US20180044430A1 - FC Engineered Anti-TNFR Superfamily Member Antibodies Having Enhanced Atonistic Activity and Methods of Using Them - Google Patents
FC Engineered Anti-TNFR Superfamily Member Antibodies Having Enhanced Atonistic Activity and Methods of Using Them Download PDFInfo
- Publication number
- US20180044430A1 US20180044430A1 US15/668,895 US201715668895A US2018044430A1 US 20180044430 A1 US20180044430 A1 US 20180044430A1 US 201715668895 A US201715668895 A US 201715668895A US 2018044430 A1 US2018044430 A1 US 2018044430A1
- Authority
- US
- United States
- Prior art keywords
- mutation
- antibody
- cancer
- seq
- antibodies
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/72—Increased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
Definitions
- the present invention relates to engineered anti-TNFR superfamily member antibodies having enhanced agonistic activity and methods of using them.
- Fc ⁇ receptors Fc ⁇ receptors
- Fc ⁇ RIIB Fc ⁇ RIIB
- the invention provides for an isolated anti-tumor necrosis factor receptor (TNFR) superfamily member antibody, wherein the antibody comprises an E345R mutation, an E345R/E430G mutation or an E345R/E430G/S440Y mutation, residue numbering according to the EU Index, and has enhanced agonistic activity when compared to a parental antibody without the mutation.
- TNFR tumor necrosis factor receptor
- the invention also provides for a pharmaceutical composition
- a pharmaceutical composition comprising the antibody of the invention and a pharmaceutically acceptable carrier.
- the invention also provides for a method of enhancing an agonistic activity of an anti-TNFR superfamily member antibody in a subject, comprising introducing an E345R mutation, an E345R/E430G mutation or a E345R/E430G/S440Y mutation into the antibody to generate an engineered antibody specifically binding the TNFR superfamily member, and administering the engineered antibody to the subject.
- the invention also provides for a method of treating a cancer in a subject, comprising administering to the subject an anti-TNFR superfamily member antibody comprising an E345R mutation, an E430G mutation, an E345R/E430G mutation or an E345R/E430G/S440Y for a time sufficient to treat the cancer.
- the invention also provides an isolated anti-tumor necrosis factor receptor (TNFR) superfamily member antibody comprising an E345R mutation, an E345R/E430G mutation or an E345R/E430G/S440Y mutation, residue numbering according to the EU Index, and has enhanced agonistic activity when compared to a parental antibody without the mutation for use in the treatment of a cancer.
- TNFR tumor necrosis factor receptor
- the invention also provides for a use of an isolated anti-tumor necrosis factor receptor (TNFR) superfamily member antibody comprising an E345R mutation, an E345R/E430G mutation or an E345R/E430G/S440Y mutation, residue numbering according to the EU Index, in the manufacture of a medicament for the treatment of cancer.
- TNFR tumor necrosis factor receptor
- FIG. 1A shows that agonistic activity of anti-OX40 antibody is cross-linking dependent.
- OX40SF2IgG1 induced signaling only in the presence of cross-linker protein G beads in HEK-BlueTM NF ⁇ B reporter assay.
- Increasing concentrations (1 ng/ml to 1000 ng/ml) of OX40 ligand or OX40SF2IgG1 in the absence or presence of protein G beads were incubated with HEK-BlueTM cells stabely expressing OX40 and a secreted embryonic alkaline phosphatase (SEAP) reporter gene under the control of NF ⁇ B-inducible promoter.
- SEAP secreted embryonic alkaline phosphatase
- FIG. 1B shows that co-culturing with Raji cells fails to significantly enhance the agonistic activity of SF2 antibody with native human IgG1 Fc.
- Increasing concentrations (10 to 1000 ng/mL) of OX40SF2IgG1 antibody were incubated with HEK-Blue: OX40 cells with or without co-culturing with Raji cells and their agonistic activities were assessed by HEK-Blue NF- ⁇ B reporter assay.
- FIG. 2A shows that OX40SF2IgG1 S267E/L328F and OX40SF2IgG1V12 have enhanced binding to Fc ⁇ RIIB when compared to the wild-type IgG1 (OX40SF2IgG1).
- Expi293F cells expressing Fc ⁇ RIIB were incubated with increasing concentrations (1 ng/ml to 10000 ng/ml) of OX40SF2IgG1, OX40SF2IgG1S267E/L328F and OX40SF2IgG1V12, and binding of the antibodies were assessed using flow cytometry.
- FIG. 2B shows that OX40SF2IgG1S267E/L328F has enhanced binding to Fc ⁇ RIIA when compared to the wild-type IgG1 (OX40SF2IgG1), whereas OX40SF2IgG1V12 had comparable binding.
- FIG. 2C shows that OX40SF2IgG1V12 has reduced binding to Fc ⁇ RI when compared to the wild-type IgG1 (OX40SF2IgG1), whereas OX40SF2IgG1S267E/L328F had comparable binding.
- Expi293F cells expressing Fc ⁇ RI were incubated with increasing concentrations (1 ng/ml to 10000 ng/ml) of OX40SF2IgG1, OX40SF2IgG1S267E/L328F and OX40SF2IgG1V12, and binding of the antibodies were assessed using flow cytometry.
- FIG. 2D shows that OX40SF2IgG1S267E/L328F and OX40SF2IgG1V12 have abolished binding to Fc ⁇ RIIIA.
- FIG. 3A shows that OX40SF2IgG1S267E/L328F and OX40SF2IgG1V12 have enhanced binding to Raji cells expressing Fc ⁇ RIIB receptors when compared to the wild-type IgG1 (OX40SF2IgG1).
- Increasing concentrations (3 ng/ml to 10000 ng/ml) of OX40SF2IgG1, OX40SF2IgG1S267E/L328F and OX40SF2IgG1V12 were assessed for their binding to Raji cells by flow cytometry assay.
- Mean fluorescence signals were plotted vs. concentrations of test antibodies. Data are presented as mean ⁇ SEM, n ⁇ 3.
- FIG. 3B shows that binding of OX40SF2IgG1S267E/L328F and OX40SF2IgG1V12 to Raji cells is Fc ⁇ RIIB dependent.
- Raji cells were pretreated with 5 ⁇ g/ml of anti-Fc ⁇ RIIB antibody 2B6 and the binding of 1 ⁇ g/ml of antibodies to Raji cells were assessed by flow cytometry.
- FIG. 3C shows that the agonistic activity of OX40SF2IgG1S267E/L328F is dependent on antibody cross-linking by Fc ⁇ RIIB on Raji cells.
- Increasing concentrations (10 ng/ml to 1000 ng/ml) of OX40SF2IgG1S267E/L328F were incubated with HEK-BlueTM cells stably expressing OX40 with or without co-culture with Raji cells which were in some assays pre-incubated with 5 ⁇ g/ml of the anti-Fc ⁇ RIIB antibody 2B6 antibody before initiation of the co-cultures.
- the y axis shows the agonistic activity of anti-OX40 antibodies normalized as percent activity mediated by 1 ⁇ g/ml OX40 ligand. Data are presented as mean ⁇ SEM, n ⁇ 6.
- FIG. 3D shows that the agonistic activity of OX40SF2IgG1V12 is dependent on antibody cross-linking by Fc ⁇ RIIB on Raji cells.
- Increasing concentrations (10 ng/ml to 1000 ng/ml) of OX40SF2IgG1V12 were incubated with HEK-BlueTM cells stably expressing OX40 with or without co-culture with Raji cells which were in some assays pre-incubated with 5 ⁇ g/ml of the anti-Fc ⁇ RIIB (2B6) antibody before initiation of the co-cultures.
- the y axis shows the agonistic activity of anti-OX40 antibodies normalized as percent activity mediated by 1 ⁇ g/ml OX40 ligand. Data are presented as mean ⁇ SEM, n ⁇ 6.
- FIG. 4A shows that OX40SF2IgG1V12 and OX40SF2IgG1S267E/L328F have abolished ADCC.
- Increasing concentrations (10 ng/ml to 1000 ng/ml) of OX40SF2IgG1S267E/L328F, OX40SF2IgG1V12 and OX40SF2IgG1 were incubated with HEK-BlueTM cells stably expressing OX40 co-cultured with effectors cells and ADCC reporter bioassays were performed.
- the fold activation (over the control sample without an antibody added) of ADCC activities were plotted vs. concentrations of test antibodies. Data are presented as mean ⁇ SEM, n ⁇ 6.
- FIG. 4B shows that OX40SF2IgG1V12 and OX40SF2IgG1S267E/L328F retain their ADCP activity.
- Increasing concentrations (1 ng/ml to 1000 ng/ml) of OX40SF2IgG1S267E/L328F, OX40SF2IgG1V12 and OX40SF2IgG1 were incubated with GFP positive HEK-BlueTM cells stably expressing OX40 co-cultured with differentiated macrophages and the phagocytosis of GFP positive target cells were evaluated by flow cytometry assay. The percentages of GFP positive cells eliminated, which reflect the ADCP activities, were plotted vs. concentrations of test antibodies. Data are presented as mean ⁇ SEM, n ⁇ 6.
- FIG. 4C shows that OX40SF2IgG1V12 has reduced binding to differentiated macrophages whereas OX40SF2IgG1S267E/L328F binds to macrophages at similar levels as the wild-type antibody (OX40SF2IgG1).
- OX40SF2IgG1S267E/L328F binds to macrophages at similar levels as the wild-type antibody (OX40SF2IgG1).
- Increasing concentrations (1 ng/ml to 1000 ng/ml) of OX40SF2IgG1, OX40SF2IgG1S267E/L328F and OX40SF2IgG1V12 antibodies were incubated with differentiated macrophages and their binding was assessed using flow cytometry assays.
- FIG. 4D shows that OX40SF2IgG1V12 and OX40SF2IgG1S267E/L328F do not mediate CDC.
- Increasing concentrations (10 to 10,000 ng/ml) of OX40SF2IgG1, OX40SF2IgG1S267E/L328F and OX40SF2IgG1V12 antibodies were incubated with HEK-BlueTM cells stably expressing OX40 in the presence of rabbit complement.
- LDH lactate dehydrogenase
- FIG. 5 shows the corrected bioluminescence resonance energy transfer (BRET) ratios obtained from the NanoBRETTM PPI assay for OX40SF2IgG1, OX40SF2IgG1E345R, OX40SF2IgG1E430G, OX40SF2IgG1E345R/E430G and OX40SF2IgG1E345R/E430G/S440Y, indicative of degree of antibody multimerization on the surface of OX40-expressing cell.
- BRET bioluminescence resonance energy transfer
- OX40SF2IgG1-n, OX40SF2IgG1E345R-n, OX40SF2IgG1E430G-n, OX40SF2IgG1E345R/E430G-n, and OX40SF2IgG1E345R/E430G/S440Y ⁇ n are constructs that are in-frame with C-terminal Nanoluc sequences.
- OX40SF2IgG1-h, OX40SF2IgG1E345R-h, OX40SF2IgG1E430G-h, OX40SF2IgG1E345R/E430G-h, and OX40SF2IgG1E345R/E430G/S440Y-h are constructs that are in-frame with C-terminal Halotag sequences.
- Increasing concentrations (from 10 ng/ml to 1000 ng/ml) of both Nanoluc® donor antibody and Halo Tag® acceptor antibody were applied to HEK-BlueTM cells stabely expressing OX40 cells and NanoBRET PPI assays were conducted.
- the Mean Corrected BRET ratio were plotted vs. concentrations of test antibodies. Data are presented as mean ⁇ SEM, n 2.
- FIG. 6A shows enhanced agonistic activity of OX40SF2IgG1E345R, OX40SF2IgG1E430G, OX40SF2IgG1E345R/E430G and OX40SF2IgG1E345R/E430G/S440Y when compared to OX40SF2IgG1 in a HEK-BlueTM NF ⁇ B reporter assay.
- OX40SF2IgG1, OX40SF2IgG1E345R, OX40SF2IgG1E430G, OX40SF2IgG1E345R/E430G and OX40SF2IgG1E345R/E430G/S440Y antibodies were applied to HEK-BlueTM cells stably expressing OX40, and SEAP secretion was measured.
- the agonistic activity was normalized as percent activity relative to that driven by 1 ⁇ g/ml OX40 ligand and plotted vs. concentrations of test antibodies. Data are presented as mean ⁇ SEM, n ⁇ 9.
- FIG. 6C shows that OX40SF2IgG2sigma antibody, which is silent in binding to Fc receptors, either alone or cross-linked in the presence of Raji cells has no agonistic activity in a HEK-BlueTM NF ⁇ B reporter assay.
- FIG. 6D shows that E345R mutation rescued agonistic activity of OX40SF2IgG2sigma in a HEK-BlueTM NF ⁇ B reporter assay.
- cross-linking with Raji cells failed to further boost its agonistic activity.
- FIG. 7A shows that OX40SF2IgG1E345R has enhanced ADCC when compared to the wild-type antibody (OX40SF2IgG1), and that Fc silent OX40SF2IgG2sigma and OX40SF2IgG2sigmaE345R antibodies have abrogated ADCC.
- OX40SF2IgG1, OX40SF2IgG1E345R, OX40SF2IgG2sigma and OX40SF2IgG2sigmaE345R were incubated with HEK-BlueTM cells stably expressing OX40 co-cultured with effectors cells and the ADCC reporter bioassays were performed. The fold of activation of ADCC when compared to a sample without antibody were plotted vs. concentrations of test antibodies. Data are presented as mean ⁇ SEM, n ⁇ 4.
- FIG. 7B shows that OX40SF2IgG1E345R has comparable ADCP to that of the wild-type IgG1 (OX40SF2IgG1), and that E345R rescues ADCP in effector silent antibody (OX40SF2IgG2sigmaE345R).
