domain are present.
- antibody herein is used in the broadest sense and encompasses, but is not limited to, monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), so long as they exhibit the appropriate immunological specificity for a human TIGIT protein.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to conventional (polyclonal) antibody preparations which typically include different antibodies directed against different determinants (epitopes) on the antigen, each monoclonal antibody is directed against a single determinant or epitope on the antigen.
- the TIGIT antibodies provided herein may comprise CH1 domains and/or CL domains, the amino acid sequence of which is fully or substantially human. If the TIGIT antibody is intended for human therapeutic use, it is typical for the entire constant region of the antibody, or at least a part thereof, to have fully or substantially human amino acid sequence. Therefore, one or more or any combination of the CH1 domain, hinge region, CH2 domain, CH3 domain and CL domain (and CH4 domain if present) may be fully or substantially human with respect to its amino acid sequence.
- Such antibodies may be of any human isotype, with human IgG4 and IgG1 being particularly preferred.
- the CH1 domain, hinge region, CH2 domain, CH3 domain and CL domain may all have fully or substantially human amino acid sequence.
- substantially human refers to an amino acid sequence identity of at least 90%, or at least 92%, or at least 95%, or at least 97%, or at least 99% with a human constant region.
- human amino acid sequence in this context refers to an amino acid sequence which is encoded by a human immunoglobulin gene, which includes germline, rearranged and somatically mutated genes.
- Such antibodies may be of any human isotype, with human IgG4 and IgG1 being particularly preferred.
- TIGIT antibodies comprising constant domains of “human” sequence which have been altered, by one or more amino acid additions, deletions or substitutions with respect to the human sequence.
- TIGIT antibodies provided herein may be of any isotype.
- Antibodies intended for human therapeutic use will typically be of the IgA, IgD, IgE IgG, IgM type, often of the IgG type, in which case they can belong to any of the four sub-classes IgG1, IgG2a and b, IgG3 or IgG4. Within each of these sub-classes it is permitted to make one or more amino acid substitutions, insertions or deletions within the Fc portion, or to make other structural modifications, for example to enhance or reduce Fc-dependent functionalities.
- the TIGIT antibodies provided herein are IgG antibodies. In certain embodiments, antibodies according to the invention are IgG1 antibodies. In certain alternate embodiments, antibodies according to the invention are IgG4 antibodies.
- IgG4 antibodies are known to undergo Fab arm exchange (FAE), which can result in unpredictable pharmacodynamic properties of an IgG4 antibody.
- FAE has been shown to be prevented by the S228P mutation in the hinge region (Silva et al. J Biol Chem. 2015 Feb. 27; 290(9): 5462-5469). Therefore, in certain such embodiments wherein an antibody according to the invention is an IgG4 antibody, the antibody comprises the mutation S228P—that is, a serine to proline mutation at position 228 (according to EU numbering).
- one or more amino acid substitutions, insertions or deletions may be made within the constant region of the heavy and/or the light chain, particularly within the Fc region.
- Amino acid substitutions may result in replacement of the substituted amino acid with a different naturally occurring amino acid, or with a non-natural or modified amino acid.
- Other structural modifications are also permitted, such as for example changes in glycosylation pattern (e.g. by addition or deletion of N- or O-linked glycosylation sites).
- the TIGIT antibodies may comprise an Fc region of a given antibody isotype, for example human IgG1, which is modified in order to reduce or substantially eliminate one or more antibody effector functions naturally associated with that antibody isotype.
- antibodies with cell lytic effector functions can be effective at reducing Treg cell populations but, surprisingly, without adversely affecting conventional effector T cell populations. This selectivity can allow more potent inhibition of the regulatory effect of Tregs whilst retaining anti-tumour effector T cells.
- the TIGIT antibodies retain one or more of the antibody effector functions naturally associated with that antibody isotype.
- the TIGIT antibodies of the invention may be IgG1 antibodies that retain ADCC functionality.
- the TIGIT antibodies may comprise an Fc region of a given antibody isotype, for example human IgG1, which is modified in order to enhance one or more antibody effector functions naturally associated with that antibody isotype.
- antibody effector functions include one or more or all of antibody-dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC) and antibody-dependent cellular phagocytosis (ADCP).
- the anti-TIGIT antibody is a modified antibody.
- a bispecific antibody comprising a first arm specific for TIGIT and a second arm specific for a second target.
- the second target is an immune checkpoint molecule.
- the second target is OX40.
- the second target is ICOS.
- the second target is GITR.
- the second target is 4-1BB.
- the second target is PD-1.
- the second target is PD-L1.
- the first arm specific of TIGIT comprises a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3 sequences of an antibody according to the invention.
- the first arm comprises comprise a heavy chain variable domain and a light chain variable domain wherein HCDR1 comprises SEQ ID NO: 16, HCDR2 comprises SEQ ID NO: 17, HCDR3 comprises SEQ ID NO: 18, and LCDR1 comprises SEQ ID NO: 61, LCDR2 comprises SEQ ID NO: 62, and LCDR3 comprises SEQ ID NO: 63.
- Monoclonal antibodies or antigen-binding fragments thereof that “cross-compete” with the TIGIT antibodies disclosed herein are those that bind human TIGIT at site(s) that are identical to, or overlapping with, the site(s) at which the present TIGIT antibodies bind. Competing monoclonal antibodies or antigen-binding fragments thereof can be identified, for example, via an antibody competition assay. For example, a sample of purified or partially purified human TIGIT can be bound to a solid support. Then, an antibody compound or antigen binding fragment thereof of the present invention and a monoclonal antibody or antigen-binding fragment thereof suspected of being able to compete with such invention antibody compound are added. One of the two molecules is labelled.
- the labelled compound and the unlabelled compound bind to separate and discrete sites on TIGIT, the labelled compound will bind to the same level whether or not the suspected competing compound is present. However, if the sites of interaction are identical or overlapping, the unlabelled compound will compete, and the amount of labelled compound bound to the antigen will be lowered. If the unlabelled compound is present in excess, very little, if any, labelled compound will bind.
- competing monoclonal antibodies or antigen-binding fragments thereof are those that decrease the binding of the present antibody compounds to TIGIT by about 50%, about 60%, about 70%, about 80%, about 85%, about 90%, about 95%, or about 99%.
- Details of procedures for carrying out such competition assays are well known in the art and can be found, for example, in Harlow and Lane, Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1988, 567-569, 1988, ISBN 0-87969-314-2.
- Such assays can be made quantitative by using purified antibodies. A standard curve is established by titrating one antibody against itself, i.e., the same antibody is used for both the label and the competitor.
- the capacity of an unlabelled competing monoclonal antibody or antigen-binding fragment thereof to inhibit the binding of the labelled molecule to the plate is titrated. The results are plotted, and the concentrations necessary to achieve the desired degree of binding inhibition are compared.
- Antibodies of the Invention Exhibit High Affinity for TIGIT and Compete with CD155
- the antibodies or antigen binding fragments of the invention exhibit high affinity for human TIGIT.
- Fab fragments of the antibodies according to the invention exhibit a KD for TIGIT measured by ForteBioTM in the range of from 1 ⁇ 10-10 to 5 ⁇ 10-8 M, optionally 7 ⁇ 10-10 to 4 ⁇ 10-8 M.
- antibodies according to the invention exhibit MSD KD in the range of from 1 ⁇ 10-11 to 5 ⁇ 10-9 M, optionally 2 ⁇ 10-11 to 1 ⁇ 10-9.
- Fab fragments of the antibodies according to the invention exhibit a KD for TIGIT measured by BiacoreTM in the range of from 1 ⁇ 10-10 M to 1 ⁇ 10-9 M, optionally 1 ⁇ 10-10 to 7 ⁇ 10-10 M, optionally 2 ⁇ 10-10 to 7 ⁇ 10-10 M.
- an anti-TIGIT antibody or antigen binding fragment provided herein exhibits a binding EC50 for human TIGIT of less than 0.5 nM.
- the antibody or antigen binding fragment exhibits a binding EC50 of from about 0.05 to about 0.4 nM, preferably from about 0.05 to about 0.3 nM, preferably from about 0.05 to about 0.2 nM, preferably from about 0.05 to about 0.15 nM.
- the antibody or antigen binding fragment exhibits a binding EC50 for human TIGIT of about 0.1 nM.
- the antibody comprises the CDRs of antibody 31282.
- the EC50 is determined using Jurkat cells expressing human TIGIT, as described in Example 18.
- antibodies or antigen binding fragments of the invention cross-react with mouse TIGIT and/or cynomolgus TIGIT.
- an antibody or antigen binding fragment of the invention has equivalent affinity for TIGIT expressed by CD8 T cells and expressed by Treg cells.
- an antibody or antigen binding fragment has “equivalent affinity” for CD8 T cells and Treg cells if the affinity for CD8 T cells is in the range of 0.5-1.5 times that of the affinity for Treg cells.
- an antibody having equivalent affinity for CD8 T cells and Treg cells which exhibits an affinity for Treg cells of 0.03 nM would exhibit an affinity for CD8 T cells in the range of 0.015-0.045 nM.
- Table 3 provides a summary of the affinity properties of the anti-TIGIT antibodies of the invention, with grey cells indicating parent antibody clones, with second and third generation antibodies of each lineage shown immediately below the respective parent antibody (see also Table 2).
- an anti-TIGIT antibody or antigen binding fragment provided herein exhibits a binding EC50 for human TIGIT of less than 0.5 nM.
- the antibody or antigen binding fragment exhibits a binding EC50 of from about 0.05 to about 0.4 nM, preferably from about 0.1 to about 0.3 nM.
- the antibody or antigen binding fragment exhibits a binding EC50 for human TIGIT of about 0.2 nM.
- the antibody or antigen binding fragment comprises the CDRs of antibody 31282.
- the EC50 is determined using CD8+ T cells from human PBMCs, preferably from a healthy individual, as described in Example 18.
- antibodies or antigen binding fragment of the invention exhibit high affinity for TIGIT-expressing CD8 T cells and high affinity for TIGIT-expressing Treg cells.
- antibodies or antigen binding fragment of the invention exhibit an affinity for TIGIT-expressing CD8 T cells and TIGIT-expressing Treg cells characterised by an EC50 less than 0.5 nM, preferably less than 0.3 nM, preferably less than 0.2 nM.
- the antibodies or antigen binding fragment of the invention exhibit equivalent affinity for TIGIT-expressing CD8 T cells and for TIGIT-expressing Treg cells.
- Antibodies according to the invention exhibit surprisingly high affinity for CD8+ T cells from cancer patients. This is particularly advantageous, since increasing effector activity of T cells from cancer patients by inhibition of TIGIT signalling can lead to more effective tumour control. Accordingly, in certain embodiments, an anti-TIGIT antibody or antigen binding fragment provided herein exhibits a binding EC50 of less than 0.5 nM for human TIGIT on human CD8+ T cells from cancer patients. In preferred such embodiments, the antibody or antigen binding fragment exhibits a binding EC50 of from about 0.05 to about 0.4 nM, preferably from about 0.1 to about 0.3 nM.
- the antibody or antigen binding fragment exhibits an EC50 for human TIGIT of from about 0.1 nM to about 0.2 nM.
- the antibody or antigen binding fragment comprises the CDRs of antibody 31282.
- the EC50 is determined using CD8+ T cells from PBMCs taken from a patient with cancer, as described in Example 18.
- antibodies or antigen binding fragments of the invention compete with CD155/PVR for TIGIT binding.
- an antibody or antigen binding fragment of the invention exhibits competition with CD155 characterised by an IC50 of 0.2 nM or less, preferably 0.1 nM or less.
- the antibody or antigen binding fragment exhibits competition with CD155 characterised by an IC50 of about 0.05 nM or less.
- the exhibited IC50 is about 0.05 nM.
- the invention further provides “affinity variants” of the antibodies described herein.
- the invention also provides an isolated antibody or antigen binding fragment thereof which cross-competes for binding to human TIGIT with an antibody or antigen-binding fragment described herein.
- Antibodies of the Invention Promote Pro-Inflammatory T Cell Activity
- Antibodies according to the invention are surprisingly effective at promoting pro-inflammatory activity of CD8+ T cells.
- antibodies or antigen binding fragments according to the invention are more effective at promoting pro-inflammatory CD8+ T cell activity (indicated by IFNg release) than comparator anti-TIGIT antibodies (see FIG. 24 ).
- This improved efficacy versus comparator antibodies was demonstrated in TIGIT-expressing transgenic Jurkat reporter cells and in primary CD8 T cells.
- an anti-TIGIT antibody or antigen binding fragment provided herein exhibits an activation EC50 of less than 5 nM for human TIGIT expressed by Jurkat reporter cells as described in Example 19.
- the antibody or antigen binding fragment exhibits an EC50 of from about 1 nM to about 4 nM, preferably from about 2 nM to about 4 nM.
- an anti-TIGIT antibody or antigen binding fragment provided herein exhibits an activation EC50 of less than 0.4 nM for CD8 T cells from healthy individuals as described in Example 19.
- CD8 T cell activity i.e. pro-inflammatory activity
- the antibody or antigen binding fragment exhibits an EC50 of from about 0.05 nM to about 0.4 nM, preferably from about 0.1 nM to about 0.2 nM.
- the EC50 is determined using CD8+ T cells from PBMCs taken from a healthy individual, as described in Example 19.
- the provided anti-TIGIT antibodies are effective at increasing the activity of gamma-delta ( ⁇ , or g/d) T cells (i.e. T cells expressing the ⁇ TCR subunits, as opposed to the conventional ⁇ TCR subunits).
- ⁇ T cells form a distinct and important component of the immune system and the ability of the antibodies provided herein to promote activity of these cells highlights the utility of the antibodies.
- a method of promoting ⁇ T cell activity comprising contacting a population of ⁇ T cells with an anti-TIGIT antibody.
- the method is performed in vitro.
- the method is performed in vivo in a human subject.
- the human subject has cancer.
- the anti-TIGIT antibody or antigen binding fragment comprises a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3 sequences of an antibody according to the invention.
- the anti-TIGIT antibody comprises a heavy chain variable domain and a light chain variable domain wherein HCDR1 comprises SEQ ID NO: 16, HCDR2 comprises SEQ ID NO: 17, HCDR3 comprises SEQ ID NO: 18, and LCDR1 comprises SEQ ID NO: 61, LCDR2 comprises SEQ ID NO: 62, and LCDR3 comprises SEQ ID NO: 63.
- anti-TIGIT antibodies are able to selectively deplete TIGIT-expressing Treg cells. That is, anti-TIGIT antibodies reduce the proportion of TIGIT-expressing Treg cells relative to the total population of T cells to a greater extent than they reduce the proportion of effector or memory CD4 or CD8 T cells.
- the antibody or antigen binding fragment thereof selectively depletes TIGIT-expressing Treg cells.
- TIGIT-expressing Treg cells can be mediated via selective lysis of the TIGIT-expressing Tregs (e.g. by ADCC or CDC (see FIGS. 20, 21, and 25 ).
- TIGIT-expressing Tregs are understood to be the more potent regulatory cells than Tregs not expressing TIGIT.
- selective depletion by lysis of TIGIT-expressing Treg cells is expected to increase T cell effector function (e.g. T-cell mediated cytotoxicity, pro-inflammatory cytokine release) by depleting the overall number of Treg cells but also depleting those Treg cells exhibiting the more potent regulatory function. This increased T cell effector function is demonstrated in FIG. 24 .
- antibodies or antigen binding fragments of the invention selectively lyse TIGIT-expressing Treg cells.
- Selective depletion of Treg cells expressing TIGIT can also be mediated by inducing internalisation of the TIGIT receptor such that it is no longer expressed at the cell membrane.
- TIGIT+ Treg cells become TIGIT ⁇ Treg cells
- the regulatory function of these cells is expected to become less potent (since TIGIT+ Tregs are more potent regulatory cells).
- T cell effector function is expected to increase. Therefore, in certain embodiments, antibodies or antigen binding fragments of the invention inhibit suppressive activity of TIGIT-expressing Treg cells, preferably by inducing internalisation of TIGIT by TIGIT-expressing Treg cells.
- anti-TIGIT antibodies according to the invention exhibit high affinity for CD8 T cells and Treg cells and also to exhibit selective depletion of Treg cells, thereby promoting T cell effector function via two mechanisms.
- Retention of antibody effector function e.g. ADCC, CDC
- the selectivity is particularly surprising since previous attempts to produce an anti-TIGIT antibody have sought to eliminate antibody effector function in order to avoid lysis of effector T cells expressing TIGIT.
- TIGIT antibodies of the invention exhibit affinity for effector T cells (e.g.
- TIGIT-mediated signalling in these cells can be inhibited by competition for CD155 binding and/or inducing internalisation of TIGIT on effector T cells.
- these effects of the antibodies of the invention can result in significant upregulation of T cell effector function.
- TILs tumour infiltrating lymphocytes
- Exposure to the tumour microenvironment can lead to TILs exhibiting anergic or so-called “exhausted” phenotypes, possibly due to antigen over-exposure and/or an immunosuppressive tumour microenvironment.
- Enhancing the effector function of TILs is desirable as it is these cells that are infiltrating the tumour itself and thus positioned at a locus best-suited to reduce tumour size or growth; however due to the anergic or exhausted phenotype of many TILs, it is expected to be difficult to potentiate their effector function.
- the increase in proinflammatory response from TILs following exposure to antibodies of the invention is therefore surprising and indicates the antibodies may be particularly effective therapeutic agents.
- Still further surprising advantageous properties exhibited by antibodies and antigen binding fragments include the ability to increase the pro-inflammatory activity of gamma-delta ( ⁇ ) T cells.
- the ability to promote activity of non-conventional T cells such as ⁇ T cells has not previously been reported for an anti-TIGIT antibody and offers the potential to treat diseases other than cancer in which ⁇ T cells are known to be important.
- ⁇ T cells have been reported to be involved in the response to pathogenic infection (bacterial, viral (e.g. CMV), fungal) as well as to have a role in protecting from autoimmune diseases.
- the surprising ability to promote activity of non-conventional T cells provides further potency to the anti-tumour effects of the antibodies.