- OX40SF2IgG1, OX40SF2IgG1E345R, OX40SF2IgG2sigma and OX40SF2IgG2sigmaE345R antibodies were incubated with GFP positive HEK-BlueTM cells stably expressing OX40 with differentiated macrophages and the phagocytosis of GFP positive target cells were evaluated by flow cytometry assay. The percentages of GFP positive cells eliminated, which reflect the ADCP activities, were plotted vs. concentrations of test antibodies. Data are presented as mean ⁇ SEM, n ⁇ 9.
- FIG. 7C shows that E345R mutation resulted in enhanced CDC activity of OX20SF2IgG1E345R but had no effect on effector silent OX40SF2IgG2sigmaE345R.
- Increasing concentrations (10 to 10,000 ng/ml) of OX40SF2IgG1, OX40SF2IgG1E345R, OX40SF2IgG2sigma, and OX40SF2IgG2sigmaE345R antibodies were incubated with HEK-BlueTM cells stably expressing OX40 in the presence of rabbit complement.
- Anti-tumor necrosis factor receptor (TNFR) superfamily member antibody or “anti-TNFR superfamily member antibody” refers to an antibody that specifically binds a TNFR superfamily member.
- TNFR superfamily member includes receptors that belong to the TNFR superfamily, including the receptors shown in Table 1, including naturally occurring variants of the TNFRs.
- the TNFRs are typically expressed as type I transmembrane proteins and contain one to six cysteine-rich domains in their extracellular domain. Signaling occurs as a TNFR trimer.
- An amino acid sequence for one isoform for each TNFR is shown in Table 1.
- the ligand(s) of the TNFRs are also indicated in Table 1.
- TNFR superfamily member Ligand(s) of the TNFR superfamily member Name SEQ ID NO: Name SEQ ID NO: Tumor necrosis factor 1 TNF-alpha (cachectin) 28 receptor 1 (CD120a) Tumor necrosis factor 2 TNF-alpha (cachectin) 28 receptor 2 (CD120b) Lymphotoxin beta 3 Lymphotoxin beta (TNF- 29 receptor (CD18) C) OX40 (CD134) 4 OX40L 30 CD40 5 CD154 31 Fas receptor (CD95) 6 FasL 32 Decoy receptor 3 (TR6) 7 FasL, LIGHT, TL1A 32 (FASL), 33 (LIGHT), 34 (TL1A) CD27 8 CD70, Siva 35 (CD70), 36 (Siva) CD30 9 CD153 37 4-1BB (CD137) 10 4-1BB ligand 38 Death receptor 11 TRAIL 39 4 (TRAILR1) Death receptor 12 TRAIL 39 5 (TRAILR2) Decoy receptor 13 TRAIL 39 1
- Specific binding or “specifically binds” or “binds” refers to an anti-TNFR superfamily member antibody binding to a particular TNFR superfamily member or an epitope within the particular TNFR superfamily member with greater affinity than for other antigens.
- the antibody “specifically binds” when the equilibrium dissociation constant (K D ) for binding is about 1 ⁇ 10 ⁇ 8 M or less, for example about 1 ⁇ 10 ⁇ 9 M or less, about 1 ⁇ 10 ⁇ 10 M or less, about 1 ⁇ 10 ⁇ 11 M or less, or about 1 ⁇ 10 ⁇ 12 M or less, typically with the K D that is at least one hundred-fold less than its K D for binding to a non-specific antigen (e.g., BSA, casein).
- K D equilibrium dissociation constant
- the dissociation constant may be measured using standard procedures.
- Anti-TNFR superfamily member antibodies that specifically bind to the particular TNFR superfamily member or an epitope within the particular TNFR superfamily member may, however, have cross-reactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno), Pan troglodytes (chimpanzee, chimp) or Callithrix jacchus (common marmoset, marmoset). While a monospecific antibody specifically binds one antigen or one epitope, a bispecific antibody specifically binds two distinct antigens or two distinct epitopes.
- Antibodies is meant in a broad sense and includes immunoglobulin molecules including monoclonal antibodies including murine, human, humanized and chimeric monoclonal antibodies, antibody fragments, bispecific or multispecific antibodies, dimeric, tetrameric or multimeric antibodies, single chain antibodies, domain antibodies and any other modified configuration of the immunoglobulin molecule that comprises an antigen binding site of the required specificity.
- “Full-length antibody molecules” are comprised of two heavy chains (HC) and two light chains (LC) inter-connected by disulfide bonds as well as multimers thereof (e.g. IgM). Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (comprised of domains CH1, hinge, CH2 and CH3).
- Each light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL).
- VL light chain variable region
- CL light chain constant region
- the VH and the VL regions may be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FR segments, arranged from amino-to-carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
- CDR complementarity determining regions
- CDRs are “antigen binding sites” in an antibody.
- CDRs may be defined using various terms: (i) Complementarity Determining Regions (CDRs), three in the VH (HCDR1, HCDR2, HCDR3) and three in the VL (LCDR1, LCDR2, LCDR3) are based on sequence variability (Wu et al. (1970) J Exp Med 132: 211-50; Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991).
- “Hypervariable regions”, “HVR”, or “HV”, three in the VH (H1, H2, H3) and three in the VL (L1, L2, L3) refer to the regions of an antibody variable domains which are hypervariable in structure as defined by Chothia and Lesk (Chothia et al. (1987) J Mol Biol 196: 901-17).
- the International ImMunoGeneTics (IMGT) database http://www_imgt_org) provides a standardized numbering and definition of antigen-binding sites. The correspondence between CDRs, HVs and IMGT delineations is described in (Lefranc et al. (2003) Dev Comp Immunol 27: 55-77.
- CDR CDR
- HCDR1 CDR1
- HCDR2 CDR3
- LCDR1 CDR2
- LCDR3 CDR3
- Immunoglobulins may be assigned to five major classes, IgA, IgD, IgE, IgG and IgM, depending on the heavy chain constant domain amino acid sequence.
- IgA and IgG are further sub-classified as the isotypes IgA1, IgA2, IgG1, IgG2, IgG3 and IgG4.
- Antibody light chains of any vertebrate species may assigned to one of two clearly distinct types, namely kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains.
- Antibody fragments refers to a portion of an immunoglobulin molecule that retains the heavy chain and/or the light chain antigen binding site, such as heavy chain complementarity determining regions (HCDR) 1, 2 and 3, light chain complementarity determining regions (LCDR) 1, 2 and 3, a heavy chain variable region (VH), or a light chain variable region (VL).
- Antibody fragments include well known Fab, F(ab′)2, Fd and Fv fragments as well as domain antibodies (dAb) consisting of one VH domain.
- VH and VL domains may be linked together via a synthetic linker to form various types of single chain antibody designs where the VH/VL domains may pair intramolecularly, or intermolecularly in those cases when the VH and VL domains are expressed by separate single chain antibody constructs, to form a monovalent antigen binding site, such as single chain Fv (scFv) or diabody; described for example in Int. Patent Publ. Nos. WO1998/44001, WO1988/01649, WO1994/13804 and WO1992/01047.
- scFv single chain Fv
- “Monoclonal antibody” refers to an antibody population with single amino acid composition in each heavy and each light chain, except for possible well known alterations such as removal of C-terminal lysine from the antibody heavy chain or alterations due to post-translational modification(s) of amino acids, such as methionine oxidation or asparagine or glutamine deamidation.
- Monoclonal antibodies typically bind one antigenic epitope, except that bispecific monoclonal antibodies bind two distinct antigenic epitopes.
- Monoclonal antibodies may have heterogeneous glycosylation within the antibody population.
- Monoclonal antibody may be monospecific or multispecific, or monovalent, bivalent or multivalent. A bispecific antibody is included in the term monoclonal antibody.
- isolated antibody refers to an antibody or antibody fragment that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody specifically binding for example OX-40 is substantially free of antibodies that specifically bind antigens other than OX-40). “Isolated antibody” encompasses antibodies that are isolated to a higher purity, such as antibodies that are 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% pure.
- Humanized antibody refers to an antibody in which the antigen binding sites are derived from non-human species and the variable region frameworks are derived from human immunoglobulin sequences. Humanized antibody may include substitutions in the framework so that the framework may not be an exact copy of expressed human immunoglobulin or human immunoglobulin germline gene sequences.
- Human antibody refers to an antibody having heavy and light chain variable regions in which both the framework and the antigen binding site are derived from sequences of human origin and is optimized to have minimal immune response when administered to a human subject. If the antibody contains a constant region or a portion of the constant region, the constant region also is derived from sequences of human origin.
- Human antibody comprises heavy or light chain variable regions that are “derived from” sequences of human origin if the variable regions of the antibody are obtained from a system that uses human germline immunoglobulin or rearranged immunoglobulin genes.
- Such exemplary systems are human immunoglobulin gene libraries displayed on phage, and transgenic non-human animals such as mice or rats carrying human immunoglobulin loci as described herein.
- “Human antibody” may contain amino acid differences when compared to the human germline immunoglobulin or rearranged immunoglobulin genes due to differences between the systems used to obtain the antibody and human immunoglobulin loci, introduction of somatic mutations or intentional introduction of substitutions into the framework or antigen binding site, or both.
- human antibody is at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical in amino acid sequence to an amino acid sequence encoded by human germline immunoglobulin or rearranged immunoglobulin genes.
- “human antibody” may contain consensus framework sequences derived from human framework sequence analyses, for example as described in (Knappik et al. (2000) J Mol Biol 296: 57-86), or synthetic HCDR3 incorporated into human immunoglobulin gene libraries displayed on phage, for example as described in (Shi et al. (2010) J Mol Biol 397: 385-96, and in Int. Patent Publ. No. WO2009/085462.
- Human antibodies derived from human immunoglobulin sequences may be generated using systems such as phage display incorporating synthetic CDRs and/or synthetic frameworks, or may be subjected to in vitro mutagenesis to improve antibody properties, resulting in antibodies that are not expressed by the human antibody germline repertoire in vivo.
- Antibodies in which antigen binding sites are derived from a non-human species are not included in the definition of “human antibody”.
- Recombinant refers to antibodies and other proteins that are prepared, expressed, created or isolated by recombinant means.
- Epitope refers to a portion of an antigen to which an antibody specifically binds. Epitopes typically consist of chemically active (such as polar, non-polar or hydrophobic) surface groupings of moieties such as amino acids or polysaccharide side chains and may have specific three-dimensional structural characteristics, as well as specific charge characteristics. An epitope may be composed of contiguous and/or discontiguous amino acids that form a conformational spatial unit. For a discontiguous epitope, amino acids from differing portions of the linear sequence of the antigen come in close proximity in 3-dimensional space through the folding of the protein molecule. Antibody “epitope” depends on the methodology used to identify the epitope.
- Bispecific refers to an antibody that specifically binds two distinct antigens or two distinct epitopes within the same antigen.
- the bispecific antibody may have cross-reactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno), Pan troglodytes (chimpanzee, chimp) or Callithrix jacchus (common marmoset, marmoset), or may bind an epitope that is shared between two or more distinct antigens.
- homologs such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno), Pan troglodytes (chimpanzee, chimp) or Callithrix jacchus (common marmoset, marmoset), or may bind an epitope that is shared between two or more distinct antigens.
- Multispecific refers to an antibody that specifically binds two or more distinct antigens or two or more distinct epitopes within the same antigen.
- Vector refers to a polynucleotide capable of being duplicated within a biological system or that can be moved between such systems.
- Vector polynucleotides typically contain elements, such as origins of replication, polyadenylation signal or selection markers, that function to facilitate the duplication or maintenance of these polynucleotides in a biological system, such as a cell, virus, animal, plant, and reconstituted biological systems utilizing biological components capable of duplicating a vector.
- the vector polynucleotide may be DNA or RNA molecules or a hybrid of these, single stranded or double stranded.
- “Expression vector” refers to a vector that can be utilized in a biological system or in a reconstituted biological system to direct the translation of a polypeptide encoded by a polynucleotide sequence present in the expression vector.
- Polynucleotide refers to a synthetic molecule comprising a chain of nucleotides covalently linked by a sugar-phosphate backbone or other equivalent covalent chemistry.
- cDNA is a typical example of a synthetic polynucleotide.
- Polypeptide or “protein” refers to a molecule that comprises at least two amino acid residues linked by a peptide bond to form a polypeptide Small polypeptides of less than 50 amino acids may be referred to as “peptides”.
- a “cancer cell” or a “tumor cell” as used herein refers to a cancerous, pre-cancerous or transformed cell, either in vivo, ex vivo, or in tissue culture, that has spontaneous or induced phenotypic changes. These changes do not necessarily involve the uptake of new genetic material. Although transformation may arise from infection with a transforming virus and incorporation of new genomic nucleic acid, uptake of exogenous nucleic acid or it can also arise spontaneously or following exposure to a carcinogen, thereby mutating an endogenous gene.
- Transformation/cancer is exemplified by morphological changes, immortalization of cells, aberrant growth control, foci formation, proliferation, malignancy, modulation of tumor specific marker levels, invasiveness, tumor growth in suitable animal hosts such as nude mice, and the like, in vitro, in vivo, and ex vivo (Freshney, Culture of Animal Cells: A Manual of Basic Technique (3rd ed. 1994)).
- “About” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. Unless explicitly stated otherwise within the Examples or elsewhere in the Specification in the context of a particular assay, result or embodiment, “about” means within one standard deviation per the practice in the art, or a range of up to 5%, whichever is larger.
- Value refers to the presence of a specified number of binding sites specific for an antigen in a molecule.
- the terms “monovalent”, “bivalent”, “tetravalent”, and “hexavalent” refer to the presence of one, two, four and six binding sites, respectively, specific for an antigen in a molecule.
- Antagonist refers to an antibody that induces at least one biological activity of the TNFR superfamily member the antibody binds to that is induced by a natural ligand of the TNFR superfamily member.
- exemplary agonistic activities include induction of production of a secreted embryonic alkaline phosphatase (SEAP) expressed under the control of NF ⁇ B-inducible promoter in an in vitro assay, induction of dendritic cell (DC) differentiation assessed by increased CD80, CD83, CD86 and HLA-DR surface expression on DC, activation of B cells assessed by increased B cell proliferation or increased CD23, CD80, CD83, CD86 and HLA-DR surface expression on B cells, induction of antigen-specific T cell recall responses assessed by production of interferon- ⁇ (IFN- ⁇ ) by PBMCs isolated from patients previously exposed to the antigen, and induction of CD4 + or CD8 + T cell proliferation.
- Agonistic activity e.g., agonism
- Agonistic activity may be cross-link
- “Enhanced agonistic activity” or “enhanced agonism” refers to improvement in agonism of an engineered anti-TNFR superfamily member antibody when compared to the parental wild-type antibody, when agonistic activity is measured by anti-TNFR superfamily member antibody-induced production of secreted embryonic alkaline phosphatase (SEAP) expressed under the control of NF ⁇ B-inducible promoter.
- SEAP secreted embryonic alkaline phosphatase
- the engineered antibody has “enhanced agonistic activity” when it induces SEAP production at a level that is at least 20% higher when compared to the wild-type parental antibody at antibody concentration of 1 ⁇ g/mL in either cross-linking dependent or cross-linking independent manner.
- Cross-linking refers to the higher order multimerization of an anti-TNFR superfamily member antibody on cells expressing the TNFR superfamily member, induced by the antibody binding to Fc ⁇ R, for example Fc ⁇ RIIb cis or trans, resulting in antibody-induced multimerization of TNFR and induction of TNFR agonistic activity.
- Cross-linking may be evaluated in vitro by using anti-human F(ab′)2 as a cross-linker, or cells expressing Fc ⁇ RIIb, such as Raji cells as described herein.
- “Agonistic activity independent of antibody cross-linking” means that the antibody induces production of SEAP in a HEKBlueTM reporter assay as described in Example 3 herein in solution in the absence of Raji cells expressing Fc ⁇ R, for example Fc ⁇ RIIB.
- Subject includes any human or nonhuman animal “Nonhuman animal” includes all vertebrates, e.g., mammals and non-mammals, such as nonhuman primates, sheep, dogs, cats, horses, cows chickens, amphibians, reptiles, etc.
- the present invention provides engineered anti-TNFR superfamily member antibodies having improved properties displaying enhanced agonistic activity coupled with isotype-dependent modulation of antibody effector functions.
- the invention is based, at least in part, on the finding that substitutions that multimerize anti-TNFR superfamily member antibodies on the surface cells enhance agonistic activity of the antibodies independent of cross-linking.
- the invention provides for an isolated anti-tumor necrosis factor receptor (TNFR) superfamily member antibody, wherein the antibody comprises an E345R mutation, optionally further comprising an E430G mutation, a S440Y mutation, or an E430G/S440Y mutation, residue numbering according to the EU Index, and has enhanced agonistic activity when compared to a parental antibody without the mutation.
- TNFR tumor necrosis factor receptor
- the invention also provides for an isolated anti-tumor necrosis factor receptor (TNFR) superfamily member antibody, wherein the antibody comprises an E345R mutation, an E345R/E430G mutation or a E345R/E430G/S440Y mutation, residue numbering according to the EU Index, and has enhanced agonistic activity when compared to a parental antibody without the mutation.
- TNFR tumor necrosis factor receptor
- the E345R substitution was shown herein to enhance agonistic activity of an anti-TNFR superfamily member antibody.
- the E430G substitution was shown herein to enhance agonistic activity of an anti-TNFR superfamily member antibody.
- the E345R/E430G substitution was shown herein to enhance agonistic activity of an anti-TNFR superfamily member antibody.
- the E345R/E430G/S440Y substitution was shown herein to enhance agonistic activity of an anti-TNFR superfamily member antibody.
- the invention also provides for an isolated anti-TNFR superfamily member antibody, wherein the antibody comprises an E345R mutation, residue numbering according to the EU Index, and has enhanced agonistic activity when compared to the parental antibody without the E345R mutation.
- the invention also provides for an isolated anti-TNFR superfamily member antibody, wherein the antibody comprises an E430G mutation, residue numbering according to the EU Index, and has enhanced agonistic activity when compared to the parental antibody without the E430G mutation.
- the invention also provides for an isolated anti-TNFR superfamily member antibody, wherein the antibody comprises an E345R/E430G mutation, residue numbering according to the EU Index, and has enhanced agonistic activity when compared to the parental antibody without the E345R/E430G mutation.
- the invention also provides for an isolated anti-TNFR superfamily member antibody, wherein the antibody comprises an E345R/E430G/S440Y mutation, residue numbering according to the EU Index, and has enhanced agonistic activity when compared to the parental antibody without the E345R/E430G/S440Y mutation.
- the anti-TNFR superfamily member antibody of the invention has agonistic activity independent of Fc ⁇ R antibody cross-linking Therefore, the antibodies of the invention having agonistic activity independent of Fc ⁇ R cross-linking are not dependent on the bioavailability and density of cells expressing Fc ⁇ R in the tumor microenvironment for their agonistic activity and can induce TNFR signaling in environments lacking sufficient Fc ⁇ R cell infiltration.
- the anti-TNFR superfamily member antibodies of the invention may demonstrate level of agonism less than that of the native ligand, and therefore may provide an improved safety profile.
- Parental antibody refers to the anti-TNFR superfamily member antibody used to produce the engineered antibody of the invention.
- the antibody comprises the E345R mutation.
- the antibody mediates antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- the antibody mediates antibody-dependent cell phagocytosis (ADCP).
- ADCP antibody-dependent cell phagocytosis
- the antibody mediates CDC.
- the antibody of the invention comprising the E345R mutation may further comprise a second mutation which reduces or abolishes antibody Fc mediated effector functions.
- the antibodies of the present invention comprising the E435R mutation and a second mutation that reduces or abolishes antibody Fc mediated effector functions may therefore be used in instances in which depletion of the TNFR expressing cells is not desirable. Exemplary such instances are therapeutic treatments with anti-CD40 or anti-CD27 antibodies.
- the antibody comprises the E345R mutation and is an IgG1 isotype, optionally further comprising a L234A/L235A mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R mutation and is an IgG1 isotype, optionally further comprising a L234F/L235E/D265A mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R mutation and is an IgG1 isotype, optionally further comprising a K214T/E233P/L234V/L235A/G236-deleted/A327G/P331A/D365E/L358M mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R mutation and an of IgG1 isotype, optionally further comprising a L234A/L235A/G237A/P238S/H268A/A330S/P331S mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R mutation and is an IgG1 isotype and further comprises a L234A/L235A/G237A/P238S/H268A/A330S/P331S mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R mutation and is an IgG2 isotype, optionally further comprising a V234A/G237A/P238S/H268A/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R mutation and is an IgG2 isotype and further comprises a V234A/G237A/P238S/H268A/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R mutation and is an IgG2 isotype, optionally further comprising a V234A/G237A mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R mutation and is an IgG2 isotype, optionally further comprising a H268Q/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R mutation and is an IgG3 isotype.
- the antibody comprises the E345R mutation and is an IgG4 isotype, optionally further comprising a F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A/G237A/P238S mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A/G236-deleted/G237A/P238S mutation when compared to the wild-type IgG4
- the antibody comprises the E345R mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R mutation and is an IgG4 isotype and comprises the S228P/F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R mutation and has agonistic activity independent of antibody cross-linking, wherein agonistic activity is measured by measuring antibody-induced production of secreted embryonic alkaline phosphatase (SEAP) expressed under the control of NF ⁇ B-inducible promoter from Hek-293 cells.
- SEAP secreted embryonic alkaline phosphatase
- the antibody comprises the E345R mutation and binds TNFR superfamily member tumor necrosis factor receptor 1 (SEQ ID NO: 1), tumor necrosis factor receptor 2 (SEQ ID NO: 2), lymphotoxin beta receptor (SEQ ID NO: 3), OX40 (SEQ ID NO: 4), CD40 (SEQ ID NO: 5), Fas receptor (SEQ ID NO: 6), decoy receptor 3 (SEQ ID NO: 7), CD27 (SEQ ID NO: 8), CD30 (SEQ ID NO: 9), CD137 (SEQ ID NO: 10), death receptor 4 (SEQ ID NO: 11), death receptor 5 (SEQ ID NO: 12), decoy receptor 1 (SEQ ID NO: 13), decoy receptor 2 (SEQ ID NO: 14), RANK (SEQ ID NO: 15), osteoprotegerin (SEQ ID NO: 16), TWEAK receptor (SEQ ID NO: 17), TACI (SEQ ID NO: 18), BAFF receptor (SEQ ID NO: 19), herpesvirus entry
- the antibody comprises the E345R mutation and binds TNFR superfamily member OX40 (SEQ ID NO: 4), CD27 (SEQ ID NO: 8), CD40 (SEQ ID NO: 5), CD137 (SEQ ID NO: 10), or GITR (SEQ ID NO: 23).
- the antibody comprises the E345R mutation and binds TNFR superfamily member OX40 (SEQ ID NO: 4).
- the antibody comprises the E345R mutation and binds TNFR superfamily member CD27 (SEQ ID NO: 8).
- the antibody comprises the E345R mutation and binds TNFR superfamily member CD40 (SEQ ID NO: 5).
- the antibody comprises the E345R mutation and binds TNFR superfamily member CD137 (SEQ ID NO: 10).
- the antibody comprises the E345R mutation and binds TNFR superfamily member GITR (SEQ ID NO: 23).
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a solid tumor.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a melanoma.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a lung cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a squamous non-small cell lung cancer (NSCLC).
- NSCLC squamous non-small cell lung cancer
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a non-squamous NSCLC.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a lung adenocarcinoma.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a renal cell carcinoma (RCC) (e.g., a kidney clear cell carcinoma or a kidney papillary cell carcinoma), or a metastatic lesion thereof.
- RCC renal cell carcinoma
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a mesothelioma.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a nasopharyngeal carcinoma (NPC).
- NPC nasopharyngeal carcinoma
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a colorectal cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a prostate cancer or castration-resistant prostate cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a stomach cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating an ovarian cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a gastric cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a liver cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating pancreatic cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a thyroid cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a squamous cell carcinoma of the head and neck.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a carcinomas of the esophagus or gastrointestinal tract.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a breast cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a fallopian tube cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a brain cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating an urethral cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a genitourinary cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating an endometriosis.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a cervical cancer.
- the antibody comprising the E345R mutation is suitable for use in therapy, for example in treating a metastatic lesion of the cancer.
- the antibody comprises the E430G mutation.
- the antibody mediates antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- the antibody mediates antibody-dependent cell phagocytosis (ADCP).
- ADCP antibody-dependent cell phagocytosis
- the antibody mediates CDC.
- the antibody of the invention comprising the E430G mutation may further comprise a second mutation which reduces or abolishes antibody Fc mediated effector functions.
- the antibodies of the present invention comprising the E430G mutation and a second mutation that reduces or abolishes antibody Fc mediated effector functions may therefore be used in instances in which depletion of the TNFR expressing cells is not desirable. Exemplary such instances are therapeutic treatments with anti-CD40 or anti-CD27 antibodies.
- the antibody comprises the E430G mutation and is an IgG1 isotype, optionally further comprising a L234A/L235A mutation when compared to the wild-type IgG1.
- the antibody comprises the E430G mutation and is an IgG1 isotype, optionally further comprising a L234F/L235E/D265A mutation when compared to the wild-type IgG1.
- the antibody comprises the E430G mutation and is an IgG1 isotype, optionally further comprising a K214T/E233P/L234V/L235A/G236-deleted/A327G/P331A/D365E/L358M mutation when compared to the wild-type IgG1.
- the antibody comprises the E430G mutation and is an IgG1 isotype, optionally further comprising a L234A/L235A/G237A/P238S/H268A/A330S/P331S mutation when compared to the wild-type IgG1.
- the antibody comprises the E430G mutation and is an IgG1 isotype and further comprises a L234A/L235A/G237A/P238S/H268A/A330S/P331S mutation when compared to the wild-type IgG1.
- the antibody comprises the E430G mutation and is an IgG2 isotype, optionally further comprising a V234A/G237A/P238S/H268A/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E430G mutation and is an IgG2 isotype and further comprises a V234A/G237A/P238S/H268A/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E430G mutation and is of IgG2 isotype, optionally further comprising a V234A/G237A mutation when compared to the wild-type IgG2.
- the antibody comprises the E430G mutation and is an IgG2 isotype, optionally further comprising a H268Q/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E430G mutation and is an IgG3 isotype.
- the antibody comprises the E430G mutation and is an IgG4 isotype, optionally further comprising a F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E430G mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A/G237A/P238S mutation when compared to the wild-type IgG4.
- the antibody comprises the E430G mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A/G236-deleted/G237A/P238S mutation when compared to the wild-type IgG4
- the antibody comprises the E430G mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E430G mutation and is an IgG4 isotype and comprises the S228P/F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E430G mutation and has agonistic activity independent of antibody cross-linking, wherein agonistic activity is measured by measuring antibody-induced production of secreted embryonic alkaline phosphatase (SEAP) expressed under the control of NF ⁇ B-inducible promoter from Hek-293 cells.