- a method for selectively depleting Treg cells from a population of T cells comprising contacting the population of T cells with an anti-TIGIT antibody or antigen binding fragment thereof, whereby the anti-TIGIT antibody selectively depletes the population of Treg cells.
- the method is performed in vitro.
- the method is performed in vivo in a human subject.
- the human subject has cancer.
- the anti-TIGIT antibody or antigen binding fragment comprises a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3 sequences of an antibody according to the invention.
- the anti-TIGIT antibody comprises a heavy chain variable domain and a light chain variable domain wherein HCDR1 comprises SEQ ID NO: 16, HCDR2 comprises SEQ ID NO: 17, HCDR3 comprises SEQ ID NO: 18, and LCDR1 comprises SEQ ID NO: 61, LCDR2 comprises SEQ ID NO: 62, and LCDR3 comprises SEQ ID NO: 63.
- the present invention also provides anti-TIGIT antibodies that do not compete with CD155/PVR for TIGIT binding. Therefore, in a further aspect, the invention provides a human TIGIT antibody or antigen binding fragment thereof that does not compete with CD155/PVR for human TIGIT binding.
- Fab fragments of the CD155 non-competitive anti-TIGIT antibodies according to the invention exhibit a KD for TIGIT measured by ForteBioTM in the range of from 5 ⁇ 10-9 to 5 ⁇ 10-8 M, optionally 1 ⁇ 10-8 to 3 ⁇ 10-8 M.
- the antibody may comprise a heavy chain variable domain and a light chain variable domain wherein HCDR1 comprises SEQ ID NO: 280, HCDR2 comprises SEQ ID NO: 281, HCDR3 comprises SEQ ID NO: 282, and LCDR1 comprises SEQ ID NO: 292, LCDR2 comprises SEQ ID NO: 293, and LCDR3 comprises SEQ ID NO: 294.
- the heavy chain variable domain may comprise the amino acid sequence shown as SEQ ID NO: 333 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto
- the light chain variable domain may comprise the amino acid sequence shown as SEQ ID NO: 334 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto.
- Embodiments wherein the amino acid sequence of the VH domain exhibits less than 100% sequence identity with the sequence shown as SEQ ID NO: 333 may nevertheless comprise heavy chain CDRs which are identical to HCDR1, HCDR2 and HCDR3 of SEQ ID NO:333 (SEQ ID NOs:280, 281 and 282, respectively) whilst exhibiting amino acid sequence variation within the framework regions.
- embodiments wherein the amino acid sequence of the VL domain exhibits less than 100% sequence identity with the sequence shown as SEQ ID NO: 334 may nevertheless comprise light chain CDRs which are identical to LCDR1, LCDR2 and LCDR3 of SEQ ID NO:334 (SEQ ID NOs:292, 293 and 294, respectively) whilst exhibiting amino acid sequence variation within the framework regions.
- the antibody may comprise a heavy chain variable domain and a light chain variable domain wherein HCDR1 comprises SEQ ID NO: 353, HCDR2 comprises SEQ ID NO: 354, HCDR3 comprises SEQ ID NO: 355, and LCDR1 comprises SEQ ID NO: 356, LCDR2 comprises SEQ ID NO: 357, and LCDR3 comprises SEQ ID NO: 358.
- the heavy chain variable domain may comprise the amino acid sequence shown as SEQ ID NO: 367 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto
- the light chain variable domain may comprise the amino acid sequence shown as SEQ ID NO: 368 or an amino acid sequence exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity thereto.
- Embodiments wherein the amino acid sequence of the VH domain exhibits less than 100% sequence identity with the sequence shown as SEQ ID NO: 367 may nevertheless comprise heavy chain CDRs which are identical to HCDR1, HCDR2 and HCDR3 of SEQ ID NO:367 (SEQ ID NOs:353, 354 and 355, respectively) whilst exhibiting amino acid sequence variation within the framework regions.
- amino acid sequence of the VL domain exhibits less than 100% sequence identity with the sequence shown as SEQ ID NO: 368 may nevertheless comprise light chain CDRs which are identical to LCDR1, LCDR2 and LCDR3 of SEQ ID NO:368 (SEQ ID NOs:356, 357 and 358, respectively) whilst exhibiting amino acid sequence variation within the framework regions.
- the invention also provides polynucleotide molecules encoding the TIGIT antibodies of the invention, also expression vectors containing a nucleotide sequences which encode the TIGIT antibodies of the invention operably linked to regulatory sequences which permit expression of the antigen binding polypeptide in a host cell or cell-free expression system, and a host cell or cell-free expression system containing this expression vector.
- Polynucleotide molecules encoding the TIGIT antibodies of the invention include, for example, recombinant DNA molecules.
- nucleic acids or polynucleotides are “isolated”.
- nucleic acid molecule refers to a nucleic acid molecule that is separated from sequences with which it is immediately contiguous in the naturally occurring genome of the organism in which it originated.
- an “isolated nucleic acid” may comprise a DNA molecule inserted into a vector, such as a plasmid or virus vector, or integrated into the genomic DNA of a prokaryotic or eukaryotic cell or non-human host organism.
- isolated polynucleotide refers primarily to an RNA molecule encoded by an isolated DNA molecule as defined above.
- RNA RNA molecule that has been purified/separated from other nucleic acids with which it would be associated in its natural state (i.e., in cells or tissues).
- An isolated polynucleotide (either DNA or RNA) may further represent a molecule produced directly by biological or synthetic means and separated from other components present during its production.
- a recombinant polynucleotide encoding it may be prepared (using standard molecular biology techniques) and inserted into a replicable vector for expression in a chosen host cell, or a cell-free expression system.
- Suitable host cells may be prokaryote, yeast, or higher eukaryote cells, specifically mammalian cells.
- useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen. Virol.
- mice myeloma cells SP2/0-AG14 ATCC CRL 1581; ATCC CRL 8287 or NS0 (HPA culture collections no. 85110503)
- monkey kidney cells CV1 ATCC CCL 70
- African green monkey kidney cells VOD-76, ATCC CRL-1587
- human cervical carcinoma cells HELA, ATCC CCL 2
- canine kidney cells MDCK, ATCC CCL 34
- buffalo rat liver cells BRL 3A, ATCC CRL 1442
- human lung cells W138, ATCC CCL 75
- human liver cells Hep G2, HB 8065
- mouse mammary tumour MMT 060562, ATCC CCL51
- TRI cells Mather et al., Annals N.Y.
- host cell generally refers to a cultured cell line. Whole human beings into which an expression vector encoding an antigen binding polypeptide according to the invention has been introduced are explicitly excluded from the definition of a “host cell”.
- the invention also provides a method of producing a TIGIT antibody of the invention which comprises culturing a host cell (or cell free expression system) containing polynucleotide (e.g. an expression vector) encoding the TIGIT antibody under conditions which permit expression of the TIGIT antibody, and recovering the expressed TIGIT antibody.
- a host cell or cell free expression system
- polynucleotide e.g. an expression vector
- This recombinant expression process can be used for large scale production of TIGIT antibodies according to the invention, including monoclonal antibodies intended for human therapeutic use.
- Suitable vectors, cell lines and production processes for large scale manufacture of recombinant antibodies suitable for in vivo therapeutic use are generally available in the art and will be well known to the skilled person.
- an isolated polynucleotide or combination of isolated polynucleotides encoding an antibody or antigen binding fragment comprising a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, wherein the combination is selected from the group consisting of:
- HCDR1 comprising SEQ ID NO: 16, HCDR2 comprising SEQ ID NO: 17, HCDR3 comprising SEQ ID NO:18, LCDR1 comprising SEQ ID NO:61, LCDR2 comprising SEQ ID NO:62, and LCDR3 comprising SEQ ID NO:63;
- HCDR1 comprising SEQ ID NO:4, HCDR2 comprising SEQ ID NO:5, HCDR3 comprising SEQ ID NO:6, LCDR1 comprising SEQ ID NO:49, LCDR2 comprising SEQ ID NO:50, and LCDR3 comprising SEQ ID NO:51;
- HCDR1 comprising SEQ ID NO:7
- HCDR2 comprising SEQ ID NO:8
- HCDR3 comprising SEQ ID NO:9
- LCDR1 comprising SEQ ID NO:52
- LCDR2 comprising SEQ ID NO:53
- LCDR3 comprising SEQ ID NO:54;
- HCDR1 comprising SEQ ID NO:10, HCDR2 comprising SEQ ID NO:11, HCDR3 comprising SEQ ID NO:12, LCDR1 comprising SEQ ID NO:55, LCDR2 comprising SEQ ID NO:56, and LCDR3 comprising SEQ ID NO:57;
- HCDR1 comprising SEQ ID NO:13, HCDR2 comprising SEQ ID NO:14, HCDR3 comprising SEQ ID NO:15, LCDR1 comprising SEQ ID NO:58, LCDR2 comprising SEQ ID NO:59, and LCDR3 comprising SEQ ID NO:60;
- HCDR1 comprising SEQ ID NO:1, HCDR2 comprising SEQ ID NO:2, HCDR3 comprising SEQ ID NO:3, LCDR1 comprising SEQ ID NO:46, LCDR2 comprising SEQ ID NO:47, and LCDR3 comprising SEQ ID NO:48;
- HCDR1 comprising SEQ ID NO:19, HCDR2 comprising SEQ ID NO:20, HCDR3 comprising SEQ ID NO:21, LCDR1 comprising SEQ ID NO:64, LCDR2 comprising SEQ ID NO:65, and LCDR3 comprising SEQ ID NO:66;
- HCDR1 comprising SEQ ID NO:22, HCDR2 comprising SEQ ID NO:23, HCDR3 comprising SEQ ID NO:24, LCDR1 comprising SEQ ID NO:67, LCDR2 comprising SEQ ID NO:68, and LCDR3 comprising SEQ ID NO:69;
- HCDR1 comprising SEQ ID NO:25, HCDR2 comprising SEQ ID NO:26, HCDR3 comprising SEQ ID NO:27, LCDR1 comprising SEQ ID NO:70, LCDR2 comprising SEQ ID NO:71, and LCDR3 comprising SEQ ID NO:72;
- HCDR1 comprising SEQ ID NO:28, HCDR2 comprising SEQ ID NO:29, HCDR3 comprising SEQ ID NO:30, LCDR1 comprising SEQ ID NO:73, LCDR2 comprising SEQ ID NO:74, and LCDR3 comprising SEQ ID NO:75;
- HCDR1 comprising SEQ ID NO:31
- HCDR2 comprising SEQ ID NO:32
- HCDR3 comprising SEQ ID NO:33
- LCDR1 comprising SEQ ID NO:76
- LCDR2 comprising SEQ ID NO:77
- LCDR3 comprising SEQ ID NO:78;
- HCDR1 comprising SEQ ID NO:34, HCDR2 comprising SEQ ID NO:35, HCDR3 comprising SEQ ID NO:36, LCDR1 comprising SEQ ID NO:79, LCDR2 comprising SEQ ID NO:80, and LCDR3 comprising SEQ ID NO:81;
- HCDR1 comprising SEQ ID NO:37, HCDR2 comprising SEQ ID NO:38, HCDR3 comprising SEQ ID NO:39, LCDR1 comprising SEQ ID NO:82, LCDR2 comprising SEQ ID NO:83, and LCDR3 comprising SEQ ID NO:84;
- HCDR1 comprising SEQ ID NO:40, HCDR2 comprising SEQ ID NO:41, HCDR3 comprising SEQ ID NO:42, LCDR1 comprising SEQ ID NO:85, LCDR2 comprising SEQ ID NO:86, and LCDR3 comprising SEQ ID NO:87;
- HCDR1 comprising SEQ ID NO:43, HCDR2 comprising SEQ ID NO:44, HCDR3 comprising SEQ ID NO:45, LCDR1 comprising SEQ ID NO:88, LCDR2 comprising SEQ ID NO:89, and LCDR3 comprising SEQ ID NO:90;
- HCDR1 comprising SEQ ID NO:271, HCDR2 comprising SEQ ID NO:272, HCDR3 comprising SEQ ID NO:273, LCDR1 comprising SEQ ID NO:283, LCDR2 comprising SEQ ID NO:284, and LCDR3 comprising SEQ ID NO:285;
- HCDR1 comprising SEQ ID NO:274, HCDR2 comprising SEQ ID NO:275, HCDR3 comprising SEQ ID NO:276, LCDR1 comprising SEQ ID NO:286, LCDR2 comprising SEQ ID NO:287, and LCDR3 comprising SEQ ID NO:288;
- HCDR1 comprising SEQ ID NO:277, HCDR2 comprising SEQ ID NO:278, HCDR3 comprising SEQ ID NO:279, LCDR1 comprising SEQ ID NO:289, LCDR2 comprising SEQ ID NO:290, and LCDR3 comprising SEQ ID NO:291.
- an isolated polynucleotide or combination of isolated polynucleotides encoding an antibody or antigen binding fragment comprising a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3 wherein: (i) HCDR1 comprises or consists of SEQ ID NO: 16, HCDR2 comprises or consists of SEQ ID NO: 17, HCDR3 comprises or consists of SEQ ID NO:18, LCDR1 comprises or consists of SEQ ID NO:61, LCDR2 comprises or consists of SEQ ID NO:62, and LCDR3 comprises or consists of SEQ ID NO:63.
- an isolated polynucleotide or combination of isolated polynucleotides encoding an antibody or antigen binding fragment described herein.
- an isolated polynucleotide encoding antibody 31282 provided herein, or an antigen binding fragment thereof is provided.
- an isolated polynucleotide encoding a VH and/or a VL domain of an anti-TIGIT antibody, wherein the polynucleotide comprises one or more sequences selected from the group consisting of SEQ ID Nos: 241-270, 335-342 and 369-370.
- the isolated polynucleotide comprises a sequence according to SEQ ID NO: 251 and/or a sequence according to SEQ ID NO: 252.
- the sequences are contiguous.
- the sequences are not contiguous.
- an expression vector comprising a polynucleotide according to the invention operably linked to regulatory sequences which permit expression of the antigen binding polypeptide in a host cell or cell-free expression system.
- a host cell or cell-free expression system containing an expression vector according to the invention.
- a method of producing a recombinant antibody or antigen binding fragment thereof which comprises culturing the host cell or cell free expression system according to the invention under conditions which permit expression of the antibody or antigen binding fragment and recovering the expressed antibody or antigen binding fragment.
- compositions comprising an antibody or antigen binding fragment according to the invention formulated with one or more a pharmaceutically acceptable carriers or excipients.
- Such compositions may include one or a combination of (e.g., two or more different) TIGIT antibodies. Techniques for formulating antibodies for human therapeutic use are well known in the art and are reviewed, for example, in Wang et al., Journal of Pharmaceutical Sciences, Vol. 96, pp 1-26, 2007.
- TIGIT antibodies and pharmaceutical compositions provided herein have utility in therapy, in particular the therapeutic treatment of disease, in particular conditions that benefit from inhibition of TIGIT function.
- the antibodies of the invention or antigen binding fragments thereof are particularly effective when administered in combination with immune checkpoint inhibitors—specifically anti-ICOS antagonist antibodies or anti-PD-1 antibodies (that is, antagonist antibodies specific for human immunoregulatory molecule PD-1).
- immune checkpoint inhibitors specifically anti-ICOS antagonist antibodies or anti-PD-1 antibodies (that is, antagonist antibodies specific for human immunoregulatory molecule PD-1).
- Administration of anti-TIGIT antibodies in combination with an anti-ICOS or anti-PD-1 antibody results in a synergistic reduction in tumour growth compared to either antibody alone. Similar effects are expected to be observed using a combination of an anti-TIGIT antibody according to the invention and an anti-PD-L1 antibody.
- antibodies of the invention or antigen binding fragments thereof are particularly effective when administered in combination with an agonist antibody specific to an immune checkpoint co-stimulatory molecule—specifically anti-4-1BB, anti-OX40 or anti-GITR agonist antibodies.
- Administration of anti-TIGIT antibodies in combination with an anti-4-1BB, anti-OX40 or anti-GITR agonist antibody results in a synergistic reduction in tumour growth compared to either antibody alone.
- a combination product comprising an anti-TIGIT antibody or antigen binding fragment thereof and one or more of a chemotherapeutic agent, an anti-PD1 antibody, an anti-PD-L1 antibody, an anti-41BB antibody, an anti-OX40 antibody, an anti-GITR antibody, and an anti-ICOS antibody.
- the anti-TIGIT antibody or antigen binding fragment is an antibody or antigen binding fragment provided in accordance with the invention.
- the anti-TIGIT antibody or antigen binding fragment comprises a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, wherein:
- HCDR1 comprises SEQ ID NO: 16 (YTFTSYYMH), HCDR2 comprises SEQ ID NO: 17 (VIGPSGASTSYAQKFQG), HCDR3 comprises SEQ ID NO: 18 (ARDHSDYWSGIMEV), LCDR1 comprises SEQ ID NO: 61 (RASQSVRSSYLA), LCDR2 comprises SEQ ID NO: 62 (GASSRAT), and LCDR3 comprises SEQ ID NO: 63 (QQYFSPPWT).
- a combination as provided herein for use in a method of treating cancer or viral infection optionally wherein the viral infection is CMV infection.
- a combination as provided herein for use in a method provided herein is also provided.
- TIGIT antibodies, or antigen binding fragments thereof and pharmaceutical compositions provided herein can be used to inhibit the growth of cancerous tumour cells in vivo and are therefore useful in the treatment of tumours.
- aspects of the invention relate to methods of inhibiting tumour cell growth in a human patient, and also methods of treating or preventing cancer, which comprise administering to a patient in need thereof an effective amount of a TIGIT antibody or antigen binding fragment as described herein, a pharmaceutical composition as described herein, or a combination as described herein.
- Another aspect of the invention provides a TIGIT antibody or antigen binding fragment as described herein for use in inhibiting the growth of tumour cells in a human patient.
- a still further aspect of the invention provides a TIGIT antibody or antigen binding fragment as described herein for use treating or preventing cancer in a human patient.
- the invention provides a method of selectively depleting Treg cells in a cancer patient, the method comprising administering an anti-TIGIT antibody or antigen-binding fragment thereof to the patient.
- the anti-TIGIT antibody binds at an epitope on human TIGIT comprising residues Q56, N58, E60, 168 L73, H76, and 1109, preferably consisting of residues Q56, N58, E60, 168 L73, H76, and I109.
- the anti-TIGIT antibody is an anti-TIGIT antibody provided herein.
- the anti-TIGIT antibody comprises a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, wherein: HCDR1 comprises or consists SEQ ID NO: 16 (YTFTSYYMH), HCDR2 comprises or consists SEQ ID NO: 17 (VIGPSGASTSYAQKFQG), HCDR3 comprises or consists SEQ ID NO: 18 (ARDHSDYWSGIMEV), LCDR1 comprises or consists SEQ ID NO: 61 (RASQSVRSSYLA), LCDR2 comprises or consists SEQ ID NO: 62 (GASSRAT), and LCDR3 comprises or consists SEQ ID NO: 63 (QQYFSPPWT).
- HCDR1 comprises or consists SEQ ID NO: 16 (YTFTSYYMH)
- HCDR2 comprises or consists SEQ ID NO: 17 (VIGPSGASTSYAQKFQG)
- HCDR3 comprises or consists SEQ ID NO: 18 (ARDHSDYWSGIMEV)
- the patient to be treated has a cancer selected from: renal cancer (e.g., renal cell carcinoma), breast cancer, brain tumours, chronic or acute leukaemias including acute myeloid leukaemia, chronic myeloid leukaemia, acute lymphoblastic leukaemia, chronic lymphocytic leukaemia, lymphomas (e.g., Hodgkin's and non-Hodgkin's lymphoma, lymphocytic lymphoma, primary CNS lymphoma, B-cell lymphoma (e.g. CLL), T-cell lymphoma (e.g.
- renal cancer e.g., renal cell carcinoma
- breast cancer e.g., brain tumours
- chronic or acute leukaemias including acute myeloid leukaemia, chronic myeloid leukaemia, acute lymphoblastic leukaemia, chronic lymphocytic leukaemia, lymphomas (e.g., Hodgkin's and non-Hodgkin's lymph
- nasopharyngeal carcinomas e.g., melanoma (e.g., metastatic malignant melanoma), prostate cancer, colon cancer, lung cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck (e.g.
- HNSCC head and neck squamous cell carcinoma
- cutaneous carcinoma cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, cancer of the oesophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, solid tumours of childhood, cancer of the bladder, cancer of the kidney or ureter, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), tumour angiogenesis, spinal axis tumour, brain stem glioma, pituitary adenoma, Kaposi's sarcom
- the cancer inhibited is lung cancer, bladder cancer, breast cancer, kidney cancer (for example kidney carcinoma), head and neck cancer (e.g. HNSCC), or colon cancer (for example colon adenocarcinoma).
- the cancer is colon cancer (for example colon adenocarcinoma) or lung cancer.
- the cancer is a blood cancer.
- the cancer is lymphoma.
- the cancer is T cell lymphoma or B cell lymphoma.
- the method of treating cancer further comprises administration of an additional therapeutic agent, for example a chemotherapeutic agent.
- an additional therapeutic agent for example a chemotherapeutic agent.
- the antibodies of the invention or antigen binding fragments thereof are particularly effective when administered in combination with immune checkpoint inhibitors—specifically anti-ICOS antagonist antibodies or anti-PD-1 antibodies (that is, antagonist antibodies specific for human immunoregulatory molecule PD-1).
- immune checkpoint inhibitors specifically anti-ICOS antagonist antibodies or anti-PD-1 antibodies (that is, antagonist antibodies specific for human immunoregulatory molecule PD-1).
- Administration of anti-TIGIT antibodies in combination with an anti-ICOS or anti-PD-1 antibody results in a synergistic reduction in tumour growth compared to either antibody alone. Similar effects are expected to be observed using a combination of an anti-TIGIT antibody according to the invention and an anti-PD-L1 antibody.
- antibodies of the invention or antigen binding fragments thereof are particularly effective when administered in combination with an agonist antibody specific to an immune checkpoint co-stimulatory molecule—specifically anti-4-1BB, anti-OX40 or anti-GITR agonist antibodies.
- Administration of anti-TIGIT antibodies in combination with an anti-4-1BB, anti-OX40 or anti-GITR agonist antibody results in a synergistic reduction in tumour growth compared to either antibody alone.
- a method of treating cancer in a subject comprising administering to the subject an effective amount of an anti-TIGIT antibody or antigen binding fragment thereof according to the invention and also administering an effective amount of an anti-PD-1 antibody, an anti-PD-L1 antibody, an anti-41BB antibody, an anti-OX40 antibody, and anti GITR antibody, or an anti-ICOS antibody.
- ⁇ T cells are known to be important in the response to infection, for example bacterial, fungal or viral infection.
- ⁇ T cells from CMV seropositive subjects exhibit markedly increased activation, characterised by an increase in IFNg section.
- the ability to promote activation of ⁇ T cells in CMV patients in this manner indicates that administration of an anti-TIGIT antibody will promote the antiviral activity of the ⁇ T cells.
- a method of treating viral infection in a subject comprising administering an effective amount of an anti-TIGIT antibody or antigen-binding fragment thereof. Also provided is a method of treating viral infection in a subject comprising administering an effective amount of an anti-TIGIT antibody or antigen-binding fragment or a pharmaceutical composition provided herein to the subject, thereby treating the viral infection.
- the viral infection is CMV infection.
- the method further comprises administration of one or more additional therapeutic agents.
- the one or more therapeutic agents are selected from: an anti-PD1 antibody, an anti-PD-L1 antibody, an anti-41BB antibody, an anti-OX40 antibody, an anti GITR antibody, and an anti-ICOS antibody.
- the anti-TIGIT antibodies disclosed herein are effective at promoting T cell activity, especially pro-inflammatory T cell activity.
- T ell activity can be measured by methods familiar to those of skill in the art, for example by measuring IFNg production as described in the Examples.
- a method of promoting T cell activity comprising contacting a population of T cells with an antibody or antigen binding fragment as described herein.
- the method of promoting T cell activity is performed in vitro. In certain embodiments, the method of promoting T cell activity is performed in vivo in a human subject. In certain such embodiments, the human subject has cancer. In certain embodiments, the human subject has a viral infection, for example CMV infection.
- the method promotes conventional ⁇ T cell activity. In certain embodiments, the method promotes CD4 T cell activity. In certain embodiments, the method promotes CD8 T cell activity. In certain embodiments, the method promotes ⁇ (gamma-delta) T cell activity.
- the anti-TIGIT antibodies disclosed herein will be especially effective at promoting T cell activity when used in combination with an anti-PD1 antibody, an anti-PD-L1 antibody, an anti-41BB antibody, an anti-OX40 antibody, an anti GITR antibody, or an anti-ICOS antibody.
- the combination provides a synergistic (i.e. greater than additive) increase in T cell activity.
- the method of promoting T cell activity further comprises contacting the population of T cells with one or more of: an anti-PD1 antibody, an anti-PD-L1 antibody, an anti-41BB antibody, an anti-OX40 antibody, an anti GITR antibody, and an anti-ICOS antibody.
- TIGIT ABPs were selected from a synthetic library of human antibodies expressed and presented on the surface of yeast cells in IgG format generally as described, e.g., in WO2009036379; WO2010105256; WO2012009568; and Xu et al., Protein Eng Des Sel., Vol. 26(10), pp. 663-670 (2013)), and more specifically as provided below.
- the sequences and characteristics of the ABPs isolated from the recombinant library are provided in FIGS. 1 to 6 .
- yeast cells ⁇ 1010 cells/library were incubated with biotinylated TIGIT-Fc antigen (Creative Biomart) in FACS wash buffer (phosphate-buffered saline (PBS)/0.1% bovine serum albumin (BSA)).
- PBS phosphate-buffered saline
- BSA bovine serum albumin
- the cell pellet was resuspended in 40 mL wash buffer, and Streptavidin MicroBeads (500 ⁇ l) were added to the yeast and incubated for 15 min at 4° C. Next, the yeast were pelleted, resuspended in 5 mL wash buffer, and loaded onto a Miltenyi LS column. After the 5 mL was loaded, the column was washed 3 times with 3 ml FACS wash buffer. The column was then removed from the magnetic field, and the yeast were eluted with 5 mL of growth media and then grown overnight. The following rounds of sorting were performed using flow cytometry.
- na ⁇ ve clones were carried out utilizing three maturation strategies: light chain diversification; diversification of HCDR1 and HCDR2; and diversification of HCDR3 within the selected HCDR1 and HCDR2 diversity pools.
- Heavy chain variable regions were extracted from na ⁇ ve outputs (described above) and transformed into a light chain library with a diversity of 1 ⁇ 106. Selections were performed as described above with one round of MACS sorting and three rounds of FACS sorting using 10 nM or 1 nM biotinylated TIGIT-HIS antigen (Creative Biomart) for respective rounds.
- HCDR1 and HCDR2 selection The HCDR3s from clones selected from the light chain diversification procedure were recombined into a premade library with HCDR1 and HCDR2 variants of a diversity of 1 ⁇ 108 and selections were performed using monomeric HIS-TIGIT antigen. Affinity pressures were applied by using decreasing concentrations of biotinylated HIS-TIGIT antigen (100 to 1 nM) under equilibrium conditions at room temperature.
- HCDR3/HCDR1/HCDR2 selections Oligos were ordered from IDT which comprised the HCDR3 as well as a homologous flanking region on either side of the HCDR3. Amino acid positions in the HCDR3 were variegated via NNK diversity at two positions per oligo across the entire HCHR3. The HCDR3 oligos were double-stranded using primers which annealed to the flanking region of the HCDR3. The remaining FWR1 to FWR3 of the heavy chain variable region was amplified from pools of antibodies with improved affinity that were isolated from the HCDR1 and HCDR2 diversities selected above.
- the library was then created by transforming the double stranded HCDR3 oligo, the FWR1 to FWR3 pooled fragments, and the heavy chain expression vector into yeast already containing the light chain of the original na ⁇ ve parent. Selections were performed as during previous cycles using FACS sorting for four rounds. For each FACS round the libraries were assessed for PSR binding, species cross-reactivity, and affinity pressure, and sorting was performed to obtain populations with the desired characteristics. Affinity pressures for these selections were performed as described above in the HCDR1 and HCDR2 selection.
- yeast clones were grown to saturation and then induced for 48 h at 30° C. with shaking. After induction, yeast cells were pelleted and the supernatants were harvested for purification. IgGs were purified using a Protein A column and eluted with acetic acid, pH 2.0. Fab fragments were generated by papain digestion and purified in a two steps process over Protein A (GE LifeSciences) and KappaSelect (GE Healthcare LifeSciences).
- DNA vector coding for specific antibody clones were generated and transduced into HEK cells.
- Human codon optimized synthetic DNA fragments for antibody variable domains were ordered at Geneart.
- Variable domain sequences were seamlessly ligated into pUPE expression vectors containing the mouse IgKappa signal sequence and constant regions of the respective antibody class.
- Expression vectors were verified by restriction analysis and DNA sequencing.
- Endotoxin free DNA maxipreps Sigma
- heavy and light chain vectors were co-transfected to HEK293EBNA1 cells, in Freestyle medium (ThermoFisherScientific), according to established protocols.
- the antibodies were further purified by gel-filtration using a Superdex200 column, equilibrated in PBS. Fractions were analysed by NuPAGE and antibody containing fractions were pooled. The final products were sterilized over a 0.22 ⁇ M syringe filter. The product was analysed by NuPAGE and endotoxin levels were measured by LAL-assay.
- ForteBio affinity measurements of selected antibodies were performed generally as previously described (see, e.g., Estep et al., Mabs, Vol. 5(2), pp. 270-278 (2013)). Briefly, ForteBio affinity measurements were performed by loading IgGs on-line onto AHQ sensors. Sensors were equilibrated off-line in assay buffer for 30 min and then monitored on-line for 60 seconds for baseline establishment. Sensors with loaded IgGs were exposed to 100 nM antigen (human TIGIT-Fc, human TIGIT-His or cyno TIGIT-Fc) for 5 minutes, afterwards they were transferred to assay buffer for 5 min for off-rate measurement. Kinetics were analyzed using the 1:1 binding model. More than 90 antibodies were tested for affinity by ForteBio and Table 3 provides data for 15 selected anti-TIGIT antibodies demonstrating strong binding to recombinant TIGIT protein.
- Biosensor analysis was conducted at 25° C. in a HBS-EP buffer system (10 mM HEPES pH 7.3, 150 mM NaCl, 3 mM EDTA, 0.05% Surfactant P20) using a Biacore 8K optical biosensor docked with a CMS sensor chip (GE Healthcare, Marlboro, Mass.).
- the sample hotel was maintained at 8° C.
- Goat anti-human IgG capture antibody Fc ⁇ fragment specific, Jackson ImmunoResearch Laboratories, Inc., West Grove, Pa.; 109-005-098
- This surface type provided a format for reproducibly capturing fresh analysis antibody after each regeneration step.
- Flow cell 2 was used to analyze captured antibody (60-90 RU) while flow cell 1 was used as a reference flow cell.
- Antigen concentrations ranging from 30 to 0.123 nM (3-fold dilutions) were prepared in running buffer. Each of the antigen sample concentrations were run as a single replicate. Two blank (buffer) injections also were run and used to assess and subtract system artefacts. The association (300 s) and dissociation (600 s) phases for all antigen concentrations were performed at a flow rate of 30 uL/min. The surface was regenerated with three sequential injections (15 s, 15 s and 60 s) of 10 mM glycine, pH 1.5 at a flow rate of 30 uL/min.
- Biacore Monovalent KD (M) (IgG on CM5 chip, Human TIGIT-HIS in solution Clone (Starting concentration 25 nM, 3x dilution) 29489 2.48E ⁇ 10 31282 2.94E ⁇ 10 29494 2.70E ⁇ 10 29520 7.16E ⁇ 10 29527 1.20E ⁇ 09 31288 1.92E ⁇ 10
- Epitope binning/ligand blocking of selected antibodies was performed using a standard sandwich format cross-blocking assay. Control anti-target IgG was loaded onto AHQ sensors and unoccupied Fc-binding sites on the sensor were blocked with an irrelevant human IgG1 antibody. The sensors were then exposed to 100 nM target antigen (hTIGIT, Creative Biomart) followed by a second anti-target antibody or ligand (anti-TIGIT antibody and CD155 or CD113 or CD112). Data was processed using ForteBio's Data Analysis Software 7.0. Additional binding by the second antibody or ligand after antigen association indicates an unoccupied epitope (non-competitor), while no binding indicates epitope blocking (competitor or ligand blocking).
- Parental antibodies (before optimization) were tested for competition with natural ligands and Table 6 summarizes the data obtained for competition against CD155, CD112 and CD113. Parental clone 26432 was found not to compete with CD155 for TIGIT binding. All other selected anti-TIGIT antibodies compete with natural ligand for binding to recombinant human TIGIT protein.
- Jurkat cells overexpressing human TIGIT (Jurkat-hTIGIT) were collected and distributed at 10 5 cells/well and incubated with anti-human TIGIT antibodies at the following concentrations: 166.6; 53.24; 17.01; 5.43; 1.73; 0.55; 0.17; 0.05; 0.01; 5.78 ⁇ 10 ⁇ 3 ; 1.85 ⁇ 10 ⁇ 3 ; 5.9 ⁇ 10 ⁇ 3 nM in complete medium during 45 min at 37° C. Excess of antibody was washed, and then the cells were incubated with CD155-His at 5 ⁇ g/ml (Creative Biomart, PVR-3141H) for 45 min at 37° C.
- CD155-His was detected using anti-His tag-PE (Biolegend, 362603, at 2 ⁇ l per test), incubated for 30 min at 4° C.
- Cells were analysed by FACS using BD LSRFortessa and the half concentration (IC50) that prevents CD155 binding was calculated on the basis of the geometric mean fluorescence.
- results were as follows: 0.101 nM for clone 29489; 0.07 nM for clone 29494; 0.102 nM for clone 29520 and 0.078 nM for clone 29527, for the results illustrated in FIG. 7 .
- the values of other tested antibodies are summarized in the Table 7 below. Overall, the results demonstrate a strong competition by the tested antagonistic anti-TIGIT antibodies with CD155 for binding to membrane expressed TIGIT.
- Anti-TIGIT IgG1 antibody samples were buffer exchanged into 1 M ammonium sulfate and 0.1 M sodium phosphate at pH 6.5 using a Zeba 40 kDa 0.5 mL spin column (Thermo Pierce, cat #87766).
- a salt gradient was established on a Dionex ProPac HIC-10 column from 1.8 M ammonium sulfate, 0.1 M sodium phosphate at pH 6.5 to the same condition without ammonium sulfate.
- the gradient ran for 17 min at a flow rate of 0.75 ml/min.
- An acetonitrile wash step was added at the end of the run to remove any remaining protein and the column was re-equilibrated over 7 column volumes before the next injection cycle. Peak retention times were monitored at A280 absorbance and concentrations of ammonium sulfate at elution were calculated based on gradient and flow rate.
- Table 8 summarizes the results obtained for 15 selected anti-TIGIT antibodies.
- Polyspecificity reagent was prepared according to Xu et.al, mAbs 2013. In brief, 2.5 liters CHO-S cells were used as starting material. The cells were pelleted at 2,400 ⁇ g for 5 min in 500 mL centrifuge bottles filled to 400 mL. Cell pellets were combined and then resuspended in 25 ml Buffer B and pelleted at 2,400 ⁇ g for 3 min. The buffer was decanted and the wash repeated one time. Cell pellets were resuspended in 3 ⁇ the pellet volume of Buffer B containing 1 ⁇ protease inhibitors (Roche, cOmplete, EDTA-free) using a polytron homogenizer with the cells maintained on ice.
- PSR Polyspecificity reagent
- the homogenate was then centrifuged at 2,400 ⁇ g for 5 min and the supernatant retained and pelleted one additional time (2,400 ⁇ g/5 min) to ensure the removal of unbroken cells, cell debris and nuclei; the resultant supernatant is the total protein preparation.
- the supernatant was then transferred into two Nalgene Oak Ridge 45 mL centrifuge tubes and pelleted at 40,000 ⁇ g for 40 min at 4° C.