- SEAP secreted embryonic alkaline phosphatase
- the antibody comprises the E430G mutation and binds TNFR superfamily member tumor necrosis factor receptor 1 (SEQ ID NO: 1), tumor necrosis factor receptor 2 (SEQ ID NO: 2), lymphotoxin beta receptor (SEQ ID NO: 3), OX40 (SEQ ID NO: 4), CD40 (SEQ ID NO: 5), Fas receptor (SEQ ID NO: 6), decoy receptor 3 (SEQ ID NO: 7), CD27 (SEQ ID NO: 8), CD30 (SEQ ID NO: 9), CD137 (SEQ ID NO: 10), death receptor 4 (SEQ ID NO: 11), death receptor 5 (SEQ ID NO: 12), decoy receptor 1 (SEQ ID NO: 13), decoy receptor 2 (SEQ ID NO: 14), RANK (SEQ ID NO: 15), osteoprotegerin (SEQ ID NO: 16), TWEAK receptor (SEQ ID NO: 17), TACI (SEQ ID NO: 18), BAFF receptor (SEQ ID NO: 19), herpesvirus entry mediator
- the antibody comprises the E430G mutation and binds TNFR superfamily member OX40 (SEQ ID NO: 4), CD27 (SEQ ID NO: 8), CD40 (SEQ ID NO: 5), CD137 (SEQ ID NO: 10), or GITR (SEQ ID NO: 23).
- the antibody comprises the E430G mutation and binds TNFR superfamily member OX40 (SEQ ID NO: 4).
- the antibody comprises the E430G mutation and binds TNFR superfamily member CD27 (SEQ ID NO: 8).
- the antibody comprises the E430G mutation and binds TNFR superfamily member CD40 (SEQ ID NO: 5).
- the antibody comprises the E430G mutation and binds TNFR superfamily member CD137 (SEQ ID NO: 10).
- the antibody comprises the E430G mutation and binds TNFR superfamily member GITR (SEQ ID NO: 23).
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a solid tumor.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a melanoma.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a lung cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a squamous non-small cell lung cancer (NSCLC).
- NSCLC squamous non-small cell lung cancer
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a non-squamous NSCLC.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a lung adenocarcinoma.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a renal cell carcinoma (RCC) (e.g., a kidney clear cell carcinoma or a kidney papillary cell carcinoma), or a metastatic lesion thereof.
- RCC renal cell carcinoma
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a mesothelioma.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a nasopharyngeal carcinoma (NPC).
- NPC nasopharyngeal carcinoma
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a colorectal cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a prostate cancer or castration-resistant prostate cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a stomach cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating an ovarian cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a gastric cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a liver cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating pancreatic cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a thyroid cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a squamous cell carcinoma of the head and neck.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a carcinomas of the esophagus or gastrointestinal tract.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a breast cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a fallopian tube cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a brain cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating an urethral cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a genitourinary cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating an endometriosis.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a cervical cancer.
- the antibody comprising the E430G mutation is suitable for use in therapy, for example in treating a metastatic lesion of the cancer.
- the antibody comprises the E345R/E430G mutation.
- the antibody mediates antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- the antibody mediates antibody-dependent cell phagocytosis (ADCP).
- ADCP antibody-dependent cell phagocytosis
- the antibody mediates CDC.
- the antibody of the invention comprising the E345R/E430G mutation may further comprise a second mutation which reduces or abolishes antibody Fc mediated effector functions.
- the antibodies of the present invention comprising the E345R/E430G mutation and a second mutation that reduces or abolishes antibody Fc mediated effector functions may therefore be used in instances in which depletion of the TNFR expressing cells is not desirable. Exemplary such instances are therapeutic treatments with anti-CD40 or anti-CD27 antibodies.
- the antibody comprises the E345R/E430G mutation and is an IgG1 isotype, optionally further comprising a L234A/L235A mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R/E430G mutation and is an IgG1 isotype, optionally further comprising a L234F/L235E/D265A mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R/E430G mutation and is an IgG1 isotype, optionally further comprising a K214T/E233P/L234V/L235A/G236-deleted/A327G/P331A/D365E/L358M mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R/E430G mutation and is an IgG1 isotype, optionally further comprising a L234A/L235A/G237A/P238S/H268A/A330S/P331S mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R/E430G mutation and is an IgG1 isotype and further comprises a L234A/L235A/G237A/P238S/H268A/A330S/P331S mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R/E430G mutation and is an IgG2 isotype, optionally further comprising a V234A/G237A/P238S/H268A/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R/E430G mutation and is an IgG2 isotype and further comprises a V234A/G237A/P238S/H268A/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R/E430G mutation and is an IgG2 isotype, optionally further comprising a V234A/G237A mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R/E430G mutation and is an IgG2 isotype, optionally further comprising a H268Q/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R/E430G mutation and is an IgG3 isotype.
- the antibody comprises the E345R/E430G mutation and is an IgG4 isotype, optionally further comprising a F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R/E430G mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A/G237A/P238S mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R/E430G mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A/G236-deleted/G237A/P238S mutation when compared to the wild-type IgG4
- the antibody comprises the E345R/E430G mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R/E430G mutation and is an IgG4 isotype and comprises the S228P/F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R/E430G mutation and has agonistic activity independent of antibody cross-linking, wherein agonistic activity is measured by measuring antibody-induced production of secreted embryonic alkaline phosphatase (SEAP) expressed under the control of NF ⁇ B-inducible promoter from Hek-293 cells.
- SEAP secreted embryonic alkaline phosphatase
- the antibody comprises the E345R/E430G mutation and binds TNFR superfamily member tumor necrosis factor receptor 1 (SEQ ID NO: 1), Tumor necrosis factor receptor 2 (SEQ ID NO: 2), lymphotoxin beta receptor (SEQ ID NO: 3), OX40 (SEQ ID NO: 4), CD40 (SEQ ID NO: 5), Fas receptor (SEQ ID NO: 6), decoy receptor 3 (SEQ ID NO: 7), CD27 (SEQ ID NO: 8), CD30 (SEQ ID NO: 9), CD137 (SEQ ID NO: 10), death receptor 4 (SEQ ID NO: 11), death receptor 5 (SEQ ID NO: 12), decoy receptor 1 (SEQ ID NO: 13), decoy receptor 2 (SEQ ID NO: 14), RANK (SEQ ID NO: 15), osteoprotegerin (SEQ ID NO: 16), TWEAK receptor (SEQ ID NO: 17), TACI (SEQ ID NO: 18), BAFF receptor (SEQ ID NO: 19),
- the antibody comprises the E345R/E430G mutation and binds TNFR superfamily member OX40 (SEQ ID NO: 4), CD27 (SEQ ID NO: 8), CD40 (SEQ ID NO: 5), CD137 (SEQ ID NO: 10), or GITR (SEQ ID NO: 23).
- the antibody comprises the E345R/E430G mutation and binds TNFR superfamily member OX40 (SEQ ID NO: 4).
- the antibody comprises the E345R/E430G mutation and binds TNFR superfamily member CD27 (SEQ ID NO: 8).
- the antibody comprises the E345R/E430G mutation and binds TNFR superfamily member CD40 (SEQ ID NO: 5).
- the antibody comprises the E345R/E430G mutation and binds TNFR superfamily member CD137 (SEQ ID NO: 10).
- the antibody comprises the E345R/E430G mutation and binds TNFR superfamily member GITR (SEQ ID NO: 23).
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a solid tumor.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a melanoma.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a lung cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a squamous non-small cell lung cancer (NSCLC).
- NSCLC squamous non-small cell lung cancer
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a non-squamous NSCLC.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a lung adenocarcinoma.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a renal cell carcinoma (RCC) (e.g., a kidney clear cell carcinoma or a kidney papillary cell carcinoma), or a metastatic lesion thereof.
- RCC renal cell carcinoma
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a mesothelioma.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a nasopharyngeal carcinoma (NPC).
- NPC nasopharyngeal carcinoma
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a colorectal cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a prostate cancer or castration-resistant prostate cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a stomach cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating an ovarian cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a gastric cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a liver cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating pancreatic cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a thyroid cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a squamous cell carcinoma of the head and neck.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a carcinomas of the esophagus or gastrointestinal tract.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a breast cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a fallopian tube cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a brain cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating an urethral cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a genitourinary cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating an endometriosis.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a cervical cancer.
- the antibody comprising the E345R/E430G mutation is suitable for use in therapy, for example in treating a metastatic lesion of the cancer.
- the antibody comprises the E345R/E430G/S440Y mutation.
- the antibody mediates antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- the antibody mediates antibody-dependent cell phagocytosis (ADCP).
- ADCP antibody-dependent cell phagocytosis
- the antibody mediates CDC.
- the antibody of the invention comprising the E345R/E430G/S440Y mutation may further comprise a second mutation which reduces or abolishes antibody Fc mediated effector functions.
- the antibodies of the present invention comprising the E345R/E430G/S440Y mutation and a second mutation that reduces or abolishes antibody Fc mediated effector functions may therefore be used in instances in which depletion of the TNFR expressing cells is not desirable. Exemplary such instances are therapeutic treatments with anti-CD40 or anti-CD27 antibodies.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG1 isotype, optionally further comprising a L234A/L235A mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG1 isotype, optionally further comprising a L234F/L235E/D265A mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG1 isotype, optionally further comprising a K214T/E233P/L234V/L235A/G236-deleted/A327G/P331A/D365E/L358M mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG1 isotype, optionally further comprising a L234A/L235A/G237A/P238S/H268A/A330S/P331S mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG1 isotype and further comprises a L234A/L235A/G237A/P238S/H268A/A330S/P331S mutation when compared to the wild-type IgG1.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG2 isotype, optionally further comprising a V234A/G237A/P238S/H268A/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG2 isotype and further comprises a V234A/G237A/P238S/H268A/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG2 isotype, optionally further comprising a V234A/G237A mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG2 isotype, optionally further comprising a H268Q/V309L/A330S/P331S mutation when compared to the wild-type IgG2.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG3 isotype.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG4 isotype, optionally further comprising a F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A/G237A/P238S mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A/G236-deleted/G237A/P238S mutation when compared to the wild-type IgG4
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG4 isotype, optionally further comprising a S228P/F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R/E430G/S440Y mutation and is an IgG4 isotype and comprises the S228P/F234A/L235A mutation when compared to the wild-type IgG4.
- the antibody comprises the E345R/E430G/S440Y mutation and has agonistic activity independent of antibody cross-linking, wherein agonistic activity is measured by measuring antibody-induced production of secreted embryonic alkaline phosphatase (SEAP) expressed under the control of NF ⁇ B-inducible promoter from Hek-293 cells.
- SEAP secreted embryonic alkaline phosphatase
- the antibody comprises the E345R/E430G/S440Y mutation and binds TNFR superfamily member tumor necrosis factor receptor 1 (SEQ ID NO: 1), Tumor necrosis factor receptor 2 (SEQ ID NO: 2), lymphotoxin beta receptor (SEQ ID NO: 3), OX40 (SEQ ID NO: 4), CD40 (SEQ ID NO: 5), Fas receptor (SEQ ID NO: 6), decoy receptor 3 (SEQ ID NO: 7), CD27 (SEQ ID NO: 8), CD30 (SEQ ID NO: 9), CD137 (SEQ ID NO: 10), death receptor 4 (SEQ ID NO: 11), death receptor 5 (SEQ ID NO: 12), decoy receptor 1 (SEQ ID NO: 13), decoy receptor 2 (SEQ ID NO: 14), RANK (SEQ ID NO: 15), osteoprotegerin (SEQ ID NO: 16), TWEAK receptor (SEQ ID NO: 17), TACI (SEQ ID NO: 18), BAFF receptor (SEQ ID NO: 1 (
- the antibody comprises the E345R/E430G/S440Y mutation and binds TNFR superfamily member OX40 (SEQ ID NO: 4), CD27 (SEQ ID NO: 8), CD40 (SEQ ID NO: 5), CD137 (SEQ ID NO: 10), or GITR (SEQ ID NO: 23).
- the antibody comprises the E345R/E430G/S440Y mutation and binds TNFR superfamily member OX40 (SEQ ID NO: 4).
- the antibody comprises the E345R/E430G/S440Y mutation and binds TNFR superfamily member CD27 (SEQ ID NO: 8).
- the antibody comprises the E345R/E430G/S440Y mutation and binds TNFR superfamily member CD40 (SEQ ID NO: 5).
- the antibody comprises the E345R/E430G/S440Y mutation and binds TNFR superfamily member CD137 (SEQ ID NO: 10).
- the antibody comprises the E345R/E430G/S440Y mutation and binds TNFR superfamily member GITR (SEQ ID NO: 23).
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a solid tumor.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a melanoma.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a lung cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a squamous non-small cell lung cancer (NSCLC).
- NSCLC non-small cell lung cancer
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a non-squamous NSCLC.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a lung adenocarcinoma.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a renal cell carcinoma (RCC) (e.g., a kidney clear cell carcinoma or a kidney papillary cell carcinoma), or a metastatic lesion thereof.
- RCC renal cell carcinoma
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a mesothelioma.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a nasopharyngeal carcinoma (NPC).
- NPC nasopharyngeal carcinoma
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a colorectal cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a prostate cancer or castration-resistant prostate cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a stomach cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating an ovarian cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a gastric cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a liver cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating pancreatic cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a thyroid cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a squamous cell carcinoma of the head and neck.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a carcinomas of the esophagus or gastrointestinal tract.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a breast cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a fallopian tube cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a brain cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating an urethral cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a genitourinary cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating an endometriosis.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a cervical cancer.