- the supernatants containing the Separated Cytosolic Proteins (SCPs) were then transferred into clean Oak Ridge tubes, and centrifuged at 40,000 ⁇ g one more time.
- the pellets containing the membrane fraction (EMF) were retained and centrifuged at 40,000 for 20 min to remove residual supernatant.
- the EMF pellets were then rinsed with Buffer B. 8 mL Buffer B was then added to the membrane pellets to dislodge the pellets and transfer into a Dounce Homogenizer. After the pellets were homogenized, they were transferred to a 50 mL conical tube and represented the final EMF preparation.
- One billion mammalian cells e.g. CHO, HEK293, Sf9 at ⁇ 106-107 cells/mL were transferred from tissue culture environment into 4 ⁇ 250 mL conical tubes and pelleted at 550 ⁇ g for 3 min. All subsequent steps were performed at 4° C. or on ice with ice-cold buffers. Cells were washed with 100 mL of PBSF (1 ⁇ PBS+1 mg/mL BSA) and combined into one conical tube.
- PBSF PBSF+1 mg/mL BSA
- the cell pellet was then re-suspended in 30 mL Buffer B (50 mM HEPES, 0.15 M NaCl, 2 mM CaCl2, 5 mM KCl, 5 mM MgCl2, 10% Glycerol, pH 7.2) and pelleted at 550 ⁇ g for 3 min. Buffer B supernatant was decanted and cells re-suspended in 3 ⁇ pellet volume of Buffer B plus 2.5 ⁇ protease inhibitor (Roche, cOmplete, EDTA-free). Protease inhibitors in Buffer B were included from here on forward.
- Buffer B 50 mM HEPES, 0.15 M NaCl, 2 mM CaCl2, 5 mM KCl, 5 mM MgCl2, 10% Glycerol, pH 7.2
- Cells were homogenized four times for 30 sec pulses (Polyton homogenizer, PT1200E) and the membrane fraction was pelleted at 40,000 ⁇ g for 1 hour at 4 C.
- the pellet is rinsed with 1 mL Buffer B; the supernatant is retained and represents the s.
- the pellet is transferred into a Dounce homogenizer with 3 mL of Buffer B and re-suspended by moving the pestle slowly up and down for 30-35 strokes.
- the enriched membrane fraction (EMF) is moved into a new collection tube, rinsing the pestle to collect all potential protein. Determine the protein concentration of the purified EMF using the Dc-protein assay kit (BioRad).
- Solubilization Buffer 50 mM HEPES, 0.15 M NaCl, 2 mM CaCl2, 5 mM KCl, 5 mM MgCl2, 1% n-Dodecyl-b-D-Maltopyranoside (DDM), 1 ⁇ protease inhibitor, pH 7.2
- Solubilization Buffer 50 mM HEPES, 0.15 M NaCl, 2 mM CaCl2, 5 mM KCl, 5 mM MgCl2, 1% n-Dodecyl-b-D-Maltopyranoside (DDM), 1 ⁇ protease inhibitor, pH 7.2
- Biotinylation For biotinylation, prepare the NHS-LC-Biotin stock solution according to manufacturer's protocol (Pierce, Thermo Fisher). In brief, 20 ul of biotin reagent is added for every 1 mg of EMF sample and incubated at 4° C. for 3 hours with gentle agitation. Adjust the volume to 25 mL with Buffer B and transfer to an Oak Ridge centrifuge tube. Pellet the biotinylated EMF (b-EMF) at 40,000 ⁇ g for 1 hour, and rinse two times with 3 mL of Buffer C (Buffer B minus the glycerol) without disturbing the pellet. Remove the residual solution. The pellet was re-suspended with a Dounce homogenizer in 3 mL of Buffer C as described previously. The re-suspended pellet now represents biotinylated EMF (b-EMF) and is solubilized as described above to prepare b-SMPs.
- b-EMF biotinylated E
- PSR analyses were carried out generally as described in WO2014/179363. Briefly, to characterize the PSR profile of monoclonal antibodies presented on yeast, two million IgG-presenting yeast were transferred into a 96-well assay plate and pellet at 3000 ⁇ g for 3 min to remove supernatant. Re-suspend the pellet in 50 ul of freshly prepared 1:10 dilution of stock b-PSRs and incubate on ice for 20 minutes. Wash the cells twice with 200 ul of cold PBSF and pellet re-suspended in 50 ul of secondary labeling mix (Extravidin-R-PE, anti-human LC-FITC, and propidium iodide).
- secondary labeling mix Extravidin-R-PE, anti-human LC-FITC, and propidium iodide.
- Flow cytometry analyses were performed to assess the expression of TIGIT on immune cell subsets in PBMC freshly isolated from healthy individuals.
- Conjugated antibodies were purchased from Ebioscience/Thermo Fisher Scientific, BioLegend or BD Biosciences. Cells were stained per manufacturer's instruction using filtered FACS buffer (PBS+2 mM EDTA+0.1% BSA) and Brilliant Stain buffer (BD #563794). Cells were blocked with appropriate Human FcBlock (BD #564220) prior to staining and were fixed using IC fixation buffer (eBioscience #00-8222-49) prior acquisition. Acquisition was performed on a FACS Fortessa (BD Biosciences) and analyzed with FlowJo software (FlowJo, LLC).
- TIGIT is preferentially expressed on NK cells, regulatory T cells and CD8 memory T cells. It is present to a lesser extent on other T cells subsets with a low proportion of na ⁇ ve T cells showing TIGIT expression. In addition, TIGIT is not expressed on monocytes, dendritic cells and B cells ( FIG. 8B ). This set of data is in agreement with published data (Yu et al. NI 2008 and Wang et al. EJI 2015).
- the affinity of human anti-TIGIT antibodies has been measured using Jurkat E6.1 cells transduced with human-TIGIT (Jurkat hTIGIT) or mouse TIGIT (Jurkat-mTIGIT).
- 10 5 cells were distributed per well and incubated with anti-TIGIT antibody at a single dose of 100 nM (Table 3) or with decreasing concentration (166.6; 53.24; 17.01; 5.43; 1.73; 0.55; 0.17; 0.05; 0.01; 5.78 ⁇ 10-3; 1.85 ⁇ 10-3; 5.9 ⁇ 10 ⁇ 3 nM) of selected antibodies ( FIG. 9 ).
- Antibodies were incubated with the cells for 20 min at 4° C. in FACS buffer.
- the half-maximal concentration of binding (EC50) to hTIGIT-Jurkat was calculated using a four-variable curve-fit equation in Prism, and the obtained values were the following ones: 0.082 nM for clone 29489; 0.07 nM for clone 29494; 0.119 nM for clone 29520 and 0.05 nM for clone 29527 for the data illustrated in FIG. 9 .
- the results demonstrate a strong binding to membrane expressed human TIGIT for the tested anti-TIGIT antibodies.
- Isolated human PBMCs from healthy volunteers were analysed for binding by antagonistic anti-TIGIT antibodies.
- Cells were distributed at 5 ⁇ 105 cells per well.
- Cells were incubated with anti-CD16 (Clone 3G8, BioLegend 302002), CD32 (Clone FLI8.26, BD Bioscience 557333) and CD64 (BD Bioscience 555525) at room temperature for 10 min, and the indicated anti-human TIGIT antibodies were directly added at a final concentration of: 12.65; 4; 1.26; 00.40; 0.126; 0.040; 0.12 and 4 ⁇ 10 ⁇ 3 nM in FACS buffer and incubated for 20 min at 4° C.
- FIGS. 10A and 10B anti-CD4-PercP-Cy5.5 (clone A161A1, BioLegend 357414); anti-CD8-BV510 (clone SK1, BD Bioscience 563919) and LVD efluor 520 (eBioscience 65-0867-14).
- anti-CD4-PercP-Cy5.5 clone A161A1, BioLegend 357414
- anti-CD8-BV510 clone SK1, BD Bioscience 563919
- LVD efluor 520 eBioscience 65-0867-14.
- LVD efluor 520 eBioscience 65-0867-14
- anti-TCRab-PercP-Cy5.5 Clone IP26, Biolegend 306723
- anti-CD4-BV510 Clone SK3, BD Horizon 562970
- anti-CD8-APC-Cy7 Clone SK1, Biolegend 344714
- anti-CD25-BV605 Clone 2A3, Biolegend 562660
- anti-CD127-APC A019D5, Biolegend 351316)
- anti-CCR7-BV421 Clone G043H7, Biolegend 353207)
- anti-CD45RO-PE-Cy7 Clone UCHL1, Biolegend 304229
- the EC50 value for binding to CD8+ human primary T cells was calculated using the % of positive TIGIT stained cells on gated LVD-CD8+ T cells ( FIGS. 10A and 10B ).
- the EC50 value for binding to human memory CD8+ or Treg primary T cells was calculated using the % of positive TIGIT stained cells on gated LVD-TCRab+CD45RO+CD8+ T cells (for memory CD8+ T cells) or on gated LVD-TCRab+CD127loCD25hiCD4+ T cells (for Tregs) and are illustrated in FIG. 10C .
- the EC50 value for binding to total human CD8+ T cells are 0.123 nM for clone 29489; 0.181 nM, for clone 29520 and 0.253 nM for clone 29527.
- Direct comparison between 29489 and 31282 (the 29489 mutant with a M to T mutation on residue 116) was performed, and the EC50 value was 0.057 nM and 0.086 nM respectively, demonstrating strong and similar binding efficacy to human primary CD8+ T cells for the 2 clones ( FIG. 10B ).
- the EC50 values obtained for binding to memory CD8+ T cells and Treg were 0.039 nM and 0.03 nM respectively, demonstrating a strong and similar affinity for both populations ( FIG. 10C ).
- Isolated PBMCs from Macaca fascicularis were obtained from BioPRIM. Cells were thawed and stimulated using the T cell activation/expansion kit for non-human primate (Miltenyi Biotec) at 1:2 (bead:cell ratio) following the manufacturer's specifications. The next day, cells were collected, counted and distributed at 5 ⁇ 104 cells per well.
- FIGS. 11A and 11B anti-CD4-PercP-Cy5.5 (clone A161A1, BioLegend 357414); anti-CD8-BV510 (clone SK1, BD Bioscience 563919), CD69-APC-Cy7 (Clone FN50, BioLegend, 310914) and LVD efluor 520 (eBioscience 65-0867-14). Stained cells were analysed by FACS using BD LSR Fortessa. The EC50 value of binding was calculated using the % of positive TIGIT stained cells gated on LVD-CD69+CD8+ T cells. As shown in FIG.
- the EC50 values for binding to cynomolgus CD8+ T cells were 0.487 nM for clone 29489, 1.73 nM for clone 29520 and 0.378 nM for clone 29527.
- Clones 29489 and 31282 (the 29489 mutant with a M to T mutation on residue 116) were compared as well, and the EC50 values were 0.25 nM and 0.26 nM respectively for the example shown in FIG. 11B , demonstrating a similar and strong affinity for cynomolgus primary CD8+ T cells for the 2 clones.
- TIGIT-overexpressing Jurkat cells can be induced by contact with CD155-expressing CHO-K1 cells upon TCR engagement on Jurkat cells and can be increased in presence of antagonistic anti-TIGIT antibody.
- the experiment was conducted in presence of increasing antibody concentrations and the EC50 values were calculated.
- Thaw-and-Use CD155 aAPC/CHO-K1 (Promega, CS198811) cells were seeded according to manufacturer's recommendations and incubated at 37° C., 5% CO2 incubator O/N. The day after, Thaw-and-Use TIGIT Effector cells (Promega, CS198811) were added according to manufacturer's recommendations to the CD155 aAPC/CHO-K1 cell plates containing fresh full medium with anti-TIGIT antibody at 133 nM ( FIG. 12A ) or increasing concentrations (0.22; 0.54; 1.36; 3.41; 8.53; 21.3; 53.3; 133.33; and 333 nM) of anti-TIGIT antibody ( FIG. 12B ) and incubated at 37° C., 5% CO2 during 6 hours.
- TIGIT Effector cell was assessed by measuring the luciferase activity by using Bio-GloTM Luciferase Assay System (Promega, G7941).
- FIG. 12A shows the effect of the addition of the selected clones on Luciferase signal as compared to isotype control.
- the data demonstrates the antagonistic activity of those antibodies that resulted in a stronger activation of Jurkat-hTIGIT cells.
- Table 10 summarizes the fold change induction in luciferase expression obtained for the different anti-TIGIT antibodies over the isotype control clone (03847).
- Jurkat-hTIGIT cell activation was assessed with anti-TIGIT antibody between 0.22 nM and 333 nM and gave an EC50 value of 3.0 nM for clone 29489; 4.4 nM for clone 29494; 2.3 nM for clone 29520 and 32 nM for clone 29527; 2.7 nM for clone 32919 and 3.2 nM for clone 32931 demonstrating a strong functional activity consecutive to blocking TIGIT inhibitory signalling.
- Clones 29489 and 31282 (the 29489 mutant with a M to T mutation on residue 116) were compared as well, and the EC50 values were respectively of 4.3 nM and 8.1 nM for the example shown in FIG. 12C , demonstrating a similar functional activity for the 2 clones.
- CD155 aAPC/CHO-K1 (Promega, CS198811) cells were seeded in U-bottom 96-well plates according to manufacturer's recommendations and incubated at 37° C., 5% CO2 incubator 0/N. The next day, CD8+ T cells were purified according to manufacturer's recommendations by using negative selection kit (Stemcell Technologies, 17953) from frozen human peripheral blood mononuclear cells isolated from total blood of healthy donors (Immunehealth).
- CD8 T cells Purified CD8 T cells were then incubated with increasing concentrations (0.11 nM, 0.33 nM, 1.06 nM, 3.3 nM, 10.6 nM, 33.3 nM, 105.5 nM and 333 nM) of antibodies (100,000 CD8 T cells/100 ul of full medium containing antibody) during 1 hour. After that, the antibody-CD8 mix was added to the CD155 aAPC/CHO-K1 cell plates containing 50 ⁇ 1 of fresh full medium and incubated at 37° C., 5% CO2 during 5 days. Finally, IFNg concentrations were assessed in cell supernatant using an ELISA assay (Affymetrix eBioscience, 88-7316-86) that was run according to manufacturer's recommendations.
- ELISA assay Affymetrix eBioscience, 88-7316-86
- CD155 aAPC/CHO-K1 (Promega, CS198811) cells were seeded in U-bottom 96-well plates according to manufacturer's recommendations and incubated at 37° C., 5% CO2 incubator 0/N.
- CD8 T cells were purified according to manufacturer's recommendations by using negative selection kit (Stemcell Technologies, 17953) from frozen human TILs isolated from ovarian ascites (Immunehealth). Purified CD8+ T cells were then incubated with anti-TIGIT antibody clone 26452, the non-optimized parent of clones 29489 and 31282 (100,000 CD8+ T cells/100W of full medium containing antibody) during 1 hour. After that, the antibody-CD8 mix was added to the CD155 aAPC/CHO-K1 cell plates containing 50 ul of fresh full medium and incubated at 37° C., 5% CO2 during 5 days.
- IFNg concentrations were assessed in cell supernatant using an ELISA assay (Affymetrix eBioscience, 88-7316-86) that was run according to manufacturer's recommendations. As seen in FIG. 14 , IFNg secretion was increased by almost 2 folds when anti-TIGIT antibody was added to the co-culture.
- Jurkat cells clone E6-1, ATCC TIB-152
- overexpress mouse TIGIT Jurkat-mTIGIT
- Anti-TIGIT antibody 26493 was used as a surrogate as this antibody showed cross-reactivity for mouse TIGIT as well as binding to human TIGIT.
- Cells were pre-incubated for 45 min at 37° C. with different concentrations of anti-TIGIT antibody clone 26493 (0.03 to 10 ⁇ g/ml) in 25 ⁇ 1 of complete medium (RPMI+10% FBS).
- FIG. 15A shows the dose-response curve of anti-TIGIT clone 26493 for CD155 competition identifying 2.3 nM as IC50 (upper dotted line represent signal from isotype, bottom dotted line signal from cells without CD155).
- OT1 cells were isolated from the spleens of C57BL/6-Tg(TcraTcrb)1100Mjb/Crl mice (Charles River) by mechanical dissociation followed by negative selection for mouse T cells using EasySepTM Mouse T Cell Isolation Kit (Stemcell, Catalog #19851).
- PanO2 cancer cells that naturally express CD155 were treated with Mitomycin C (25 ⁇ g/ml) and subsequently pulsed with OVA-peptide (S7951-1MG, Sigma Aldrich, 1 ⁇ g/ml, 1h at 37° C.).
- CD8+ T cells and PanO2 were co-cultured for 3 days in the presence of anti-TIGIT clone 26493 or isotype control at 133 nM. At day 3, supernatant was collected for detection of IFNg by ELISA ( FIG. 15B ) and T cells for the cytotoxicity assay ( FIG. 15C ).
- OVA-pulsed PanO2 were used as target cells.
- Target cells and non-pulsed Pan02 cells 1 ⁇ 106 each, were labelled with CFSE (C1157, ThermoFisher) and CellTraceTM Far Red Cell Proliferation Kit (C34564, ThermoFisher) respectively, according to manufacturer instructions. These cells were mixed (1:1 ratio) and plated at 2 ⁇ 104 cells per well. The stimulated OT-1 CD8+ T cells were added at 1 ⁇ 105 cells/well (effector cells) resulting in 10:1 effector to target ratio in the presence of anti-TIGIT clone 26493 or isotype control at 133 nM. After 24 hrs cells were washed with PBS and lifted by trypsinization. Cells were then stained with Live/dead fixable violet dead cell staining kit (Molecular Probes, L34955). Cytotoxic killing of target cells was then measured by monitoring the change in the ratio of living target cells to non-target cells by flow-cytometry.
- CFSE C1157, ThermoFisher
- FIG. 15B shows that anti-TIGIT antibody increases IFNg production by almost 2 folds while FIG. 15C shows an increased cytotoxic activity of mouse OT-I CD8+ T cells of around 60%.
- Example 12 Anti-Tumour Activity of Anti-TIGIT Antagonistic Antibody in Monotherapy and in Combination with Anti-PD1 Antibodies in Mouse Model
- anti-TIGIT clone 26493 was produced in mammalian cells on a mouse IgG2a isotype.
- Female Balb/c mice of 8 weeks were inoculated with 500.000 CT26 colon cancer cells (ATCC® CRL2638TM) subcutaneously.
- CT26 colon cancer cells ATCC® CRL2638TM
- mice were treated with 200 ⁇ g of anti-TIGIT or with isotype control (mIgG2a, BioXcell) or with 200 ⁇ g of anti-PD-1 (RMP1-14, BioXcell) and 200 ⁇ g of isotype control (mIgG2a, BioXcell) or with 200 ⁇ g of anti-PD-1 (RMP1-14, BioXcell) and different concentrations of anti-TIGIT (200 ⁇ g, 60 ⁇ g, 20 ⁇ g) by intraperitoneal injections on day 9, day 12 and day 15. Tumor growth was monitored and tumor volumes were measured with electronic calipers three times a week from day 9 until day 36. Mice were sacrificed when tumor volume exceeded 2000 mm3.
- Tumor growth curves were statistically analyzed by a linear mixed model. Differences between treatment groups were evaluated by testing the interaction of time*treatment group.
- treatment groups were recoded by a combination of two variables; anti-TIGIT (yes/no) and anti-PD-1 (yes/no).
- anti-TIGIT yes/no
- anti-PD-1 yes/no
- a synergistic effect, on top of the additive effect of each treatment was evaluated by testing the interaction term anti-TIGIT*anti-PD-1*time.
- FIG. 16A shows median tumor growth curves per group as well as individual growth curves for mice treated with anti-TIGIT antibody in monotherapy. Whereas in the control group, no mice had regression of the tumor, 2/8 mice treated with anti-TIGIT had a complete response. In the remaining mice, a clear tumor growth delay was present. In the control group, no mice survived beyond 30 days, whereas in the treated group, 7/8 mice survived beyond 30 days.
- FIG. 16B shows median tumor growth curves per group as well as individual growth curves for mice treated by anti-PD1 in monotherapy or in combination with anti-TIGIT.
- the combination of anti-TIGIT (at 200 ug) and anti-PD1 antibodies resulted in 7/8 mice showing a complete response.
- Example 13 Isotype-Dependent Anti-Tumour Activity of Anti-TIGIT Antagonistic Antibody in Monotherapy and Combination with Anti-PD1 Antibodies in Mouse Model
- anti-TIGIT clone 26493 was produced in mammalian cells on a mouse IgG2a and mouse IgG1 isotype.
- Female Balb/c mice of 8 weeks were inoculated with 500.000 CT26 colon cancer cells (ATCC® CRL-2638TM) subcutaneously.
- CT26 colon cancer cells ATCC® CRL-2638TM
- mice were treated with 200 ⁇ g of anti-TIGIT or isotype control (mIgG2a, BioXcell) by intraperitoneal injections on day 10, day 13 and day 16.
- mice were treated with 200 ⁇ g of anti-PD-1 (RMP1-14, BioXcell) and 200 ⁇ g of isotype control (mIgG2a, BioXcell) or by combination of 200 ⁇ g of anti-PD-1 (RMP1-14, BioXcell) and 200 ⁇ g of anti-TIGIT by intraperitoneal injections on day 10, day 13 and day 16. Tumor growth was monitored and tumor volumes were measured with electronic calipers three times a week from day 10 until day 33. Mice were sacrificed when tumor volume exceeded 2000 mm3.
- FIG. 17A shows median tumor growth curves per group as well as individual growth curves for monotherapy with anti-TIGIT antibody and FIG. 17B for combination therapy with anti-TIGIT and anti-PD1 antibodies.
- no anti-tumor efficacy could be observed with anti-TIGIT as a mouse IgG1 isotype, suggesting that interaction of Fc receptor with mIgG2a is important for the anti-tumor activity of anti-TIGIT antagonistic antibodies in the murine CT26 model.
- tumours were analysed by flow cytometry for the immune cell infiltrate following treatment with anti-TIGIT antibody 26493 (IgG2a), in monotherapy and in combination with anti-PD-1. Mice were inoculated and treated as described in example 12. Two days after the second treatment, mice (8 mice per group) were sacrificed and tumours harvested. Tumours were dissociated with a tumour dissociation kit (Miltenyi Biotec).
- FIG. 18A shows that in vivo treatment of tumour with anti-TIGIT mIgG2a antibody results in a decrease in proportion of regulatory T cells within CD4+ TILs population of 28% compared to the control group, which is not observed after treatment with anti-TIGIT mIgG1.
- FIG. 18B shows that there is no depletion of CD8+ TILs, but instead a small increase is observed for the two isotypes (a 17% increase compared to control for mIgG1 and 16% for mIgG2a).
- FIG. 18G shows that combining anti-TIGIT mIgG2a with anti-PD-1 results in regulatory T cells being decreased by 33% compared to anti-PD-1 monotherapy.
- CD8+ T cells the opposite is true, with 22% and 28% increase in CD8+ T cell infiltration, respectively for mIgG1 and mIgG2a isotypes, compared to anti-PD-1 monotherapy ( FIG. 18H ).
- treatment with anti-TIGIT antibody mIgG2a combined with anti-PD-1 demonstrates a shift in Th1 versus Th2 phenotype for intratumor CD4+ T cells, with a marked increase in IFNg producing CD4 cells ( FIG. 18J ) and a decrease in IL-10 producing CD4 cells ( FIG. 18K ).
- FIG. 19A shows a volcano plot of the genes that are differentially regulated between vehicle treated mice and anti-TIGIT mIgG2a treated mice. Highly statistically significant genes fall at the top of the plot, and highly differentially expressed genes fall to either side (left: downregulated in anti-TIGIT treated mice, right: upregulated in anti-TIGIT treated mice). Examples of highly upregulated genes include perforin, granzyme B and CTLA-4.
- the solid line represents a non-corrected p-value of 0.01, the dotted line a corrected p-value of 0.05 (Benjamini-Hochberg correction).
- Table 11 and Table 12 show the genes that were significantly differentially expressed for anti-TIGIT mIgG2a compared with vehicle and aPD-1+anti-TIGIT mIgG2a versus anti-PD1 respectively.
- Table 11 and Table 12 show the genes that were significantly differentially expressed for anti-TIGIT mIgG2a compared with vehicle and aPD-1+anti-TIGIT mIgG2a versus anti-PD1 respectively.
- Isolated PBMCs from healthy human donors were resuspended in complete RPMI medium (supplemented with 10% FBS heat inactivated+50U Penicilin+50U Streptomycin, and supplemented with 200 IU IL-2/ml). 2.5 ⁇ 10 5 human PBMCs were distributed per well in 96 U well plate.
- Anti-human TIGIT antibody clone 26452 produced in mammalian cells or IgG1 isotype control (Biolegend, 403102) were added at a final concentration of 66.6; 0.66 and 0.006 nM to each corresponding well. Cells were incubated for 20h at 37° C. with 5% CO2.
- LVD efluor 520 eBioscience 65-0867-14
- ant-TCRab-PercP-Cy5.5 Clone IP26, Biolegend 306723
- anti-CD4-BV510 Clone SK3, BD Horizon 562970
- anti-CD8-APC-Cy7 Clone SK1, Biolegend 344714
- anti-CD25-BV605 Clone 2A3, Biolegend 562660
- anti-CD127-APC A019D5, Biolegend 351316)
- anti-CCR7-BV421 Clone G043H7, Biolegend 353207
- anti-CD45RO-PE-Cy7 Clone UCHL1, Biolegend 304229
- CD45+CD4+ or CD45+CD8+ represent the total CD4+ or CD8+ T cells.
- CD45+RO+CD4+ or CD45+RO+CD8+ cells represent the memory CD4+ or CD8+ T cells while CD25hiCD127lowCD4+ represent Treg cells.
- the proportion of TIGIT+ cells on gated Tregs is higher than on gated memory CD8+ T cells and CD4+ T cells, as shown in FIG. 20A .
- mice of 8 weeks were inoculated with 500.000 CT26 colon cancer cells (ATCC® CRL-2638TM) subcutaneously. Three weeks after inoculation, tumors were harvested and dissociated with a tumor dissociation kit (Miltenyi Biotec). The single cell suspension was incubated with 133 nM anti-TIGIT antibody 26493 (mIgG1 or mIgG2a isotype) for 20h (1 million cells/200W in RPMI+10% FBS).
- FIG. 21 shows the % decrease in absolute TIGIT+ cell counts compared to treatment with isotype control for the different TIGIT+ immune subsets.
- the strongest decrease after anti-TIGIT mIgG2a antibody treatment is evident in regulatory T cells (around 40% decrease), suggesting that these cells are more susceptible to ADCC than conventional CD4+ or CD8+ T cells.
- Each frame-by-allele “assessment” is a statement about predicted HLA binding affinity.
- EpiMatrix assessment scores range from approximately ⁇ 3 to +3 and are normally distributed. EpiMatrix assessment scores above 1.64 are defined as “hits”; that is to say potentially immunogenic and worthy of further consideration.
- the EpiMatrix Protein Score is the difference between the number of predicted T cell epitopes expected to be found in a protein of a given size and the number of putative epitopes predicted by the EpiMatrix System.
- the EpiMatrix Protein Score is correlated with observed immunogenicity.
- EpiMatrix Protein Scores are “normalized” and can be plotted on a standardized scale.
- the EpiMatrix Protein Score of an “average” protein is zero.
- EpiMatrix Protein Scores above zero indicate the presence of excess MHC ligands and denote a higher potential for immunogenicity while scores below zero indicate the presence of fewer potential MHC ligands than expected and a lower potential for immunogenicity. Proteins scoring above +20 are considered to have a significant immunogenic potential.
- Antibodies are unique proteins in that the amino acid sequences of their variable domains, especially their Complementarity Determining Regions (CDRs), can vary to an extraordinary extent. It is this variability that allows antibodies to recognize a wide variety of antigens.
- CDRs Complementarity Determining Regions
- the recombination and mutation events that control antibody maturation can also produce new or neo-T cell epitopes. These neo-epitopes can appear to be “foreign” to circulating T cells.
- the presence of neo-epitopes in antibody sequences can lead to the formation of a human-anti-human antibody response; also known as the HAHA response or ADA (Anti-Drug-Antibodies).
- Regulatory T cells play an important role in suppressing immune responses to fully human proteins in the periphery, including those containing mutated and/or highly variable sequences such as antibody CDRs. Regulatory T cells are engaged and activated by regulatory T cell epitopes. The inherent risk associated with the presence of neo-epitopes in antibody sequences appears to be balanced by the presence of naturally occurring regulatory T cell epitopes.
- the immunogenic potential of neo-epitopes contained in humanized antibodies can be effectively controlled in the presence of significant numbers of Tregitopes.
- EpiVax has developed a Tregitope-adjusted EpiMatrix Score and corresponding prediction of anti-therapeutic antibody response.
- the scores of the Tregitopes are deducted from the EpiMatrix Protein Score.
- the Tregitope-adjusted scores have been shown to be well correlated with observed clinical immune response for a set of 23 commercial antibodies (De Groot et al. (2009) Clinical Immunol. 131:189).
- Clones 29489, 29494 and 31282 antibody sequences score on the low end of EpiMatrix scale, indicating limited potential for immunogenicity. Regression analysis of licensed monoclonal antibodies predicts ADA response in ⁇ 0% of exposed patients for antibody clone 29489 and 31282. For clone 29494, analysis predicts ADA response in 2.78% of exposed patients for the baseline VH sequence, and 2.88% for the variant VH sequence. Data are summarized in Table 13, below.
- Antibody 31282 was compared against anti-TIGIT antibody clones described in other patent applications. Specifically, 31282 was compared with: 4.1D3.Q1E (also referred to as 4.1D3, from WO2017/053748); 22G2 (from WO2016106302); 3106 (from WO2016/028656); 313M2 (from WO2016/191643); and TIG1 (from WO2017/152088).
- the references and sequences of the compared antibody clones are shown in Table 14 below:
- VH SEQ ID NO: 34 of VH sequence: WO2017/053748 EVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIR
- VL SEQ ID NO: 36 of QSPSRGLEWLGKTYYRFKWYSDYAVSVKGRITINPDTSKN WO2017/053748 QFSLQLNSVTPEDTAVFYCTRESTTYDLLAGPFDYWGQGT LVTVSS (SEQ ID NO: 343 herein)
- DNA vectors coding for specific antibody clones (clones 31282 up, 4.1D3, 22G2, 3106, 313M32 and TIG1) were generated and transduced into HEK cells for production of human IgG1 isotype.
- Human codon optimized synthetic DNA fragments for antibody variable domains were ordered at Geneart.
- Variable domain sequences were seamlessly ligated into pUPE expression vectors containing the mouse IgKappa signal sequence and constant regions of the respective antibody class. Expression vectors were verified by restriction analysis and DNA sequencing.
- Endotoxin free DNA maxipreps (Sigma) were produced and heavy and light chain vectors were co-transfected to HEK293EBNA1 cells, in Freestyle medium (ThermoFisherScientific), according to established protocols. Primatone (0.55% final volume) was added 24 hours post-transfection. Conditioned medium was harvested 6 days post transfection.
- Antibodies were purified batch wise by Mabselect sureLX (GE Healthcare) affinity chromatography. Bound antibodies were washed in 2 steps with PBS containing 1M NaCl and PBS. Antibodies were eluted with 20 mM Citrate 150 mM NaCl pH3 and neutralized to approximately pH7 with 1 ⁇ 6 volume of 1M K2HPO4/KH2PO4 pH8.
- the antibodies were further purified by gel-filtration using a Superdex200 column, equilibrated in PBS. Fractions were analysed by NuPAGE and antibody containing fractions were pooled. The final products were sterilized over a 0.22 ⁇ M syringe filter. The product was analysed by NuPAGE and endotoxin levels were measured by LAL-assay.
- clone 31282 was also produced in CHO-K1 cell as follow (clone 31282_wu) on IgG1 or IgG4 isotype.
- DNA vectors coding for the antibodies were constructed and transfected into CHO-K1 cells.
- CHO codon optimized DNA fragments for antibody variable domains were synthesized, and ligated into expression vectors containing the signal sequence and constant regions of the respective antibody class.
- Expression vectors were verified by restriction analysis and DNA sequencing.
- Heavy and light chain vectors were co-transfected to CHO-K1 cells by electroporation (Bio-rad) according to established protocols. The transfected cultures were scaled up and inoculated into fed-batch cultures. Conditioned medium was harvested after 14 days of fed-batch cultures.
- AEX anion exchange chromatography
- POROS HQ50 POROS HQ50 (Life Tech) in flow-through mode.
- the column was equilibrated by 50 mM NaAc-HAc (pH 5.5) before loading.
- AEX flow throughcollected during loading and recovering step was further polished by cation exchange chromatography (CEX) in bind-elute mode using POROS XS (Life Tech.).
- CEX cation exchange chromatography
- the CEX column was equilibrated in 50 mM NaAc-HAc (pH 5.5), and the antibodies were eluted out by linear gradient elution (LGE) to reach 50 mM NaAc-HAc (pH 5.5) containing 0.5 M NaCl in 10 CV.
- LGE linear gradient elution
- the final ultrafiltration and dia-filtration (UF/DF) using Pellicon 3, ultracel 30 kD, type A (Millipore) was performed to concentrate the CEX eluate and exchange buffer into 20 mM His-HCl (pH 5.5). Afterwards, Polysorbate 80 (PS80) and sucrose was added into the dia-filtrated sample to obtain the final product of which the concentration was proximately 20 g/L, in the buffer of 20 mM His-HCl, 0.01% (w/w) PS 80, and 9% (w/v) sucrose (pH 5.5). The product had gone through all PQA tests. The SEC purity, Endotoxin level and other criteria had all met the requirement.
- PS80 Polysorbate 80
- sucrose was added into the dia-filtrated sample to obtain the final product of which the concentration was proximately 20 g/L, in the buffer of 20 mM His-HCl, 0.01% (w/w) PS 80, and 9% (w/v
- Biosensor analysis was conducted at 25° C. in a HBS-EP buffer system (10 mM HEPES pH 7.3, 150 mM NaCl, 3 mM EDTA, 0.05% Tween20) using Biacore T200 technology, CMS sensor chip (run at Novalix, France).
- the sample hotel was maintained at 8° C.
- Goat anti-human IgG capture antibody (Fc ⁇ fragment specific, Jackson ImmunoResearch Laboratories) was immobilized (10000 RU) to both flow cells of the sensor chip using standard amine coupling chemistry. This surface type provided a format for reproducibly capturing fresh analysis antibody after each regeneration step.
- Flow cell 2 was used to analyse captured antibody while flow cell 1 was used as a reference flow cell.
- the affinity of human anti-TIGIT antibodies has been measured using Jurkat E6.1 cells transduced with human-TIGIT (Jurkat hTIGIT).
- 10 5 cells were distributed per well and incubated with decreasing concentration (8; 4; 2; 1; 0.5; 0.25; 0.125; 0.062; 0.031; 0.016; 8 ⁇ 10 ⁇ 3 and 4 ⁇ 10 ⁇ 3 nM) of various anti-TIGIT antagonist antibody clones ( FIG. 2 ).
- Antibodies were incubated with the cells for 20 min at 4° C. in FACS buffer.
- EC50 values for binding Jurkat-hTIGIT are very close for clone 31282 with no marked difference between antibody produced in HEK cells (31282 up, 0.13 nM) or in CHO-K1 cells (31282-wu, 0.10 nM).
- Clone 3106 and TIG1 also show EC50 values below 0.2 nM while affinity for other clones (4.1D3, 22G2 and 313M32) is lower and results show EC50 values ranging from 0.267 to 0.445 nM. Results demonstrate a strong binding to membrane expressed human TIGIT in an engineered system for anti-TIGIT clones 31282, 3106 and TIG1 while other clones have a lower affinity.
- Isolated human PBMCs from healthy volunteers were analysed for binding by antagonist anti-TIGIT antibodies.
- Cells were distributed at 1 ⁇ 10 5 cells per well.