- the antibody comprising the E345R/E430G/S440Y mutation is suitable for use in therapy, for example in treating a metastatic lesion of the cancer.
- Antibody-dependent cellular cytotoxicity is a mechanism for inducing cell death that depends upon the interaction of antibody-coated target cells with effector cells possessing lytic activity, such as natural killer cells, monocytes, macrophages and neutrophils via Fc gamma receptors (Fc ⁇ R) expressed on effector cells.
- effector cells possessing lytic activity such as natural killer cells, monocytes, macrophages and neutrophils via Fc gamma receptors (Fc ⁇ R) expressed on effector cells.
- Fc ⁇ R Fc gamma receptors
- NK cells express Fc ⁇ RIIIA
- monocytes express Fc ⁇ RI, Fc ⁇ RII and Fc ⁇ RIIIA.
- Death of the antibody-coated target cell such as TNFR expressing cells, occurs because of effector cell activity through the secretion of membrane pore-forming proteins and proteases.
- the antibodies may be added to TNFR expressing cells in combination with immune effector cells, which may be activated by the antigen antibody complexes resulting in cytolysis of the target cell. Cytolysis may be detected by the release of label (e.g. radioactive substrates, fluorescent dyes or natural intracellular proteins) from the lysed cells.
- label e.g. radioactive substrates, fluorescent dyes or natural intracellular proteins
- exemplary effector cells for such assays include peripheral blood mononuclear cells (PBMC) and NK cells.
- PBMC peripheral blood mononuclear cells
- target cells include cells expressing the TNFR either endogenously or recombinantly, such as Tregs.
- target cells are used with a ratio of 1 target cell to 50 effector cells.
- Target cells are pre-labeled with BATDA (PerkinElmer) for 20 minutes at 37° C., washed twice and resuspended in DMEM, 10% heat-inactivated FBS, 2 mM L-glutamine (all from Invitrogen).
- Target (1 ⁇ 10 4 cells) and effector cells 0.5 ⁇ 10 6 cells
- 100 ⁇ l of cells are added to the wells of 96-well U-bottom plates.
- An additional 100 ⁇ l is added with or without the test antibodies.
- the plates are centrifuged at 200 g for 3 minutes, incubated at 37° C. for 2 hours, and then centrifuged again at 200 g for 3 minutes.
- ADCC activity may be assessed by evaluating activation of Fc ⁇ RIIIA in a reporter gene assay in which activation of the receptor leads to expression of a luciferase reporter as described herein.
- ADCP antibody-dependent cellular phagocytosis
- monocyte-derived macrophages as effector cells and Daudi cells (ATCC® CCL-213TM) or B cell leukemia or lymphoma or tumor cells expressing TNFR as target cells engineered to express GFP or another labeled molecule. Effector:target cell ratio may be for example 4:1. Effector cells may be incubated with target cells for 4 hours with or without the antibody of the invention. After incubation, cells may be detached using accutase. Macrophages may be identified with anti-CD11b and anti-CD14 antibodies coupled to a fluorescent label, and percent phagocytosis may be determined based on % GFP fluorescence in the CD11 + CD14 + macrophages using standard methods.
- effector functions for example ADCC, ADCP and/or CDC of the antibodies of the invention may further be enhanced by introducing additional mutations into the antibody Fc which enhances binding of the antibody to an activating Fc ⁇ receptor (Fc ⁇ R) or complement.
- Fc ⁇ R activating Fc ⁇ receptor
- Fc positions that may be mutated to increase binding of the antibodies of the invention to the activating Fc ⁇ and/or to enhance antibody effector functions are those described for example in U.S. Pat. No. 6,737,056, U.S. Patent Publ. No. 2015/0259434, Shields et al. (2001) J Biol Chem 276: 6591-604, Lazar et al. (2006) Proc Natl Acad Sci U SA 103: 4005-10, Stavenhagen et al. (2007) Cancer Res 67: 8882-90, Richards et al. (2008) Mol Cancer Ther 7: 2517-27 and Diebolder et al.
- Exemplary combination mutations that result in antibodies with increased ADCC or ADCP are S239D/I332E, S298A/E333A/K334A, F243L/R292P/Y300L, F243L/R292P/Y300L/P396L, F243L/R292P/Y300L/V305I/P396L and G236A/S239D/I332E mutations on IgG1.
- Fc positions that may be mutated to enhance CDC of the antibodies of the invention are those described for example in Int. Patent Appl. WO2014/108198, Idusogie et al. (2001) J Immunol 166: 2571-5 and Moore et al. (2010) MAbs 2: 181-9, and include positions 267, 268, 324, 326, 333, 345 and 430.
- Exemplary mutations that may be made singularly or in combination are S267E, H268F, S324T, K326A, K326W, E333A, E430S, E430F and E430T mutations.
- Exemplary combination mutations that result in antibodies with increased CDC are K326A/E333A, K326W/E333A, H268F/S324T, S267E/H268F, S267E/S324T and S267E/H268F/S324T mutations on IgG1.
- “Complement-dependent cytotoxicity”, or “CDC”, refers to a mechanism for inducing cell death in which the Fc effector domain of a target-bound antibody binds and activates complement component C1q which in turn activates the complement cascade leading to target cell death. Activation of complement may also result in deposition of complement components on the target cell surface that facilitate ADCC by binding complement receptors (e.g., CR3) on leukocytes.
- complement receptors e.g., CR3
- CDC of TNFR expressing cells may be measured for example by plating Daudi cells at 1 ⁇ 10 5 cells/well (50 ⁇ l/well) in RPMI-B (RPMI supplemented with 1% BSA), adding 50 ⁇ l of test antibodies to the wells at final concentration between 0-100 ⁇ g/ml, incubating the reaction for 15 min at room temperature, adding 11 ⁇ l of pooled human serum to the wells, and incubation the reaction for 45 min at 37° C. Percentage (%) lysed cells may be detected as % propidium iodide stained cells in FACS assay using standard methods.
- the ability of the antibodies of the invention to induce ADCC may also be enhanced by engineering their oligosaccharide component.
- Human IgG1 or IgG3 are N-glycosylated at Asn297 with most of the glycans in the well-known biantennary G0, G0F, G1, G1F, G2 or G2F forms.
- Antibodies produced by non-engineered CHO cells typically have a glycan fucose content of about at least 85%. The removal of the core fucose from the biantennary complex-type oligosaccharides attached to the Fc regions enhances the ADCC of antibodies via improved Fc ⁇ RIIIa binding without altering antigen binding or CDC activity.
- Such mAbs may be achieved using different methods reported to lead to the successful expression of relatively high defucosylated antibodies bearing the biantennary complex-type of Fc oligosaccharides such as control of culture osmolality (Konno et al. (2012) Cytotechnology 64: 249-65), application of a variant CHO line Lec13 as the host cell line (Shields et al. 2002) J Biol Chem 277: 26733-40), application of a variant CHO line EB66 as the host cell line (Olivier et al. (2010) MAbs 2: 405-15, application of a rat hybridoma cell line YB2/0 as the host cell line (Shinkawa et al.
- the anti-TNFR superfamily member antibody of the invention comprises a second mutation that enhances ADCC, ADCP and/or CDC of the antibody.
- the anti-TNFR superfamily member antibody of the invention comprises a second mutation that enhances ADCC, ADCP and/or CDC of the antibody selected from the group consisting of a G236A mutation, a S239D mutation, a F243L mutation, a T256A mutation, a K290A mutation, a R292P mutation, a S298A mutation, a Y300L mutation, a V305L mutation, a K326A mutation, a A330K mutation, a I332E mutation, an E333A mutation, a K334A mutation, an A339T mutation, a P396L mutation, a S267E mutation, a H268F mutation, a S324T mutation, a K326A mutation, a K326W mutation, an E333A mutation, an E430S mutation, an E430F mutation and an E430T mutation.
- a second mutation that enhances ADCC, ADCP and/or CDC of the antibody selected from the group consisting of
- the anti-TNFR superfamily member antibody of the invention comprises a second mutation that enhances ADCC, ADCP and/or CDC of the antibody selected from the group consisting of a S239D/I332E mutation, a S298A/E333A/K334A mutation, a F243L/R292P/Y300L mutation, a F243L/R292P/Y300L/P396L mutation, a F243L/R292P/Y300L/V305I/P396L mutation, a G236A/S239D/I332E mutation, a K326A/E333A mutation, a K326W/E333A mutation, a H268F/S324T mutation, a S267E/H268F mutation, a S267E/S324T mutation and a S267E/H268F/S324T mutation.
- a S239D/I332E mutation a S298A/E333
- the ability of antibodies of the invention to induce ADCC may be enhanced by engineering their oligosaccharide component.
- Human IgG1 or IgG3 are N-glycosylated at Asn297 with most glycans in the well-known biantennary G0, G0F, G1, G1F, G2 or G2F forms.
- Antibodies produced by non-engineered CHO cells typically have a glycan fucose content of about at least 85%. The removal of the core fucose from the biantennary complex-type oligosaccharides attached to the Fc regions enhances the ADCC of antibodies via improved Fc ⁇ RIIIa binding without altering antigen binding or CDC activity.
- the anti-TNFR superfamily member antibody of the invention has a biantennary glycan structure with fucose content of about between 0% to about 15%, for example 15%, 14%, 13%, 12%, 11% 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1% or 0%.
- the anti-TNFR superfamily member antibody of the invention has a biantennary glycan structure with fucose content of about 50%, 40%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 14%, 13%, 12%, 11% 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1% or 0%.
- “Fucose content” means the amount of the fucose monosaccharide within the sugar chain at Asn297.
- the relative amount of fucose is the percentage of fucose-containing structures related to all glycostructures. These may be characterized and quantified by multiple methods, for example: 1) using MALDI-TOF of N-glycosidase F treated sample (e.g. complex, hybrid and oligo- and high-mannose structures) as described in Intl. Patent Publ. No.
- WO2008/077546 2) by enzymatic release of the Asn297 glycans with subsequent derivatization and detection/quantitation by HPLC (UPLC) with fluorescence detection and/or HPLC-MS (UPLC-MS); 3) intact protein analysis of the native or reduced mAb, with or without treatment of the Asn297 glycans with Endo S or other enzyme that cleaves between the first and the second GlcNAc monosaccharides, leaving the fucose attached to the first GlcNAc; 4) digestion of the mAb to constituent peptides by enzymatic digestion (e.g., trypsin or endopeptidase Lys-C), and subsequent separation, detection and quantitation by HPLC-MS (UPLC-MS) or 5) separation of the mAb oligosaccharides from the mAb protein by specific enzymatic deglycosylation with PNGase F at Asn 297.
- UPLC UPLC
- the oligosaccharides released may be labeled with a fluorophore, separated and identified by various complementary techniques which allow fine characterization of the glycan structures by matrix-assisted laser desorption ionization (MALDI) mass spectrometry by comparison of the experimental masses with the theoretical masses, determination of the degree of sialylation by ion exchange HPLC (GlycoSep C), separation and quantification of the oligosaccharide forms according to hydrophilicity criteria by normal-phase HPLC (GlycoSep N), and separation and quantification of the oligosaccharides by high performance capillary electrophoresis-laser induced fluorescence (HPCE-LIF).
- MALDI matrix-assisted laser desorption ionization
- Low fucose or “low fucose content” refers to antibodies with fucose content of about 0%-15%.
- Normal fucose or ‘normal fucose content” refers to antibodies with fucose content of about over 50%, typically about over 60%, 70%, 80% or over 85%.
- the antibodies of the invention may further be engineered to introduce at least one mutation in the antibody Fc that reduces binding of the antibody to an activating Fc ⁇ receptor (Fc ⁇ R) and/or reduces Fc effector functions such as C1q binding, complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC) or phagocytosis (ADCP).
- Fc ⁇ R activating Fc ⁇ receptor
- Fc effector functions such as C1q binding, complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC) or phagocytosis (ADCP).
- Fc positions that may be mutated to reduce binding of the antibody to the activating Fc ⁇ R and subsequently to reduce effector functions are those described for example in Shields et al. (2001) J Biol Chem 276: 6591-604, Intl. Patent Publ. No. WO2011/066501, U.S. Pat. Nos. 6,737,056 and 5,624,821, Xu et al. (2000) Cell Immunol 200: 16-26, Alegre et al. (1994) Transplantation 57: 1537-43, Bolt et al. (1993) Eur J Immunol 23: 403-11, Cole et al. (1999) Transplantation 68: 563-71, Rother et al.
- MAbs 1 include positions 214, 233, 234, 235, 236, 237, 238, 265, 267, 268, 270, 295, 297, 309, 327, 328, 329, 330, 331 and 365.
- Exemplary mutations that may be made singularly or in combination are K214T, E233P, L234V, L234A, deletion of G236, V234A, F234A, L235A, G237A, P238A, P238S, D265A, S267E, H268A, H268Q, Q268A, N297A, A327Q, P329A, D270A, Q295A, V309L, A327S, L328F, A330S and P331S mutations on IgG1, IgG2, IgG3 or IgG4.
- Exemplary combination mutations that may be made to reduced ADCC are L234A/L235A on IgG1, V234A,/G237A/P238S/H268A/V309L/A330S/P331S on IgG2, F234A/L235A on IgG4, S228P/F234A/L235A on IgG4, N297A on IgG1, IgG2, IgG3 or IgG4, V234A/G237A on IgG2, K214T/E233P/L234V/L235A/G236-deleted/A327G/P331A/D365E/L358M on IgG1, H268Q/V309L/A330S/P331S on IgG2, S267E/L328F on IgG1, L234F/L235E/D265A on IgG1, L234A/L235A/G237A/P238S/
- a S228P mutation may be made into IgG4 antibodies to enhance IgG4 stability.