- Cells were incubated with anti-CD16 (Clone 3G8, BioLegend 302002), CD32 (Clone FLI8.26, BD Bioscience 557333) and CD64 (BD Bioscience 555525) at room temperature for 10 min, and the indicated anti-human TIGIT antibody clones were directly added at a final concentration of 8; 4; 2; 1; 0.5; 0.25; 0.125; 0.062; 0.031; 0.016; 8 ⁇ 10 ⁇ 3 and 4 ⁇ 10 ⁇ 3 nM in FACS buffer and incubated for 20 min at 4° C.
- the EC50 values for binding to CD8+ human primary T cells were calculated using the MFI signal on living TIGIT+CD8+ T cells. The results are illustrated in FIG. 22B and the EC50 concentrations summarized in the Table 17 below. EC50 values for binding human primary CD8+ T cells are very close for clone 31282 with no marked difference between antibody produced in HEK cells (31282 up, 0.21 nM) or in CHO-K1 cells (31282-wu, 0.19 nM).
- Comparison between the different clones of antagonist a-TIGIT antibodies show the best EC50 value for binding on human primary CD8+ T cells for clone 31282_wu (0.19 nM) and clone 31282 up (0.21 nM).
- Clones 3106 and TIG1 show a difference in EC50 of 2 fold while clone 22G2, 313M32 and 4.1D3 differs by a factor of 6.1 to 9.7 fold.
- 31282 wu and 31282 up show the best binding to membrane expressed TIGIT on human primary CD8+ T cells.
- Isolated human PBMCs from cancer patients were analysed for binding by different antagonist anti-TIGIT antibody clones.
- Cells were distributed at 1 ⁇ 105 cells per well.
- Cells were incubated with anti-CD16 (Clone 3G8, BioLegend 302002), CD32 (Clone FLI8.26, BD Bioscience 557333) and CD64 (BD Bioscience 555525) at room temperature for 10 min, and the indicated anti-human TIGIT antibodies were directly added at a final concentration of: 8, 4, 2, 1, 0.5, 0.25, 0.125, 0.062 and 0.031 nM in FACS buffer and incubated for 20 min at 4° C.
- Clones 31282 wu and 31282 up show very close EC50 value for binding on CD8+ T cells from cancer patients with concentration of 0.14 and 0.12 nM, respectively.
- the rest of the clones show lower affinity with clone 3106, TIG1 and 22G2 showing a 1.5, 2.7 and 3.1 fold lower affinity, respectively.
- Measured EC50 value for clone 313M32 is 8.3 fold lower compared to clone 31282 up.
- Clone 4.1D3 shows the lowest affinity, binding with a difference of 9.5 fold to the best clone tested.
- Jurkat cells overexpressing human TIGIT (Jurkat-hTIGIT) were collected and distributed at 5.10 4 cells/well and incubated with anti-human TIGIT antibodies at the following concentrations: 133.33; 42.20; 13.33; 4.22; 1.33; 0.422; 0.133; 0.042; 0.0133; 4.22 ⁇ 10 ⁇ 3 ; 1.3 ⁇ 10 ⁇ 3 ; 4.2 ⁇ 10 ⁇ 4 ; 1.3 ⁇ 10 ⁇ 4 ; 4.2 ⁇ 10′′ 5 nM in complete medium during 45 min at 37° C. Excess of antibody was washed, and then the cells were incubated with CD155-His at 15 ⁇ g/ml (Creative Biomart, PVR-3141H) for 45 min at 37° C.
- CD155-His was detected using anti-His tag-PE (Biolegend, 362603, at 2 ⁇ l per test), incubated for 30 min at 4° C.
- Cells were analysed by FACS using BD LSRFortessa and the half concentration (IC 50 ) that prevents CD155 binding was calculated based on the median fluorescence intensity of PE in total cells.
- Anti-TIGIT clones 31282_wu and 31282_up show the best IC50 values for CD155 competition on Jurkat cells engineered to express hTIGIT with concentration of 0.05 and 0.04 nM respectively.
- Other clones (4.1D3, 22G2, 3106, TIG1) have IC 50 values between 0.07 and 0.09 nM while clone 313M32 clone competes with CD155 for binding to TIGIT with a much lower efficiency (0.65 nM).
- TIGIT-overexpressing Jurkat cells can be induced by contact with CD155-expressing CHO-K1 cells upon TCR engagement on Jurkat cells and can be increased in presence of antagonist anti-TIGIT antibody.
- the experiment was conducted in presence of increasing antibody concentrations and the EC50 values were calculated.
- CD155 aAPC/CHO-K1 (Promega, CS198811) cells were seeded according to manufacturer's recommendations and incubated at 37° C., 5% CO2 incubator O/N. The next day, TIGIT Effector cells (Promega, CS198811) were added according to manufacturer's recommendations to the CD155 aAPC/CHO-K1 cell plates containing fresh full medium with anti-TIGIT antibody at increasing concentrations (0.03; 0.11; 0.33; 1.06; 3.34; 10.56; 33.38; 105.49; and 333 nM) and incubated at 37° C., 5% CO2 during 6 hours. After the 6 hours of incubation, activation of TIGIT Effector cell was assessed by measuring the luciferase activity by using Bio-GloTM Luciferase Assay System (Promega, G7941).
- anti-TIGIT antibody 31282 has the best efficacy in term of EC50 value and maximum induction of luciferase signal in the assay.
- Activity observed for clone produced in HEK (31282 up) or CHO-K1 (31282 wu) cells is comparable with a maximum luciferase signal that is 8 folds higher than control isotype (Bioexcell, BE0297) and with an EC50 concentration measured at 3.3 nM and 3.5 nM respectively.
- clones 4.1D3, 22G2 and 3106 have a maximum activity between 5.3 and 6.7 fold over isotype control, associated with an EC50 between 5 and 10 nM.
- EC50 values for clone 313M32 and TIG1 could not be determined due to a low activity and poor fitting of the curves at the concentrations tested ( FIG. 24A ).
- CD155 aAPC/CHO-K1 (Promega, CS198811) cells were seeded in U-bottom 96-well plates according to manufacturer's recommendations and incubated at 37° C., 5% CO2 incubator O/N. The next day, CD8+ T cells were purified according to manufacturer's recommendations by using negative selection kit (Stemcell Technologies, 17953) from frozen human peripheral blood mononuclear cells isolated from total blood of healthy donors (Immunehealth).
- CD8 T cells and increasing concentrations (0.011 nM, 0.033 nM, 0.11 nM, 0.33 nM, 1.06 nM, 3.3 nM, 10.6 nM, 33.3 nM and 105.5 nM) of antibodies were then added to CD155 aAPC/CHO-K1 (100,000 CD8 T cells/100 ul of full medium containing antibody) and incubated at 37° C., 5% CO2 during 5 days. Finally, IFNg concentrations were assessed in cell supernatant using an ELISA assay (Affymetrix eBioscience, 88-7316-86) that was run according to manufacturer's recommendations.
- ELISA assay Affymetrix eBioscience, 88-7316-86
- a-TIGIT clone 31282 and 4.1D3 display the best induction of IFNg secretion with a respective 2.7 and 2.9 fold increase over isotype control antibody.
- Clone 31282 has the best efficacy for induction of IFNg production in terms of EC50 concentration, which was measured at 0.13 nM.
- Clone 3106 shows an EC50 value 2.3 fold different while clone 22G2 and 4.1D3 are 3.1 and 10.8 fold less potent than clone 31282. No value could be determined for clone 313M32 due to a low activity and poor fitting of the curves at the concentrations tested ( FIG. 24B ).
- human primary CD3+ T cells from PBMC of a cancerous patient were co-cultured with a CHO-K1 cell line engineered to express human PVR/CD155 and to activate human T cells (CHO-TCR-CD155).
- CHO-TCR-CD155 a CHO-K1 cell line engineered to express human PVR/CD155 and to activate human T cells
- CD155 aAPC/CHO-K1 (Promega, CS198811) cells were seeded in U-bottom 96-well plates according to manufacturer's recommendations and incubated at 37° C., 5% CO2 incubator 0/N. The day after, CD3+ T cells were purified according to manufacturer's recommendations by using negative selection kit (Stemcell Technologies, 17951) from fresh human peripheral blood mononuclear cells isolated from total blood from a cancerous patient (HNSCC) collected 24h earlier (Biopartners).
- HNSCC cancerous patient
- CD155 aAPC/CHO-K1 100,000 CD3 T cells/100 ul of full medium containing antibody
- IFNg concentrations were assessed in cell supernatant using an ELISA assay (Affymetrix eBioscience, 88-7316-86) that was run according to manufacturer's recommendations.
- antibody 31282 induced a strong functional activity to increase IFNg secretion, demonstrating the potential of this a-TIGIT antibody to reactivate PBMC T cells from cancer patients.
- a-TIGIT Clone 31282 Increases Intracellular Cytokine Production in T Cells from Cancer Patient PBMC and Dissociated Tumour Cells (DTC)
- DTC dissociated tumour cells
- T cells subsets were gated as followed: CD45+CD3+ for PBMC and CD45+CD3+CD4+ and CD45+CD3+CD8+ for DTC. Cytokine-secreting T cells were gated using unstained and unstimulated controls.
- FIG. 24D shows that intracellular content of IL2, IFNg and TNFa were all increased upon activation in presence of a-TIGIT clone 31282. This increase was observed in CD3+ T cells from PBMC in accordance with data illustrated in FIG. 24C but also in both CD4+ and CD8+ TIL from dissociated tumour cells. This demonstrates the potential of a-TIGIT clone 31282 to increase the activation of PBMC and TIL populations from cancer patient T cells.
- Example 21 A-TIGIT Clone 31282 Induces Preferential Cytotoxicity of Treg in PBMC from Cancer Patients
- isolated PBMCs from a lung cancer patient were resuspended in complete RPMI medium (supplemented with 10% FBS heat inactivated+50 U Penicillin+50 U Streptomycin).
- 2.5 ⁇ 105 human PBMCs were distributed per well in 96 U well plate.
- Anti-human TIGIT antibody clone 31282, human IgG1 isotype control (BioXcell BE0297) or Rituximab (InvivoGen hcd20-mab1) were added at a final concentration of 6.6 nM to each corresponding well. Cells were incubated for 20h at 37° C. with 5% CO2.
- LVD efluor 520 eBioscience 65-0867-14
- ant-TCRab-PercP-Cy5.5 Clone IP26, Biolegend 306723
- anti-CD4-BV510 Clone SK3, BD Horizon 562970
- anti-CD8-APC-Cy7 Clone SK1, Biolegend 344714
- anti-CD25-BV605 Clone 2A3, Biolegend 562660
- anti-CD127-APC A019D5, Biolegend 351316)
- anti-CCR7-BV421 Clone G043H7, Biolegend 353207
- anti-CD45RO-PE-Cy7 Clone UCHL1, Biolegend 304229
- anti-TIGIT clone 31282 triggers higher specific lysis on Tregs cells (30.1+/ ⁇ 3%) than on CD45RO+CCR7+/ ⁇ CD8+ T cells (total memory CD8+ T cells) ( ⁇ 1.48+/ ⁇ 6%) or CD45RO+CCR7+/ ⁇ CD4+T (total memory CD4+ T cells) (0.64+/ ⁇ 3%).
- Rituximab positive control triggers 77.9% (+/ ⁇ 6.8%) of specific lysis on gated CD19+ cells.
- Overall data demonstrate a preferential depletion of Treg cells from cancer patient PBMC as compared to total memory CD4+ and CD8+ T cell populations. Similar preferential depletion of Treg cells was observed using cells from a patient with colon adenocarcinoma.
- Flow cytometry analyses were performed to assess the expression of TIGIT on immune cell subsets from freshly isolated matched PBMC and tumour infiltrated lymphocytes within dissociated tumour cells (DTC) from cancer patients.
- DTC dissociated tumour cells
- Samples from different indications were acquired: Ovarian cancer, Kidney cancer, HNSSC, Cutaneous carcinoma, Melanoma and Lung cancer.
- tumours were minced mechanically then incubated with Tumor Dissociation Kit (Miltenyi Biotech #130-095-929) under rotation in a gentleMACS dissociator, following manufacturer instructions for specific tumour types.
- Cells were stained per manufacturer's instruction using filtered FACS buffer (PBS+2 mM EDTA+0.1% BSA) and Brilliant Stain buffer (BD #563794). Cells were blocked with appropriate Human FcBlock (BD #564220) prior to staining and were fixed using IC fixation buffer (eBioscience #00-8222-49) prior acquisition.
- DTC were stained with the following antibody panel: anti-CD45-BB515 (Clone HI30, BD Horizon 564585), anti-CD73-BV421 (Clone AD2, BD Horizon 562430), anti-CD8a-BV510 (Clone SK1, BD Horizon 563919), anti-CD3-BV650 (Clone SK7, BD Horizon 563999), anti-CD56-BV711 (Clone 5.1H11, Biolegend 362542), anti-CD279-BV785 (Clone EH12.2H7, Biolegend 329930), anti-CD127-APC (Clone A019D5, Biolegend 351316), anti-CD4-APC-R700 (Clone RPA-T4, BD Horizon 564975), LVD efluor 780 (eBioscience 65-0865-14), anti-TIGIT-PE (Clone MBSA43, eBioscience E13456-108), anti-CD39-PE-Dazzle59
- PBMC peripheral blood mononuclear cells
- anti-CD45RO ⁇ BB515 Clone UCHL1, BD Horizon 564529
- anti-CD73-BV421 Clone AD2, BD Horizon 562430
- anti-CD8a-BV510 Clone SK1, BD Horizon 563919
- anti-CD3-BV650 Clone SK7, BD Horizon 563999
- anti-CD56-BV711 Clone 5.1H11, Biolegend 362542
- anti-CD197-BV786 Clone 3D12, BD Horizon 563710
- anti-CD127-APC Clone A019D5, Biolegend 351316)
- anti-CD4-APC-R700 Clone RPA-T4, BD Horizon 564975
- LVD efluor 780 eBioscience 65-0865-14
- anti-TIGIT-PE Clone MBSA43, eBioscience E13456-108
- TIGIT expression on different immune populations is represented in FIG. 26A and TIGIT density for each subset is represented in FIG. 26B using Box and whiskers representation using the Tukey method to compute percentiles.
- TIGIT frequency on T cell subset is higher on PBMC from cancer patients as compared to PBMC from healthy donors. This frequency is further increased on DTC TILS ( FIG. 26A ). While the same observation is made looking at the density of TIGIT on the surface of CD3+CD4+non-Treg cells and CD4+ Treg cells, for CD3+CD8+ T cells the number of TIGIT molecules per cell is decreased on DTC TILS ( FIG. 26B ).
- TIGIT residues 23-128 was produced by Proteros Biostructures GmbH.
- TIGIT (23-128) with N-terminal HIS-tag (thrombin cleavable) was cloned into pET15b and expressed in LB medium in B121(DE3) at 37° C. in inclusion bodies.
- Inclusion bodies (IBs) were washed with buffer containing Tris/HCl pH 7.4 and Tris/HCl pH 7.4, 0.05% Brij-35. IBs were denaturated with 6 M Gdm/HCl, 50 mM Tris pH 8.5 and 10 mM DTT.
- Refolding was performed in 50 mM Tris/HCl pH8, 1 mM GSH, 0.5 mM GSSG, 150 mM NaCl. Refolded protein was purified on HIS-trap. The N-terminal HIS-tag was removed via Thrombin cleavage and further purification on Superdex-75 equilibrated in 50 mM Tris/HCl pH 7.5, 200 mM NaCl.
- HEK293F cell were grown in Freestyle F17 with 1% penicillin/streptomycin, 2 mM L-glutamine and 0.1% Pluronic. Expanded cultures for transfection were cultivated in 3 L Erlenmeyer flasks (Corning, 2 L cell culture working volume, 37° C., 8% v/v CO2,
- the culture was diluted one day before transfection and the cell number adjusted to 1 ⁇ 106 cells/ml. The volume of the expression culture was 6 L.
- a transient transfection was performed with plasmids for light and heavy chain of Fab.
- a MasterMix of DNA/FectoPro (FectoPro, PolyPlus) was prepared in pure F17 Medium and incubated for 10 minutes (according to PolyPlus protocol). This transfection mix was added to the cell suspension dropwise and the Booster was added immediately. 18 hrs after transfection the culture was fed with 3 g/L glucose.
- Fab-TIGIT complex formation purified TIGIT was mixed with purified Fab in a ratio of 1.5:1 and the complex was purified on Superdex-200 equilibrated in 20 mM Tris pH 8, 100 mM NaCl.
- the Fab-TIGIT complex was concentrated to 35 mg/ml for crystallization.
- the Fab-TIGIT complex was crystallized at 277K using the vapour diffusion method by mixing 0.1 ⁇ l protein solution (35.3 mg/ml in 20 mM TRIS pH 8.0; 100 mM NaCl) in a 1:1 ratio with reservoir solution (0.10 M Sodium cacodylate pH 6.00; 15% (w/v) PEG4000). Crystals were cryo-protected by immersing them in reservoir solution with 25% glycerol added.
- a cryo-protocol was established using Proteros Biostructures GmbH Standard Protocols. Crystals have been flash-frozen and measured at a temperature of 100 K. X-ray diffraction data was collected from Fab:TIGIT complex crystals at the SWISS LIGHT SOURCE (SLS, Villigen, Switzerland) using cryogenic conditions. The crystals belong to space group P1. Data were processed using the programmes XDS and XSCALE. Data collection and processing statistics can be found in Table 22.
- phase information necessary to determine and analyse the structure was obtained by molecular replacement.
- a previously solved structure of Fab was used as a search model.
- Subsequent model building and refinement was performed according to standard protocols with the software packages CCP4 and COOT.
- CCP4 and COOT the software packages
- TLS refinement (using REFMAC5, CCP4) has been carried out, which resulted in lower R-factors and higher quality of the electron density map.
- Automatically generated local NCS restraints have been applied (keyword “ncsr local” of newer REFMAC5 versions).
- the ligand parameterisation and generation of the corresponding library files were carried out with CHEMSKETCH and LIBCHECK (CCP4), respectively.
- the water model was built with the “Find waters” algorithm of COOT by putting water molecules in peaks of the Fo-Fc map contoured at 3.0 followed by refinement with REFMAC5 and checking all waters with the validation tool of COOT.