- the antibodies of the invention comprise a second mutation selected from the group consisting of a K214T mutation, a E233P mutation, a L234V mutation, a L234A mutation, deletion of a G236, a V234A mutation, a F234A mutation, a L235A mutation, a G237A mutation, a P238A mutation, a P238S mutation, a D265A mutation, a S267E mutation, a H268A mutation, a H268Q mutation, a Q268A mutation, a N297A mutation, a A327Q mutation, a P329A mutation, a D270A mutation, a Q295A mutation, a V309L mutation, a A327S mutation, a L328F mutation, a A330S mutation and a P331S mutation, wherein residue numbering is according to the EU Index.
- the antibodies of the invention may be further engineered to modulate antibody half-life by introducing additional Fc mutations, such as those described for example in Dall'Acqua et al. (2006) J Biol Chem 281: 23514-24, Zalevsky et al. (2010) Nat Biotechnol 28: 157-9, Hinton et al. (2004) J Biol Chem 279: 6213-6, Hinton et al. (2006) J Immunol 176: 346-56, Shields et al. (2001) J Biol Chem 276: 6591-604, Petkova et al. (2006) Int Immunol 18: 1759-69, Datta-Mannan et al.
- Exemplary mutations that may be made singularly or in combination are T250Q, M252Y, I253A, S254T, T256E, P257I, T307A, D376V, E380A, M428L, H433K, N434S, N434A, N434H, N434F, H435A and H435R mutations.
- Exemplary singular or combination mutations that may be made to increase the half-life of the antibody are M428L/N434S, M252Y/S254T/T256E, T250Q/M428L, N434A and T307A/E380A/N434A mutations.
- Exemplary singular or combination mutations that may be made to reduce the half-life of the antibody are H435A, P257I/N434H, D376V/N434H, M252Y/S254T/T256E/H433K/N434F, T308P/N434A and H435R mutations.
- Constant modifications refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequences.
- Conservative modifications include amino acid substitutions, additions and deletions.
- Conservative substitutions are those in which the amino acid is replaced with an amino acid residue having a similar side chain.
- amino acids with acidic side chains e.g., aspartic acid, glutamic acid
- basic side chains e.g., lysine, arginine, histidine
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
- uncharged polar side chains e.g., glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine, tryptophan
- aromatic side chains e.g., phenylalanine, tryptophan, histidine, tyrosine
- aliphatic side chains e.g., glycine, alanine, valine, leucine, isoleucine, serine, threonine
- amide e.g., asparagine, glutamine
- any native residue in the polypeptide may also be substituted with alanine, as has been previously described for alanine scanning mutagenesis (MacLennan et al. (1998) Acta Physiol Scand Suppl 643: 55-67; Sasaki et al. (1998) Adv Biophys 35: 1-24)
- Amino acid substitutions to the antibodies of the invention may be made by known methods for example by PCR mutagenesis (U.S. Pat. No. 4,683,195).
- libraries of variants may be generated for example using random (NNK) or non-random codons, for example DVK codons, which encode 11 amino acids (Ala, Cys, Asp, Glu, Gly, Lys, Asn, Arg, Ser, Tyr, Trp).
- NNK random
- DVK codons which encode 11 amino acids (Ala, Cys, Asp, Glu, Gly, Lys, Asn, Arg, Ser, Tyr, Trp).
- the resulting antibody variants may be tested for their characteristics using assays described herein.
- the antibodies of the invention may be post-translationally modified by processes such as glycosylation, isomerization, deglycosylation or non-naturally occurring covalent modification such as the addition of polyethylene glycol moieties (pegylation) and lipidation. Such modifications may occur in vivo or in vitro.
- the antibodies of the invention may be conjugated to polyethylene glycol (PEGylated) to improve their pharmacokinetic profiles. Conjugation may be carried out by techniques known to those skilled in the art. Conjugation of therapeutic antibodies with PEG has been shown to enhance pharmacodynamics while not interfering with function (Leong et al. (2001) Cytokine 16: 106-19; Yang et al. (2003) Protein Eng 16: 761-70; Knight et al. (2004) Platelets 15: 409-18).
- Antibodies of the invention may be modified to improve stability, selectivity, cross-reactivity, affinity, immunogenicity or other desirable biological or biophysical property are within the scope of the invention. Stability of an antibody is influenced by a number of factors, including (1) core packing of individual domains that affects their intrinsic stability, (2) protein/protein interface interactions that have impact upon the HC and LC pairing, (3) burial of polar and charged residues, (4) H-bonding network for polar and charged residues; and (5) surface charge and polar residue distribution among other intra- and inter-molecular forces (Worn et al. (2001) J Mol Biol 305: 989-1010).
- Potential structure destabilizing residues may be identified based upon the crystal structure of the antibody or by molecular modeling in certain cases, and the effect of the residues on antibody stability may be tested by generating and evaluating variants harboring mutations in the identified residues.
- One of the ways to increase antibody stability is to raise the thermal transition midpoint (T m ) as measured by differential scanning calorimetry (DSC).
- T m thermal transition midpoint
- DSC differential scanning calorimetry
- the protein T m is correlated with its stability and inversely correlated with its susceptibility to unfolding and denaturation in solution and the degradation processes that depend on the tendency of the protein to unfold (Remmele et al. (2000) Biopharm. 13: 36-46).
- CTL C-terminal lysine
- CTL removal may be controlled to less than the maximum level by control of concentration of extracellular Zn 2+ , EDTA or EDTA-Fe 3+ as described in U.S. Patent Publ. No. US20140273092.
- CTL content in antibodies can be measured using known methods.
- the antibodies of the invention have a C-terminal lysine content of about 10% to about 90%, about 20% to about 80%, about 40% to about 70%, about 55% to about 70%, or about 60%.
- the antibodies of the invention have a C-terminal lysine content of about 0%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%.
- the antibodies of the invention with engineered Fc domains may be generated using standard cloning and expression technologies using wild type IgG1, IgG2, IgG3 or IgG4 sequences as templates. For example, site-directed mutagenesis or PCR-mediated mutagenesis may be performed to introduce the mutation(s) in the antibody Fc and the effect on antibody binding to Fc ⁇ R, agonistic activity or other property of interest, may be evaluated using the methods described herein.
- VH and the VL domains of the anti-TNFR superfamily member antibodies may be generated de novo.
- hybridoma method of Kohler and Milstein, Nature 256:495, 1975 may be used to generate monoclonal antibodies.
- a mouse or other host animal such as a hamster, rat or monkey, is immunized with human TNFR or an extracellular domain of a TNFR followed by fusion of spleen cells from immunized animals with myeloma cells using standard methods to form hybridoma cells (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103, Academic Press, 1986).
- Colonies arising from single immortalized hybridoma cells are screened for production of antibodies with desired properties, such as specificity of binding, cross-reactivity or lack thereof, and affinity for the antigen.
- Various host animals may be used to produce the anti-TNFR superfamily member antibodies of the invention.
- Balb/c mice may be used to generate mouse anti-human TNFR superfamily member antibodies.
- the antibodies made in Balb/c mice and other non-human animals may be humanized using various technologies to generate more human-like sequences.
- Exemplary humanization techniques including selection of human acceptor frameworks are known and include CDR grafting (U.S. Pat. No. 5,225,539), SDR grafting (U.S. Pat. No. 6,818,749), Resurfacing ((Padlan (1991) Mol Immunol 28: 489-98), Specificity Determining Residues Resurfacing (U.S. Patent Publ. No. 2010/0261620), human framework adaptation (U.S. Pat. No. 8,748,356) or superhumanization (U.S. Pat. No. 7,709,226).
- CDRs of parental antibodies are transferred onto human frameworks that may be selected based on their overall homology to the parental frameworks, based on similarity in CDR length, or canonical structure identity, or a combination thereof.
- Humanized antibodies may be further optimized to improve their selectivity or affinity to a desired antigen by incorporating altered framework support residues to preserve binding affinity (backmutations) by techniques such as those described in Int. Patent Publ. Nos. WO1090/007861 and WO1992/22653, or by introducing variation at any of the CDRs for example to improve affinity of the antibody.
- Transgenic animals such as mice or rat carrying human immunoglobulin (Ig) loci in their genome may be used to generate human antibodies against a target protein, and are described in for example U.S. Pat. No. 6,150,584, Int. Patent Publ. No. WO99/45962, Int. Patent Publ. Nos. WO2002/066630, WO2002/43478, WO2002/043478 and WO1990/04036, Lonberg et al. (1994) Nature 368: 856-9; Green et al. (1994) Nat Genet 7: 13-21; Green et al. (1998) J Exp Med 188: 483-95; Lonberg et al.
- the endogenous immunoglobulin loci in such animal may be disrupted or deleted, and at least one complete or partial human immunoglobulin locus may be inserted into the genome of the animal using homologous or non-homologous recombination, using transchromosomes, or using minigenes. Companies such as Regeneron (http://_www_regeneron_com), Harbour Antibodies (http://_www_harbourantibodies_com), Open Monoclonal Technology, Inc.
- OMT (http://_www_omtinc_net), KyMab (http://_www_kymab_com), Trianni (http://_www.trianni_com) and Ablexis (http://_www_ablexis_com) may be engaged to provide human antibodies directed against a selected antigen using technologies as described above.
- Human antibodies may be selected from a phage display library, where the phage is engineered to express human immunoglobulins or portions thereof such as Fabs, single chain antibodies (scFv), or unpaired or paired antibody variable regions (Knappik et al. (2000) J Mol Biol 296: 57-86; Krebs et al. (2001) J Immunol Methods 254: 67-84; Vaughan et al. (1996) Nat Biotechnol 14: 309-14; Sheets et al. (1998) Proc Natl Acad Sci USA 95: 6157-62; Clackson et al. (1991) Nature 352: 624-8; Marks et al.
- the antibodies of the invention may be isolated for example from phage display library expressing antibody heavy and light chain variable regions as fusion proteins with bacteriophage pIX coat protein as described in (Shi et al. (2010) J Mol Biol 397: 385-96, and Int. Patent Publ. No. WO09/085462).
- the libraries may be screened for phage binding to human and/or cyno TNFR and the obtained positive clones may be further characterized, the Fabs isolated from the clone lysates, and expressed as full-length IgGs.
- Such phage display methods for isolating human antibodies are described in for example U.S. Pat. Nos.
- immunogenic antigens and monoclonal antibody production may be performed using any suitable technique, such as recombinant protein production.
- the immunogenic antigens may be administered to an animal in the form of purified protein, or protein mixtures including whole cells or cell or tissue extracts, or the antigen may be formed de novo in the animal's body from nucleic acids encoding said antigen or a portion thereof.
- VH/VL regions of the anti-TNFR superfamily member antibodies of the invention may also be obtained from existing anti-TNFR superfamily receptor antibodies.
- VH and the VL regions of anti-OX40 antibodies described in U.S. Pat. No. 8,133,983, U.S. Pat. No. 7,960,515, U.S. Patent Publ. No. US2013/0280275, Intl. Patent Publ. No. WO2013/028231 and U.S. Patent Publ. No. US2014/0377284 may be used to engineer antibodies of the invention.
- the VH/VL regions of anti-OX40 antibodies MEDI-6469, BMS-986178, MOXR-0916, MEDI-6383, MEDI-0562, PF-04518600 or GSK-3174998 may be used.
- Additional exemplary VH and VL regions that may be used to generate engineered anti-OX40 antibodies of the invention are:
- SEQ ID NO: 51 (VH of antibody SF2 described in US2014/0377284) QVQLVQSGAEVKKPGSSVKVSCKASGYTFKDYTMHWVRQAPGQGLEWIGG IYPNNGGSTYNQNFKDRVTLTADKSTSTAYMELSSLRSEDTAVYYCARMG YHGPHLDFDVWGQGTTVTVSS SEQ ID NO: 52 (VL of antibody SF2 described in US2014/0377284) DIQMTQSPSSLSASVGDRVTITCKASQDVGAAVAWYQQKPGKAPKLLIYW ASTRHTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYINYPLTFGG GTKVEIK SEQ ID NO: 53 (VH of 12H3VH1VL1 described in US2014/0377284) QVQLVQSGAEVKKPGSSVKVSCKASGYTFKDYTMHWVRQAPGQGLEWMGG IYPNNGGSTYNQNF
- VH and the VL regions of anti-CD40 antibodies that may be used to engineer antibodies of the invention are those of CP-870,893 and humanized S2C6 described in U.S. Pat. No. 7,288,251 (antibody 21.4.1) and U.S. Pat. No. 8,303,955, respectively, and anti-CD40 antibodies described in Int. Patent Publ. Nos. WO2001/056603, WO2001/083755, WO2013/034904 and WO2014/070934.
- Additional exemplary VH and VL regions that may be used to generate engineered anti-CD40 antibodies of the invention are:
- SEQ ID NO: 57 (VH of M9 antibody) QLQLQESGPGLVKPSEILSLTCTVSGGSISSSSYYWGWIRQPPGKGLEWI GNIYYRGDTYYSPSLKSRVTISVDTSKNQFSLKLNSVTAADTAVYYCAKG FRFDYWGQGTLVTVSS
- SEQ ID NO: 58 (VL of M9 antibody) QSALTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMI YEVSKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNNLV FGGGTKLTVL
- VH and the VL regions of anti-GITR antibodies that may be used to engineer antibodies of the invention are those of described in U.S. Pat. Nos. 7,812,135, 8,591,886 and 7,618,632, or in Int. Patent Publ. Nos. WO2011/028683, WO2013/039954, WO2005/007190 and WO2007/133822.
- VH and the VL regions of anti-CD27 antibodies that may be used to engineer antibodies of the invention are those of described in U.S. Pat. No. 9,169,325 and U.S. Pat. Publ. No. US20130183316.
- VH and the VL regions of anti-CD137 antibodies that may be used to engineer antibodies of the invention are those of described in U.S. Pat. Nos. 7,288,638, 8,716,452 and 8,821,867.
- Antibodies of the invention engineered into full-length bispecific antibodies are within the scope of the invention.
- Full-length antibody refers to an antibody having two full-length antibody heavy chains and two full-length antibody light chains.
- a full-length antibody heavy chain (HC) consists of well-known heavy chain variable and constant domains VH, CH1, hinge, CH2, and CH3.
- a full-length antibody light chain (LC) consists of well-known light chain variable and constant domains VL and CL.
- the full-length antibody may be lacking the C-terminal lysine (K) in either one or both heavy chains.
- Full-length bispecific antibodies may be generated for example using Fab arm exchange (or half molecule exchange) between two monospecific bivalent antibodies by introducing substitutions at the heavy chain CH3 interface in each half molecule to favor heterodimer formation of two antibody half molecules having distinct specificity either in vitro in cell-free environment or using co-expression.
- Fab-arm or “half molecule” refers to one heavy chain-light chain pair that specifically binds an antigen.
- the Fab arm exchange reaction is the result of a disulfide-bond isomerization reaction and dissociation-association of CH3 domains.
- the heavy chain disulfide bonds in the hinge regions of the parental monospecific antibodies are reduced.
- the resulting free cysteines of one of the parental monospecific antibodies form an inter heavy-chain disulfide bond with cysteine residues of a second parental monospecific antibody molecule and simultaneously CH3 domains of the parental antibodies release and reform by dissociation-association.
- the CH3 domains of the Fab arms may be engineered to favor heterodimerization over homodimerization.
- the resulting product is a bispecific antibody having two Fab arms or half molecules which each bind a distinct epitope, i.e. an epitope on TNFR and an epitope on a second antigen.
- “Homodimerization” refers to an interaction of two heavy chains having identical CH3 amino acid sequences. “Homodimer” refers to an antibody having two heavy chains with identical CH3 amino acid sequences.
- Heterodimerization refers to an interaction of two heavy chains having non-identical CH3 amino acid sequences. “Heterodimer” refers to an antibody having two heavy chains with non-identical CH3 amino acid sequences.
- the anti-TNFR superfamily member antibodies of the invention may be engineered into bispecific format using Knob-in-Hole (Genentech), CrossMAbs (Roche) and the electrostatically-matched (Chugai, Amgen, NovoNordisk, Oncomed), the LUZ-Y (Genentech), the Strand Exchange Engineered Domain body (SEEDbody) (EMD Serono), the Biclonic (Merus).
- selected amino acids forming the interface of the CH3 domains in human IgG can be mutated at positions affecting CH3 domain interactions to promote heterodimer formation.
- An amino acid with a small side chain (hole) is introduced into a heavy chain of an antibody specifically binding a first antigen and an amino acid with a large side chain (knob) is introduced into a heavy chain of an antibody specifically binding a second antigen.
- a heterodimer is formed because of the preferential interaction of the heavy chain with a “hole” with the heavy chain with a “knob”.
- Exemplary CH3 substitution pairs forming a knob and a hole are (expressed as modified position in the first CH3 domain of the first heavy chain/modified position in the second CH3 domain of the second heavy chain): T366Y/F405A, T366W/F405W, F405W/Y407A, T394W/Y407T, T394S/Y407A, T366W/T394S, F405W/T394S and T366W/T366S_L368A_Y407V.
- one of the half arms have the CH1 and the CL domains exchanged to ensure correct light chain pairing of the resulting bispecific antibody (see e.g. U.S. Pat. No. 8,242,247).
- heterodimerization may be promoted by following substitutions (expressed as modified position in the first CH3 domain of the first heavy chain/modified position in the second CH3 domain of the second heavy chain): L351Y_F405A_Y407V/T394W, T366I_K392M_T394W/F405A_Y407V, T366L_K392M_T394W/F405A_Y407V, L351Y_Y407A/T366A_K409F, L351Y_Y407A/T366V_K409F, Y407A/T366A_K409F, or T350V_L351Y_F405A_Y407V/T350V_T366L_K392L_T394W as described in U.S. Patent Publ. No. US2012/0149876 or U.S. Patent Publ. No. US2013/0195849.
- LUZ-Y technology may be utilized to generate bispecific antibodies.
- a leucine zipper is added into the C terminus of the CH3 domains to drive the heterodimer assembly from parental mAbs that is removed post-purification as described in (Wranik et al. (2012) J Biol Chem 287: 43331-9).
- SEEDbody technology may be utilized to generate bispecific antibodies.
- SEEDbodies have, in their constant domains, select IgG residues substituted with IgA residues to promote heterodimerization as described in U.S. Patent No. US20070287170.
- Bispecific antibodies may be generated in vitro in a cell-free environment by introducing asymmetrical mutations in the CH3 regions of two monospecific homodimeric antibodies and forming the bispecific heterodimeric antibody from two parent monospecific homodimeric antibodies in reducing conditions to allow disulfide bond isomerization according to methods described in Int. Patent Publ. No. WO2011/131746 (DuoBody technology).
- the first monospecific bivalent antibody and the second monospecific bivalent antibody are engineered to have certain substitutions at the CH3 domain that promoter heterodimer stability; the antibodies are incubated together under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide bond isomerization; thereby generating the bispecific antibody by Fab arm exchange.
- the incubation conditions may optimally be restored to non-reducing.
- exemplary reducing agents that may be used are 2-mercaptoethylamine (2-MEA), dithiothreitol (DTT), dithioerythritol (DTE), glutathione, tris(2-carboxyethyl) phosphine (TCEP), L-cysteine and beta-mercaptoethanol.
- 2-MEA 2-mercaptoethylamine
- DTT dithiothreitol
- DTE dithioerythritol
- glutathione glutathione
- tris(2-carboxyethyl) phosphine (TCEP) tris(2-carboxyethyl) phosphine
- L-cysteine L-cysteine
- beta-mercaptoethanol beta-mercaptoethanol.
- Antibody domains and numbering are well known. “Asymmetrical” refers to non-identical substitutions in the two CH3 domains in two separate heavy chains in an antibody.
- An IgG1 CH3 region typically consists of residues 341-446 on IgG1 (residue numbering according to the EU index).
- the antibodies of the invention may be engineered into various well known antibody forms.
- the invention provides for pharmaceutical compositions comprising the antibodies of the invention and a pharmaceutically acceptable carrier.
- the antibodies of the invention may be prepared as pharmaceutical compositions containing an effective amount of the antibody as an active ingredient in a pharmaceutically acceptable carrier.
- Carrier refers to a diluent, adjuvant, excipient, or vehicle with which the antibody of the invention is administered.
- vehicles may be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- 0.4% saline and 0.3% glycine may be used. These solutions are sterile and generally free of particulate matter.
- compositions may be sterilized by conventional, well-known sterilization techniques (e.g., filtration).
- the compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, stabilizing, thickening, lubricating and coloring agents, etc.
- concentration of the antibodies of the invention in such pharmaceutical formulation may vary, from less than about 0.5%, usually to at least about 1% to as much as 15 or 20% by weight and may be selected primarily based on required dose, fluid volumes, viscosities, etc., according to the particular mode of administration selected.
- Suitable vehicles and formulations, inclusive of other human proteins, e.g., human serum albumin are described, for example, in e.g. Remington: The Science and Practice of Pharmacy, 21 st Edition, Troy, D. B. ed., Lipincott Williams and Wilkins, Philadelphia, Pa. 2006, Part 5, Pharmaceutical Manufacturing pp 691-1092, See especially pp. 958-989.
- the mode of administration for therapeutic use of the antibodies of the invention may be any suitable route that delivers the antibody to the host, such as parenteral administration, e.g., intradermal, intramuscular, intraperitoneal, intravenous or subcutaneous, pulmonary, transmucosal (oral, intranasal, intravaginal, rectal), using a formulation in a tablet, capsule, solution, powder, gel, particle; and contained in a syringe, an implanted device, osmotic pump, cartridge, micropump; or other means appreciated by the skilled artisan, as well known in the art.
- parenteral administration e.g., intradermal, intramuscular, intraperitoneal, intravenous or subcutaneous
- pulmonary transmucosal
- oral intranasal, intravaginal, rectal
- a formulation in a tablet, capsule, solution, powder, gel, particle and contained in a syringe
- an implanted device osmotic pump, cartridge, micro
- Site specific administration may be achieved by for example intratumoral, intrarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracerebellar, intracerebroventricular, intracolic, intracervical, intragastric, intrahepatic, intracardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravascular, intravesical, intralesional, vaginal, rectal, buccal, sublingual, intranasal, or transdermal delivery.
- the antibodies of the invention may be administered to a subject by any suitable route, for example parentally by intravenous (i.v.) infusion or bolus injection, intramuscularly or subcutaneously or intraperitoneally.
- i.v. infusion may be given over for example 15, 30, 60, 90, 120, 180, or 240 minutes, or from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 hours.
- the dose given to a subject is sufficient to alleviate or at least partially arrest the disease being treated (“therapeutically effective amount”) and may be sometimes 0.005 mg to about 100 mg/kg, e.g. about 0.05 mg to about 30 mg/kg or about 5 mg to about 25 mg/kg, or about 4 mg/kg, about 8 mg/kg, about 16 mg/kg or about 24 mg/kg, or for example about 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 mg/kg, but may even higher, for example about 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 40, 50, 60, 70, 80, 90 or 100 mg/kg.
- therapeutically effective amount e.g. about 0.05 mg to about 30 mg/kg or about 5 mg to about 25 mg/kg, or about 4 mg/kg, about 8 mg/kg, about 16 mg/kg or about 24 mg/kg, or for example about 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 mg/kg, but may even higher, for example about 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 40, 50, 60, 70, 80
- a fixed unit dose may also be given, for example, 50, 100, 200, 500 or 1000 mg, or the dose may be based on the patient's surface area, e.g., 500, 400, 300, 250, 200, or 100 mg/m 2 .
- 1 and 8 doses e.g., 1, 2, 3, 4, 5, 6, 7 or 8
- 1 and 8 doses may be administered to treat the patient, but 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more doses may be given.
- the administration of the antibodies of the invention may be repeated after one day, two days, three days, four days, five days, six days, one week, two weeks, three weeks, one month, five weeks, six weeks, seven weeks, two months, three months, four months, five months, six months or longer. Repeated courses of treatment are also possible, as is chronic administration.
- the repeated administration may be at the same dose or at a different dose.
- the antibodies of the invention described herein may be administered at 8 mg/kg or at 16 mg/kg at weekly interval for 8 weeks, followed by administration at 8 mg/kg or at 16 mg/kg every two weeks for an additional 16 weeks, followed by administration at 8 mg/kg or at 16 mg/kg every four weeks by intravenous infusion.
- the antibodies in the methods of the invention may be provided as a daily dosage in an amount of about 0.1-100 mg/kg, such as 0.5, 0.9, 1.0, 1.1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, 45, 50, 60, 70, 80, 90 or 100 mg/kg, per day, on at least one of day 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40, or alternatively, at least one of week 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 after initiation of treatment, or any combination thereof, using single or divided doses of every 24, 12, 8, 6, 4, or 2 hours, or any combination thereof.
- 0.1-100 mg/kg such as 0.5, 0.9, 1.0, 1.1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
- the antibodies in the methods of the invention may also be administered prophylactically to reduce the risk of developing cancer, delay the onset of the occurrence of an event in cancer progression, and/or reduce the risk of recurrence when a cancer is in remission.
- the antibodies of the invention may be lyophilized for storage and reconstituted in a suitable carrier prior to use. This technique has been shown to be effective with conventional protein preparations and well known lyophilization and reconstitution techniques can be employed.
- the antibodies of the invention have in vitro and in vivo diagnostic, as well as therapeutic and prophylactic utilities.
- the antibodies of the invention may be administered to cells in culture, in vitro or ex vivo, or to a subject to treat, prevent, and/or diagnose a variety of disorders, such as cancers and infectious disorders.
- the invention also provides for a method of enhancing an agonistic activity of an anti-TNFR superfamily member in a subject, comprising introducing an E345R mutation, an E430G mutation, an E345R/E430G mutation or an E345R/E430G/S440Y mutation into the antibody to generate an engineered antibody specifically binding the receptor of TNFR family, and administering the engineered antibody to the subject for a time sufficient to enhance the agonistic activity.
- the invention also provides for a method of enhancing an agonistic activity of an anti-TNFR superfamily member in a subject, comprising introducing an E345R mutation, an E430G mutation, an E345R/E430G mutation or an E345R/E430G/S440Y mutation into the antibody to generate an engineered antibody specifically binding the receptor of TNFR family, and administering the engineered antibody to the subject.
- the invention also provides for a method of treating a cancer in a subject, comprising administering to the subject an antibody specifically binding a receptor of TNFR family comprising an E345R mutation, an E430G mutation, an E345R/E430G mutation or an E345R/E430G/S440Y for a time sufficient to treat the cancer.
- the invention also provides for a method of treating a cancer in a subject, comprising administering to the subject an anti-TNFR superfamily antibody comprising an E345R mutation, an E345R/E430G mutation or an E345R/E430G/S440Y for a time sufficient to treat the cancer.
- the antibody mediates ADCC.
- the antibody mediates ADCP.
- the antibody enhances the agonistic activity of an anti-TNFR superfamily member independent of antibody cross-linking.
- the antibody optionally further comprises a second mutation (s) that reduces ADCC.
- the subject has a viral infection.
- the subject has a cancer.
- the cancer is a solid tumor.
- the solid tumor is a melanoma, a lung cancer, a squamous non-small cell lung cancer (NSCLC), a non-squamous NSCLC, a colorectal cancer, a prostate cancer, a castration-resistant prostate cancer, a stomach cancer, an ovarian cancer, a gastric cancer, a liver cancer, a pancreatic cancer, a thyroid cancer, a squamous cell carcinoma of the head and neck, a carcinoma of the esophagus or gastrointestinal tract, a breast cancer, a fallopian tube cancer, a brain cancer, an urethral cancer, a genitourinary cancer, an endometriosis, a cervical cancer or a metastatic lesion of the cancer.
- NSCLC non-small cell lung cancer
- NSCLC non-squamous NSCLC
- colorectal cancer a prostate cancer
- a castration-resistant prostate cancer a stomach cancer
- an ovarian cancer a gastric cancer
- the TNFR is tumor necrosis factor receptor 1 (SEQ ID NO: 1), tumor necrosis factor receptor 2 (SEQ ID NO: 2), lymphotoxin beta receptor (SEQ ID NO: 3), OX40 (SEQ ID NO: 4), CD40 (SEQ ID NO: 5), Fas receptor (SEQ ID NO: 6), decoy receptor 3 (SEQ ID NO: 7), CD27 (SEQ ID NO: 8), CD30 (SEQ ID NO: 9), CD137 (SEQ ID NO: 10), death receptor 4 (SEQ ID NO: 11), death receptor 5 (SEQ ID NO: 12), decoy receptor 1 (SEQ ID NO: 13), decoy receptor 2 (SEQ ID NO: 14), RANK (SEQ ID NO: 15), osteoprotegerin (SEQ ID NO: 16), TWEAK receptor (SEQ ID NO: 17), TACI (SEQ ID NO: 18), BAFF receptor (SEQ ID NO: 19), herpesvirus entry mediator (SEQ ID NO: 20), nerve growth factor
- the TNFR is OX40 (SEQ ID NO: 4), CD27 (SEQ ID NO: 8), CD40 (SEQ ID NO: 5), CD137 (SEQ ID NO: 10), or GITR (SEQ ID NO: 23).
- the TNFR is OX40 (SEQ ID NO: 4).
- the TNFR is CD27 (SEQ ID NO: 8).
- the TNFR is CD40 (SEQ ID NO: 5).
- the TNFR is CD137 (SEQ ID NO: 10).
- the TNFR is GITR (SEQ ID NO: 23).
- TNFR1/2/TNF- ⁇ CD70/CD27/CD27, CD137/4-1BB, OX40/OX40L, CD40/CD40L, GITR/GITRL (Bremer, Hindawi Publishin Corporation ISRN oncology Volume 2013, Article ID 371854, 25 pages; Sanmamed et al)
- agonistic antibodies targeting the TNFR superfamily members such as anti-CD40, anti-OX-40, anti-GITR, anti-CD27, anti-CD137 antibodies are in clinical development for various solid tumors as well as heme malignancies such as non-Hodking's lymphoma and B-cell malignancies.
- anti-CD40, anti-OX40, anti-GITR, anti-CD27, anti-CD137 and other anti-TNFR superfamily member antibodies of the invention with improved properties in terms of their enhanced agonistic activity optionally coupled with effector functionality will be therapeutically effective in the treatment of various cancers, including solid tumors.
- TNFR tumor necrosis factor receptor
- Monoclonal antibodies that stimulate antitumor immunity are emerging as an important class of cancer therapeutics (Mellman et al. (2011) Nature 480: 480-9; Chen et al. (2013) Nat Rev Immunol 13: 227-42).
- the antibodies targeting the immune checkpoint receptors CTLA-4 and PD-1 have been approved as monotherapies for advanced melanoma, lung cancer and evaluated for the treatment of other types of human cancer.
- agonist antibodies directed against the immunostimulatory receptors on T cells and antigen presenting cells also can stimulate antitumor immunity and are emerging as a promising area of clinical development for cancer immunotherapies (Schaer et al. (2014) J Immunother Cancer 2: 7).
- TNF tumor necrosis factor
- CD40 is expressed on antigen presenting cells and the activation of this receptor facilitates more efficacious presentation of tumor antigens to activated T cells (Mangsbo et al. (2015) Clin Cancer Res 21: 1115-26). Many evidences indicated that the agonistic activities of therapeutic antibodies to these TNF receptors are important for their anti-tumor activities (Mangsbo et al. (2015) Clin Cancer Res 21: 1115-26; He et al. (2013) J Immunol 191: 4174-83; Wilson et al. (2011) Cancer Cell 19: 101-13). On the other hand, several TNFR superfamily members, such as OX40 and GITR, have elevated expression on regulatory T cells (T reg ) which negatively modulate tumor immunity.
- T reg regulatory T cells
- anti-OX40 and anti-GITR antibodies may facilitate the selective elimination of regulatory T cells in tumor microenvironment by the effector functions of the antibody (Bulliard et al. (2013) J Exp Med 210: 1685-93; Bulliard et al. (2014) Immunol Cell Biol 92: 475-80).
- Such antibody-mediated killing of regulatory T cells may be more important than the antibody-mediated activation of effector T cells for the anti-tumor activities of therapeutic anti-OX40 and anti-GITR antibodies.
- Anti-CD19 antibody engineered with such mutations showed improved inhibition of B cell receptor-mediated activation of primary human B cells.
- Fc variant also has enhanced binding to R131 allotype of the activating Fc ⁇ RIIA receptor (Mimoto et al. (2013) Protein Eng Des Sel 26: 589-98.
- Mimoto et al. reported a set of six mutations in IgG1 Fc, collectively named as V12 mutations, with selectively enhanced Fc ⁇ RIIB engagement without associated increased binding to either H131 or R131 allotype of Fc ⁇ RIIA receptor (Mimoto et al. (2013) Protein Eng Des Sel 26: 589-98.
- Anti-CD137 agonistic antibody with the engineered V12 mutation showed much enhanced agonistic activity dependent on Fc ⁇ RIIB engagement.
- Plasmids encoding antibody heavy chains (HC) and light chains (LC) were co-transfected at a 1:3 (HC: LC) molar ratio into Expi293F cells following the transfection kit instructions (Life Technologies). Cells were spun down five days post transfection and the supernatant were passed through a 0.2 ⁇ m filter. The titer of antibody expression was quantified using Octet (ForteBio). Antibody purification was carried out using prepacked Protein A spin columns following the kit instruction (GE Healthcare Life Sciences). The purified antibody was buffer-exchanged into DPBS, pH7.2 by dialysis and protein concentration was determined by UV absorbance at 280 nm. Quality and integrity of the molecules was assessed by high-performance size-exclusion chromatography (HP-SEC) and SDS-PAGE of reduced and non-reduced samples.
- HP-SEC high-performance size-exclusion chromatography
- the coding sequence for the light chain of anti-OX40 SF2 antibody was cloned into pNLF-C and pHTC halotag vectors (Promega, Madison, Wis.) in frame with C-terminal Nanoluc and Halotag sequences respectively. These light chains were paired with the heavy chains for OX40SF2IgG1, OX40SF2IgG1E345R, OX40SF2IgG1E345R/E430G, and OX40SF2IgG1E345R/E430G/S440Y antibodies to express Fc engineered SF2 antibodies with either Nanoluc or Halotag attached at the C-termini of the light chains. Standard Protein A spin column were employed to purify these modified antibodies.
- HEK-Blue OX40 cells were seeded in each well of the 96-well assay plate and cultured at 37° C. overnight. The next day, equal concentrations of Nanoluc-tagged antibody (donor) and Halotag-tagged antibody (acceptor) in 50 ⁇ l assay medium (Opti-MEM I reduced serum medium, no phenol red plus 4% FBS) were applied to the cells. Halotag 618 ligand diluted 1:1000 in 50 ⁇ l assay medium were added in experimental well, and a no ligand control well was also set up by diluting DMSO 1:1000 in assay medium.
- Plasmids expressing cDNAs encoding human Fc ⁇ RI (NM_000566) (SEQ ID NO: 59), Fc ⁇ RIIA (NM_021642) (SEQ ID NO: 60), Fc ⁇ RIIB (NM_004001) (SEQ ID NO: 61), and Fc ⁇ RIIIA (NM_000569) (SEQ ID NO: 62) (Origene) were transiently transfected into Expi293F cells by Expifectmine293 transfection kit (Life Technologies). Flow cytometry assays were performed 48 h after transfection.
- PE and DRAQ7 signals of the stained cells were detected by Miltenyi MACSQuant flow cytometer (Miltenyi Biotec, Auburn, USA) using B2 and B4 channel respectively. Live cells were gated on DRAQ7 exclusion and the geometric mean fluorescence signals were determined for at least 10,000 live events collected. FlowJo software (Tree Star) was used for analysis. Data was plotted as the logarithm of antibody concentration versus mean fluorescence signals. Nonlinear regression analysis was performed by GraphPad Prism 6 (GraphPad Software, Inc.) and EC 50 values were calculated.
- HEK-Blue human OX40
- OX40 expression plasmid pUNO1-hOX40
- SEAP secreted embryonic alkaline phosphatase
- IFN- ⁇ minimal promoter NF- ⁇ B-inducible promoter
- An OX40 target cell line expressing GFP was established by infection HEK-Blue: OX40 cells with a Turbo GFP transduction particle (Sigma Aldrich). Stable GFP-expressing cells were selected with puromycin.
- the human CD14 + CD16 + monocytes were isolated from PBMCs (Biologics Specialty) using a negative human monocyte enrichment kit without CD16 depletion (StemCell Technologies). Isolated monocytes were plated in X-VIVO-10 medium (Lonza) containing 10% FBS and macrophages were differentiated from monocytes by the addition of 25 ng/ml macrophage colony-stimulating factor (R&D Systems) for 7 days.
- IFN ⁇ 50 ng/ml; R&D Systems
- 1 ⁇ 10 5 cells/well differentiated macrophages were mixed with 0.25 ⁇ 10 5 cells/well GFP-expressing HEK-Blue: OX40 cells (4:1 ratio) in 200 ⁇ l medium (DMEM+10% FBS) in 96-well U-bottom plates.
- the test antibodies were added and the plate was incubated in a 37° C. incubator for 24 h. Then the cells were detached using Accutase (Sigma) and resuspended in BSA Stain Buffer.
- Macrophages were stained with anti-CD11b and anti-CD14 antibodies (BD Biosciences) coupled to Alexa Fluor 647 (Invitrogen).
- GFP positive HEK-Blue OX40 target cells and Alexa647 positive macrophages were identified by flow cytometry using Miltenyi MACSQuant flow cytometer (Miltenyi Biotec, Auburn, USA).
- Percentage of target cells killed ((Percentage of GFP + , CD11b ⁇ , CD14 ⁇ cells with the lowest concentration of antibody) ⁇ (Percentage of GFP + , CD11b ⁇ , CD14 ⁇ cells with the test concentration of antibody))/(Percentage of GFP + , CD11b ⁇ , CD14 ⁇ cells with the lowest concentration of antibody) ⁇ 100.
- OX40 a member of TNF receptor superfamily, activates nuclear factor kappaB (NFkB) signaling pathway by binding to TNF receptor-associated factors (TRAF).
- NFkB nuclear factor kappaB
- TNF receptor-associated factors TNF receptor-associated factors
- OX40SF2IgG1 antibody immobilized on protein G beads can stimulated reporter gene expression in a dose-dependent manner and to a level better than OX40 ligand at 1000 ng/ml ( FIG. 1A ), indicating that antibody crosslinking is needed for the agonistic activity.
- Fc ⁇ RIIB can provide the crosslinking activity and facilitate the agonistic activity of TNF receptor antibodies (Li et al. (2012) Cell Cycle 11: 3343-4).
- the Fc ⁇ RIIB crosslinking effect was assessed in the reporter assay by co-culturing HEK-Blue: OX40 cells with human B lymphoblastoid Raji cells, on which Fc ⁇ RIIB is predominantly expressed (Rankin et al. (2006) Blood 108: 2384-91).
- co-culturing with Raji cells failed to significantly enhance the agonistic activity of SF2 antibody with native IgG1 ( FIG. 1B ).
- OX40SF2IgG1 showed high affinity with an EC 50 at 326 ng/ml ( FIG. 2C ).
- the OX40SF2IgG1 S267E/L328F antibody showed similar binding property as OX40SF2IgG1, however, the V12 mutations significantly abrogate the binding of OX40SF2IgG1V12 antibody to Fc ⁇ RI.
- the binding of the engineered anti-OX40 antibodies to Fc ⁇ RIIIA receptor were also evaluated by flow cytometry assay.
- OX40SF2IgG1 antibody showed binding to Fc ⁇ RIIIA with an EC 50 of 744 ng/ml
- OX40SF2IgG1 S267E/L328F and OX40SF2IgG1V12 showed no binding activities to Fc ⁇ RIIIA ( FIG. 2D ).
- the ADCC activities of the anti-OX40 antibodies with S267E/L328F and V12 mutations were studied by a reporter bioassay, in which the bioluminescent reporter gene expression in effector cells reflects Fc ⁇ RIIIA-mediated ADCC activation.
- HEK-Blue OX40 target cells were co-cultured with effector cells expressing Fc ⁇ RIIIA, OX40SF2IgG1 dose-dependently activated reporter gene expression.
- OX40SF2IgG1S267E/L328F nor OX40SF2IgG1V12 induced reporter gene expression ( FIG.
- ADCP antibody