- the criteria for the list of suspected waters were: B-factor greater 80 ⁇ 2, 2Fo-Fc map less than 1.2 ⁇ , distance to closest contact less than 2.3 ⁇ or more than 3.5 ⁇ .
- the suspected water molecules and those in the ligand binding site (distance to ligand less than 10 ⁇ ) were checked manually.
- the final complex structure was refined with PHENIX. We chose the refinement parameter including XYZ coordinates, Real space, Individual B-factors and Group B-factors.
- the heavy and light chains of the human Fab antibody fragment show the typical folding of human antibodies ( FIG. 27A ).
- the model comprises residues 23 to 128 of TIGIT, residues 1 to 224 of the heavy chain of clone 31282 and residues 1 to 214 of the light chain of clone 31282.
- One short loop region of the heavy chain is not fully defined by electron density and has thus not been included in the model.
- Clone 31282 heavy chain interacts with different regions of TIGIT with CDR H1 Tyr33 contacting TIGIT on residue Leu73; with CDR H2 Val50, Ser54 and Ser57 contacting TIGIT on residue Leu73; with CDR H3 Asp102, Tyr103 and Trp104 contacting TIGIT on residue Gln56, Ile68, Leu73 and His76.
- Contact residues were defined as each amino acid meeting each of the following criteria: (i) it has a calculated binding free energy contribution greater than 0.3 kcal/mol, (ii) it has an experimental averaged B-factor lower than the mean B-factor of all residues in the X-ray structure, (iii) it makes at least 3 pairs of heavy-atom interatomic contacts with antibody atoms at a distance less than or equal to 4.0 Angstroms, (iv) it does not make only solvent-exposed hydrogen bond or ionic interactions, (v) if it is a non-aromatic polar residue (Asn, Gln, Ser, Thr, Asp, Glu, Lys, or Arg), it makes at least one hydrogen bond or ionic interaction with the antibody.
- Anti-TIGIT antibody clone 32959 of human IgG1 isotype was produced in HEK cells and purified as described in Example 17 above.
- Jurkat cells overexpressing human TIGIT (Jurkat-hTIGIT) were collected and distributed at 5.104 cells/well and incubated with antagonist a-TIGIT clone 31282 at the following concentrations: 0 nM (No Ab), 0.08 nM, 0.16 nM, 0.8 nM and 8 nM that represent a range of concentration from 0 to 100 times the Kd of this clone.
- the half-maximal concentration of binding (EC50) to hTIGIT-Jurkat was calculated using a four-variable curve-fit equation in Prism, and the obtained values are shown in Table 26 and illustrated in FIG. 28 .
- the results show a strong binding of a-TIGIT clone 32959, independently of the concentration of clone 31282, demonstrating the absence of competition with an antagonist a-TIGIT antibody.
- Example 25 Determination of Pharmacokinetic Profile of Clone 31282 after Single i.v. Injection in Cynomolgus Monkey
- Antibody was administered at 3 different concentrations (0.1 mg/kg; 1 mg/kg; 10 mg/kg) to 2 animals (1 male and 1 female). Blood was collected through 504 hours post-dose on Day 1. Blood samples were processed for plasma and analyzed for concentration of a-TIGIT clone 31282 IgG1 or IgG4 using an ELISA method.
- Plasma concentration-time data from individual animals were used to calculate toxicokinetic parameter values for a-TIGIT clone 31282 IgG1 and IgG4 after IV dosing using the intravascular model in Phoenix WinNonlin (version 6.3, Pharsight, a Certara Company, Princeton, N.J.).
- IgG1 concentrations were quantifiable in plasma of male and female monkeys through 240 h, 336 h, and 504 h post-dose, respectively, and IgG4 was quantifiable through 168 h, 240 h, and 504 h, respectively ( FIG. 29 and Table 27).
- Cmax and AUClast ratios (males/females) ranging from 0.855 to 1.16.
- TIGIT expression was profiled on immune cells of Sézary Syndrome patients using the following commercial reagents: anti-CD3 Krome Orange (#B00068), anti-CD4-PE(#A07751), anti, CD8-PC7 (#737661), anti-CD56-PC5 (#A07789), anti-CD45-Pacific Blue (#A74763), anti-CD19-AF750 (#A94681) and anti-Vb8-FITC (#IM1233) (all from Beckman-Coulter) and anti-TIGIT-APC (clone MBSA43, ebiosciences #17-9500-42).
- Flow-cytometry analyses of Sézary Syndrome patient samples were performed on a CytoFlex apparatus (Beckman-Coulter). Data were analyzed with FloJo software (FlowJo, LLC).
- FIG. 30A A representative example is shown on FIG. 30A .
- Gating strategy for this donor that has a malignant TCR-Vb8 clone is shown in FIG. 30A with malignant cells being CD45+CD3+CD4+Vb8+ and normal CD4+ T cells being CD45+CD3+CD4+Vb8 ⁇ .
- a strong expression of TIGIT is observed on the malignant CD4+ T cells compared to the normal CD4+ T cells (respective MFI of 4987 and 999) ( FIG. 30B ).
- flow cytometry analyses were performed to assess the expression of TIGIT on normal and malignant B cells in bone marrow samples from patients with CLL.
- the samples were stained with the following antibody panel: LVD efluor 780 (eBioscience 65-0865-14), anti-CD45-BB515 (Clone HI30, BD Horizon 564585), anti-CD5-BV510 (Clone UCHT2, Biolegend 363381), anti-CD19-BV711 (Clone SJ25C1, BD Horizon 563036) and anti-TIGIT-PE (Clone MBSA43, eBioscience E13456-108).
- LVD efluor 780 eBioscience 65-0865-14
- anti-CD45-BB515 Clone HI30, BD Horizon 564585
- anti-CD5-BV510 Clone UCHT2, Biolegend 363381
- anti-CD19-BV711 Clone SJ25C1, BD Horizon 563036
- FIG. 31 A representative example is shown on FIG. 31 with gating strategy illustrated in FIG. 31A .
- a high proportion of malignant B-CLL cells are positive for TIGIT (75%), in contrast to normal B cells (1%) (MFIs of 1440 and 810, respectively) ( FIG. 31B ).
- tumour cells express TIGIT in specific blood cancer indications.
- EL4 T cell lymphoma cells (ATCC® TIB-39TM) were engineered to stably express mouse TIGIT (EL4-mTIGIT).
- EL4 cells transduced with a similar vector coding for GFP were used as control (EL4-GFP). Pools of cells were subcloned to obtain clones of EL4-mTIGIT and EL4-GFP.
- the anti-TIGIT antibody used was a modified version of antibody 29527 (modified such that residue 27 of VH FR3 is mutated from L to V and where residue 6 of VH FR4 is mutated from M to T) and produced on a human IgG1 isotype.
- mice of 8 weeks were inoculated with 1.000.000 EL4-mTIGIT cells or 200.000 EL4-GFP cells subcutaneously.
- Mice were treated with 200 ⁇ g of anti-TIGIT or isotype control antibody (hIgG1, BioXcell) by intraperitoneal injections on day 7, day 10, day 13 and day 16 after tumour innoculation. Tumor growth was monitored and tumor volumes were measured with electronic calipers three times a week from day 7 until day 26. Mice were sacrificed when tumor volume exceeded 2000 mm3. Tumor growth curves were statistically analyzed by a linear mixed model. Differences between treatment groups were evaluated by testing the interaction of time*treatment group.
- FIG. 32 illustrates tumor growth curves in mice inoculated with EL4-mTIGIT (A-C) or EL4-GFP (D-F). Median tumor growth curves (A and D) as well as individual tumor growth curves for mice treated with hIgG1 isotype control (B and E) or antagonist a-TIGIT Ab (C and F) are represented. In mice inoculated with EL4-mTIGIT cells, there was a significant suppression of tumor growth when treated with anti-TIGIT Ab compared to isotype control treated group (p ⁇ 0.001).
- Example 28 Anti-Tumour Activity of Anti-TIGIT Antagonistic Antibody in Combination with Immune Checkpoint Antibodies in CT26 Colon Carcinoma Mouse Models
- anti-TIGIT Ab In addition to the combination of anti-TIGIT Ab with an anti-PD1 antibody (Examples 12, 13 and 14), the antitumor efficacy of an anti-TIGIT antibody was also evaluated in combination with agonist antibodies specific for co-stimulatory molecules 4-1BB, OX40 and GITR, as well as with an antagonist antibody specific for checkpoint inhibitory molecule ICOS.
- CT26 tumour cell line was purchased from ATCC® (CRL-2638TM).
- Female balb/c mice of 8 weeks were subcutaneously inoculated in the right flank with 500.000 cells.
- the anti-TIGIT antibody used was a modified version of antibody 29527 (modified such that residue 27 of VH FR3 is mutated from L to V and where residue 6 of VH FR4 is mutated from M to T) produced on a mouse IgG2a isotype, that was given at 20 ⁇ g/mouse.
- Anti-4-1BB (clone 3H3, BioXCell, BE0239) was given at 5 ug/mouse
- a-OX-40 (clone OX-86, BioXCell, BE0031) was given at 20 ug/mouse
- a-GITR (clones DTA-1, BioXCell, BE0063) was given at 10 ug/mouse
- a-ICOS (clone 7E.17G9, BioXCell, BE0059) was given at 200 ug/mouse.
- Tumor growth was monitored and tumor volumes were measured with electronic calipers three times a week from day 7 until day 35. Mice were sacrificed when tumor volume exceeded 2000 mm3.
- Tumor growth curves were statistically analyzed by a linear mixed model on logarithmically transformed tumor volumes. Differences between treatment groups were evaluated by testing the interaction of time*treatment group. This resulted in a good model fit for the vast majority of the data, except for very small tumor volumes (below 10 mm3). Therefore, these small tumor volumes were treated as missing values.
- IC immune checkpoint antibody
- treatment groups were re-coded by a combination of two variables; anti-TIGIT (yes/no) and IC (yes/no).
- a synergistic effect, on top of the additive effect of each treatment was evaluated by testing the interaction term anti-TIGIT*IC*time.
- FIG. 33A shows median tumor growth curves per group as well as individual growth curves for mice treated by anti-TIGIT in monotherapy or in combination with anti-4-1BB.
- There was significant suppression of tumor growth in mice treated with anti-TIGIT+anti-4-1BB compared to anti-TIGIT or anti-4-1BB monotherapy (p 0.0005 and p ⁇ 0.0001 respectively).
- the combination of anti-TIGIT and anti-4-1BB antibodies resulted in 6/10 mice showing a complete response (where tumor is ⁇ 30 mm3 and considered as non-measurable), as compared with 1/10 or 0/10 complete response in groups treated respectively with a-TIGIT or a-4-1BB as a single agent.
- FIG. 33B shows median tumor growth curves per group as well as individual growth curves for mice treated by anti-TIGIT in monotherapy or in combination with anti-OX-40.
- There was significant suppression of tumor growth in mice treated with anti-TIGIT+anti-OX-40 compared to anti-TIGIT or anti-OX-40 monotherapy (p 0.0002 and p ⁇ 0.0001, respectively).
- FIG. 33C shows median tumor growth curves per group as well as individual growth curves for mice treated by anti-TIGIT in monotherapy or in combination with anti-GITR.
- the combination of anti-TIGIT and anti-GITR antibodies resulted in 6/10 mice showing a complete response as compared with 1/10 or 0/10 in groups treated respectively with anti-TIGIT or anti-GITR as a single agent.
- FIG. 33D shows median tumor growth curves per group as well as individual growth curves for mice treated by anti-TIGIT in monotherapy or in combination with anti-ICOS.
- the combination of anti-TIGIT and anti-ICOS antibodies resulted in 1/10 mice showing a complete response (where tumor is ⁇ 30 mm3 and considered as non-measurable), as compared with 1/10 or 0/10 in groups treated respectively with anti-TIGIT or anti-ICOS antibodies as a single agent.
- ⁇ (gamma-delta, or g/d)T cells are a population of unconventional T cells with described antitumor activity (Zhao et al. 2018. J Transl Med. 16:122) and antiviral activity (e.g. CMV infection) and also have been implicated in autoimmune diseases (Malik S et al. 2016. Front Immunol. 7:14).
- Flow cytometry analyses were performed to assess the expression of TIGIT on ⁇ T cells on PBMC freshly isolated from healthy individuals with a seronegative or seropositive status for Cytomegalovirus (CMV) (CMV status was assessed by the EFS concentrate Aquitaine, Bordeaux, France).
- CMV status was assessed by the EFS concentrate.
- Cells were stained per manufacturer's instruction using filtered FACS buffer (PBS+2 mM EDTA+0.1% BSA). Acquisition was performed on a FACS Fortessa (BD Biosciences) and analyzed with BD FACS DIVA software (BD Biosciences). Cells were gated on Forward and Side scatter and viability.
- ⁇ T cells were gated as follows: CD3+TCR ⁇ +V ⁇ 2 ⁇ (V ⁇ 2 ⁇ T cells) using the following antibodies: anti-TCR ⁇ APC, clone REA591 #130-109-280 from Miltenyi; anti-TCR V ⁇ 2-PE-Vio 770, clone REA771, #130-111-012 from Miltenyi; BV421 mouse anti-human CD3, clone UCHT1, #560365 from BD Biosciences; Zombie Aqua Fixable viable kit, #423101 from Biolegend.
- non-conventional V ⁇ 2 ⁇ ⁇ T cells express TIGIT in both CMV negative and positive human populations (anti-TIGIT, clone MBSA43, #12-98500-42 from eBioscience) ( FIG. 34A ).
- V ⁇ 1+ ⁇ T cells anti-TCR Vd1-FITC, clone REA173 #130-100-532 and anti-FITC Microbeads #130-048-701 both from Miltenyi
- total PBMC from CMV positive donors were activated with anti-V ⁇ 1 (10 ug/ml) (clone R9.1, #IM1761 from Beckman Coulter) and IL-15 (20 ng/ml), #200-15-50UG from Peprotech), IL-2 (100U/ml, #200-02-1MG Peprotech) was additionally added to isolated V ⁇ 1+ ⁇ T cells, in presence or absence of TIGIT-ligand CD155 (#9174-CD-050 from R&D Systems).
- FIG. 34B shows a dose-dependent decrease in IFN ⁇ secretion (ELISA kit, #3420-1h-20 from Mabtech) mediated by the addition of TIGIT-ligand CD155 (0, 0.1, 1 and 10 ug/ml) with a maximal inhibition reached at 1 ug/ml of CD155.
- the addition of anti-TIGIT Ab clone 31282 (10 ug/ml) fully restores IFN ⁇ production to level equal or higher to the condition without CD155 ligand while human IgG1 isotype control has very limited effect.
- FIG. 34B shows a dose-dependent decrease in IFN ⁇ secretion (ELISA kit, #3420-1h-20 from Mabtech) mediated by the addition of TIGIT-ligand CD155 (0, 0.1, 1 and 10 ug/ml) with a maximal inhibition reached at 1 ug/ml of CD155.
- the addition of anti-TIGIT Ab clone 31282 (10 ug/ml) fully restores I
- 34C demonstrates similar inhibitory effect mediated by CD155 (10 ⁇ g/ml) after anti-V ⁇ 1 activation of total PBMC and a total restoration of IFN ⁇ secretion when a-TIGIT clone 31282 is added to the mix.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Virology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- General Engineering & Computer Science (AREA)
- Mycology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/634,506 US20200407445A1 (en) | 2017-07-27 | 2018-07-26 | Anti-tigit antibodies |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762606159P | 2017-07-27 | 2017-07-27 | |
| BE2017/5535A BE1025333B1 (fr) | 2017-07-27 | 2017-07-31 | Anticorps anti-tigit |
| EP17184102.6 | 2017-07-31 | ||
| EP17184102 | 2017-07-31 | ||
| BE20175535 | 2017-07-31 | ||
| US201862660640P | 2018-04-20 | 2018-04-20 | |
| US16/634,506 US20200407445A1 (en) | 2017-07-27 | 2018-07-26 | Anti-tigit antibodies |
| PCT/US2018/043968 WO2019023504A1 (en) | 2017-07-27 | 2018-07-26 | ANTI-TIGIT ANTIBODIES |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20200407445A1 true US20200407445A1 (en) | 2020-12-31 |
Family
ID=65896429
Family Applications (5)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/634,506 Abandoned US20200407445A1 (en) | 2017-07-27 | 2018-07-26 | Anti-tigit antibodies |
| US16/159,506 Active US10329349B2 (en) | 2017-07-27 | 2018-10-12 | Anti-TIGIT antibodies |
| US16/413,557 Active US11439705B2 (en) | 2017-07-27 | 2019-05-15 | Anti-TIGIT antibodies |
| US17/872,494 Pending US20230190931A1 (en) | 2017-07-27 | 2022-07-25 | Anti-TIGIT Antibodies |
| US17/946,158 Abandoned US20230181731A1 (en) | 2017-07-27 | 2022-09-16 | Anti-TIGIT Antibodies |
Family Applications After (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/159,506 Active US10329349B2 (en) | 2017-07-27 | 2018-10-12 | Anti-TIGIT antibodies |
| US16/413,557 Active US11439705B2 (en) | 2017-07-27 | 2019-05-15 | Anti-TIGIT antibodies |
| US17/872,494 Pending US20230190931A1 (en) | 2017-07-27 | 2022-07-25 | Anti-TIGIT Antibodies |
| US17/946,158 Abandoned US20230181731A1 (en) | 2017-07-27 | 2022-09-16 | Anti-TIGIT Antibodies |
Country Status (14)
| Country | Link |
|---|---|
| US (5) | US20200407445A1 (enExample) |
| EP (2) | EP3719040A1 (enExample) |
| JP (2) | JP7366897B2 (enExample) |
| KR (1) | KR102731476B1 (enExample) |
| CN (2) | CN110997720B (enExample) |
| AR (1) | AR112768A1 (enExample) |
| AU (1) | AU2018306463B2 (enExample) |
| BR (1) | BR112020001499A2 (enExample) |
| CA (1) | CA3070791A1 (enExample) |
| ES (1) | ES2812236T3 (enExample) |
| IL (1) | IL272227B2 (enExample) |
| MX (2) | MX2020000960A (enExample) |
| SG (1) | SG11202000660QA (enExample) |
| TW (1) | TWI812632B (enExample) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112794909A (zh) * | 2021-02-04 | 2021-05-14 | 广州爱思迈生物医药科技有限公司 | 一种抗tigit单克隆抗体及其应用 |
| WO2022179567A1 (zh) * | 2021-02-24 | 2022-09-01 | 克莱格医学有限公司 | Tigit工程化细胞及其组合物 |
| WO2022184067A1 (zh) * | 2021-03-02 | 2022-09-09 | 百奥泰生物制药股份有限公司 | 抗tigit抗体在联合用药中的应用 |
| WO2022184068A1 (zh) * | 2021-03-02 | 2022-09-09 | 百奥泰生物制药股份有限公司 | 抗tigit抗体在治疗肿瘤或癌症中的应用 |
| WO2023016450A1 (zh) * | 2021-08-09 | 2023-02-16 | 普米斯生物技术(珠海)有限公司 | 抗tigit抗体及其用途 |
| CN115925945A (zh) * | 2021-09-24 | 2023-04-07 | 广东菲鹏制药股份有限公司 | 抗tigit人源化抗体或其抗原结合片段及其应用 |
Families Citing this family (26)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| TW202402800A (zh) | 2017-05-01 | 2024-01-16 | 美商艾吉納斯公司 | 抗tigit抗體類和使用彼等之方法 |
| IL272227B2 (en) * | 2017-07-27 | 2025-09-01 | iTeos Belgium SA | Anti-tigit antibodies |
| AU2019272384A1 (en) | 2018-05-23 | 2021-01-07 | Beigene, Ltd. | Anti-OX40 antibodies and methods of use |
| KR102776112B1 (ko) | 2018-09-11 | 2025-03-11 | 아이테오스 벨지움 에스에이 | A2a 억제제로서 싸이오카바메이트 유도체, 이의 약학 조성물 및 항암제와의 조합물 |
| CN113993894B (zh) * | 2019-01-07 | 2024-08-02 | Iteos比利时公司 | 抗tigit抗体 |
| TWI760751B (zh) * | 2019-05-29 | 2022-04-11 | 美商美國禮來大藥廠 | Tigit及pd-1/tigit-結合分子 |
| BR112021022171A2 (pt) * | 2019-06-13 | 2021-12-21 | Green Cross Corp | Anticorpo para tigit, seu uso e método para produzir o mesmo |
| JP7122354B2 (ja) * | 2019-09-24 | 2022-08-19 | 財團法人工業技術研究院 | 抗tigit抗体および使用方法 |
| CN114746446A (zh) * | 2019-11-21 | 2022-07-12 | 百济神州有限公司 | 使用抗ox40抗体与抗tigit抗体组合治疗癌症的方法 |
| US20230057899A1 (en) | 2019-12-05 | 2023-02-23 | Compugen Ltd. | Anti-pvrig and anti-tigit antibodies for enhanced nk-cell based tumor killing |
| CN113563470B (zh) * | 2020-04-29 | 2023-02-10 | 广州昂科免疫生物技术有限公司 | 结合tigit抗原的抗体及其制备方法与应用 |
| WO2021258337A1 (en) * | 2020-06-24 | 2021-12-30 | Huahui Health Ltd. | Human monoclonal antibodies against tigit for immune related diseases |
| CA3194641A1 (en) * | 2020-10-26 | 2022-05-05 | Akeso Biopharma, Inc. | Anti-tigit antibody, and pharmaceutical composition and use thereof |
| WO2022111612A1 (zh) * | 2020-11-26 | 2022-06-02 | 信达生物制药(苏州)有限公司 | 包含抗tigit/pd-1双特异性抗体的制剂及其制备方法和用途 |
| CN114539418A (zh) * | 2020-11-26 | 2022-05-27 | 上海华奥泰生物药业股份有限公司 | 双特异性抗体及其用途 |
| EP4293045A4 (en) * | 2021-01-14 | 2024-12-11 | Shanghai Junshi Biosciences Co., Ltd. | PHARMACEUTICAL COMPOSITION OF ANTI-TIGIT ANTIBODY AND ITS APPLICATION |
| CN114790241B (zh) * | 2021-01-26 | 2024-12-13 | 北京免疫方舟医药科技有限公司 | 抗tigit抗体及其应用 |
| CN113150156B (zh) * | 2021-04-22 | 2022-06-07 | 浙江博锐生物制药有限公司 | 抗tigit抗体及其用途 |
| AR125753A1 (es) | 2021-05-04 | 2023-08-09 | Agenus Inc | Anticuerpos anti-tigit, anticuerpos anti-cd96 y métodos de uso de estos |
| CA3219603A1 (en) * | 2021-05-10 | 2022-11-17 | Medimabbio Inc. | Anti-tigit antibodies and use thereof |
| CN115838424A (zh) * | 2021-09-22 | 2023-03-24 | 上海康岱生物医药技术股份有限公司 | 靶向tigit的单克隆抗体 |
| CN116135884A (zh) * | 2021-11-17 | 2023-05-19 | 普米斯生物技术(珠海)有限公司 | 抗tigit-抗pd-l1双特异性抗体、其药物组合物及用途 |
| CN116143923B (zh) * | 2022-12-30 | 2025-11-11 | 合肥天港免疫药物有限公司 | 高亲和力tigit抗体及其应用 |
| WO2024251140A1 (en) * | 2023-06-06 | 2024-12-12 | Wuxi Biologics (Shanghai) Co., Ltd. | Anti-tigit antibodies and uses thereof |
| CN119285774A (zh) * | 2023-10-11 | 2025-01-10 | 首都医科大学附属北京胸科医院 | 抗人tigit单克隆抗体tigit-m007或其功能性片段及其应用 |
| CN119431580B (zh) * | 2024-09-29 | 2025-11-18 | 上海百英生物科技股份有限公司 | 一种抗人tigit单克隆抗体及其应用 |
Family Cites Families (37)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5892019A (en) | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
| WO2003072035A2 (en) | 2002-02-22 | 2003-09-04 | Genentech, Inc. | Compositions and methods for the treatment of immune related diseases |
| US7193069B2 (en) | 2002-03-22 | 2007-03-20 | Research Association For Biotechnology | Full-length cDNA |
| ES2357505T3 (es) | 2002-09-11 | 2011-04-27 | Genentech, Inc. | Composición y procedimientos novedosos para el tratamiento de enfermedades inmunorelacionadas. |
| CN1835975B (zh) * | 2003-08-13 | 2012-11-21 | 辉瑞产品公司 | 经修饰的人类igf-1r抗体 |
| US20070054360A1 (en) | 2005-05-12 | 2007-03-08 | Zeren Gao | Compositions and methods for modulating immune responses |
| EP1963534A2 (en) | 2005-12-19 | 2008-09-03 | Genizon Biosciences Inc. | Genemap of the human gene associated with crohn's disease |
| CA2697193C (en) | 2007-09-14 | 2017-06-06 | Adimab, Inc. | Rationally designed, synthetic antibody libraries and uses therefor |
| US8877688B2 (en) | 2007-09-14 | 2014-11-04 | Adimab, Llc | Rationally designed, synthetic antibody libraries and uses therefor |
| MX2010011088A (es) | 2008-04-09 | 2010-11-05 | Genentech Inc | Composiciones y metodos novedosos para el tratamiento de las enfermedades relacionadas con la inmunidad. |
| CA2755782A1 (en) | 2009-03-18 | 2010-09-23 | Simon Barry | Peptidase inhibitor 16 (pi16) as a biomarker for regulatory t 9treg) cells and uses therefor |
| EP2388336A1 (en) | 2010-05-19 | 2011-11-23 | Signature Diagnostics AG | Method and kits for diagnosing colorectal cancer |
| US8822642B2 (en) | 2010-06-09 | 2014-09-02 | Zymogenetics, Inc. | Dimeric fusion proteins and related compositions and methods |
| WO2012009568A2 (en) | 2010-07-16 | 2012-01-19 | Adimab, Llc | Antibody libraries |
| DE102011005235B4 (de) | 2011-03-08 | 2017-05-24 | Sirs-Lab Gmbh | Verfahren zum Identifizieren einer Teilmenge von Polynucleotiden aus einer dem Humangenom entsprechenden Ausgangsmenge von Polynucleotiden zur in vitro Bestimmung eines Schweregrads der Wirtsantwort eines Patienten |
| DE18200782T1 (de) | 2012-04-02 | 2021-10-21 | Modernatx, Inc. | Modifizierte polynukleotide zur herstellung von proteinen im zusammenhang mit erkrankungen beim menschen |
| WO2013184912A2 (en) | 2012-06-06 | 2013-12-12 | Oncomed Pharmaceuticals, Inc. | Binding agents that modulate the hippo pathway and uses thereof |
| DK2925350T3 (da) | 2012-12-03 | 2019-05-13 | Bristol Myers Squibb Co | Øgning af virksomheden mod cancer af immunomodulatoriske fc- fusionsproteiner |
| HK1221908A1 (zh) | 2013-04-29 | 2017-06-16 | Adimab, Llc | 多特异(polyspecificity)试剂,其制备方法和用途 |
| DK3021869T3 (da) * | 2013-07-16 | 2020-09-21 | Hoffmann La Roche | Fremgangsmåder til behandling af cancer ved anvendelse af PD-1-aksebindende antagonister og TIGIT-hæmmere |
| WO2016011264A1 (en) | 2014-07-16 | 2016-01-21 | Genentech, Inc. | Methods of treating cancer using tigit inhibitors and anti-cancer agents |
| KR102050082B1 (ko) * | 2014-08-19 | 2019-11-29 | 머크 샤프 앤드 돔 코포레이션 | 항-tigit 항체 |
| RU2017119428A (ru) | 2014-11-06 | 2018-12-06 | Дженентек, Инк. | Комбинированная терапия, включающая применение агонистов, связывающихся с ох40, и ингибиторов tigit |
| SG10202006538TA (en) * | 2014-12-23 | 2020-08-28 | Bristol Myers Squibb Co | Antibodies to tigit |
| TWI715587B (zh) * | 2015-05-28 | 2021-01-11 | 美商安可美德藥物股份有限公司 | Tigit結合劑和彼之用途 |
| JO3620B1 (ar) | 2015-08-05 | 2020-08-27 | Amgen Res Munich Gmbh | مثبطات نقطة فحص مناعية للاستخدام في علاج سرطانات محمولة عبر الدم |
| US10766957B2 (en) * | 2015-08-14 | 2020-09-08 | Merck Sharp & Dohme Corp | Anti-TIGIT antibodies |
| EP3353210B8 (en) | 2015-09-25 | 2024-12-18 | F. Hoffmann-La Roche AG | Anti-tigit antibodies and methods of use |
| SG10201912736UA (en) | 2015-10-01 | 2020-02-27 | Potenza Therapeutics Inc | Anti-tigit antigen-binding proteins and methods of use thereof |
| IL261188B (en) * | 2016-03-04 | 2022-08-01 | Jn Biosciences Llc | An anti-tigit antibody that binds to the tigit polypeptide on one or more amino acid residues |
| CN109071656B (zh) | 2017-01-05 | 2021-05-18 | 璟尚生物制药公司 | 检查点调节物拮抗剂 |
| MA47694A (fr) * | 2017-02-28 | 2021-05-19 | Seagen Inc | Anticorps anti-tigit |
| TW202402800A (zh) | 2017-05-01 | 2024-01-16 | 美商艾吉納斯公司 | 抗tigit抗體類和使用彼等之方法 |
| WO2018229163A1 (en) * | 2017-06-14 | 2018-12-20 | King's College London | Methods of activating v delta 2 negative gamma delta t cells |
| IL272227B2 (en) | 2017-07-27 | 2025-09-01 | iTeos Belgium SA | Anti-tigit antibodies |
| SG11202011461TA (en) * | 2018-06-01 | 2020-12-30 | Compugen Ltd | Anti-pvrig/anti-tigit bispecific antibodies and methods of use |
| CN113993894B (zh) * | 2019-01-07 | 2024-08-02 | Iteos比利时公司 | 抗tigit抗体 |
-
2018
- 2018-07-25 IL IL272227A patent/IL272227B2/en unknown
- 2018-07-26 EP EP20173561.0A patent/EP3719040A1/en active Pending
- 2018-07-26 CN CN201880048693.8A patent/CN110997720B/zh active Active
- 2018-07-26 JP JP2020527852A patent/JP7366897B2/ja active Active
- 2018-07-26 KR KR1020207005664A patent/KR102731476B1/ko active Active
- 2018-07-26 ES ES18750302T patent/ES2812236T3/es active Active
- 2018-07-26 MX MX2020000960A patent/MX2020000960A/es unknown
- 2018-07-26 CA CA3070791A patent/CA3070791A1/en active Pending
- 2018-07-26 SG SG11202000660QA patent/SG11202000660QA/en unknown
- 2018-07-26 CN CN202411294417.3A patent/CN119841950A/zh active Pending
- 2018-07-26 AU AU2018306463A patent/AU2018306463B2/en active Active
- 2018-07-26 US US16/634,506 patent/US20200407445A1/en not_active Abandoned
- 2018-07-26 BR BR112020001499-0A patent/BR112020001499A2/pt not_active Application Discontinuation
- 2018-07-26 EP EP18750302.4A patent/EP3484925B1/en active Active
- 2018-07-27 AR ARP180102114A patent/AR112768A1/es unknown
- 2018-07-27 TW TW107126050A patent/TWI812632B/zh active
- 2018-10-12 US US16/159,506 patent/US10329349B2/en active Active
-
2019
- 2019-05-15 US US16/413,557 patent/US11439705B2/en active Active
-
2020
- 2020-01-24 MX MX2024000742A patent/MX2024000742A/es unknown
-
2022
- 2022-07-25 US US17/872,494 patent/US20230190931A1/en active Pending
- 2022-09-16 US US17/946,158 patent/US20230181731A1/en not_active Abandoned
-
2023
- 2023-07-28 JP JP2023123773A patent/JP2023153911A/ja active Pending
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112794909A (zh) * | 2021-02-04 | 2021-05-14 | 广州爱思迈生物医药科技有限公司 | 一种抗tigit单克隆抗体及其应用 |
| WO2022179567A1 (zh) * | 2021-02-24 | 2022-09-01 | 克莱格医学有限公司 | Tigit工程化细胞及其组合物 |
| WO2022184067A1 (zh) * | 2021-03-02 | 2022-09-09 | 百奥泰生物制药股份有限公司 | 抗tigit抗体在联合用药中的应用 |
| WO2022184068A1 (zh) * | 2021-03-02 | 2022-09-09 | 百奥泰生物制药股份有限公司 | 抗tigit抗体在治疗肿瘤或癌症中的应用 |
| WO2023016450A1 (zh) * | 2021-08-09 | 2023-02-16 | 普米斯生物技术(珠海)有限公司 | 抗tigit抗体及其用途 |
| CN115925945A (zh) * | 2021-09-24 | 2023-04-07 | 广东菲鹏制药股份有限公司 | 抗tigit人源化抗体或其抗原结合片段及其应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| MX2020000960A (es) | 2020-07-22 |
| IL272227A (en) | 2020-03-31 |
| AU2018306463B2 (en) | 2025-03-27 |
| CN110997720A (zh) | 2020-04-10 |
| JP2020528768A (ja) | 2020-10-01 |
| KR20200100589A (ko) | 2020-08-26 |
| AR112768A1 (es) | 2019-12-11 |
| EP3484925A1 (en) | 2019-05-22 |
| IL272227B2 (en) | 2025-09-01 |
| KR102731476B1 (ko) | 2024-11-18 |
| US20230190931A1 (en) | 2023-06-22 |
| JP7366897B2 (ja) | 2023-10-23 |
| EP3719040A1 (en) | 2020-10-07 |
| JP2023153911A (ja) | 2023-10-18 |
| SG11202000660QA (en) | 2020-02-27 |
| CN110997720B (zh) | 2024-10-01 |
| AU2018306463A1 (en) | 2020-03-05 |
| EP3484925B1 (en) | 2020-05-27 |
| BR112020001499A2 (pt) | 2020-09-08 |
| US20230181731A1 (en) | 2023-06-15 |
| IL272227B1 (en) | 2025-05-01 |
| MX2024000742A (es) | 2024-02-09 |
| US10329349B2 (en) | 2019-06-25 |
| CN119841950A (zh) | 2025-04-18 |
| TWI812632B (zh) | 2023-08-21 |
| CA3070791A1 (en) | 2019-01-31 |
| TW201910351A (zh) | 2019-03-16 |
| US11439705B2 (en) | 2022-09-13 |
| ES2812236T3 (es) | 2021-03-16 |
| US20190100591A1 (en) | 2019-04-04 |
| US20190315867A1 (en) | 2019-10-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230181731A1 (en) | Anti-TIGIT Antibodies | |
| WO2019023504A1 (en) | ANTI-TIGIT ANTIBODIES | |
| US12312401B2 (en) | Anti-TIGIT antibodies | |
| US20220098312A1 (en) | Anti-neuropilin antigen-binding proteins and methods of use thereof | |
| EP3356413A1 (en) | Anti-tigit antigen-binding proteins and methods of use thereof | |
| EA045372B1 (ru) | Анти-tigit антитела | |
| HK40027182B (zh) | 抗tigit抗体 | |
| HK40027182A (en) | Anti-tigit antibodies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: ITEOS THERAPEUTICS SA, BELGIUM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ADIMAB, LLC;REEL/FRAME:052059/0129 Effective date: 20181002 Owner name: ADIMAB LLC, NEW HAMPSHIRE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:COOPER, ANTHONY;REEL/FRAME:052059/0126 Effective date: 20180731 Owner name: ITEOS THERAPEUTICS SA, BELGIUM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:QUEVA, CHRISTOPHE;DENIES, SOFIE;HOOFD, CATHERINE;AND OTHERS;REEL/FRAME:052059/0119 Effective date: 20180809 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| AS | Assignment |
Owner name: ITEOS BELGIUM SA, BELGIUM Free format text: CHANGE OF NAME;ASSIGNOR:ITEOS THERAPEUTICS SA;REEL/FRAME:054677/0908 Effective date: 20200313 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |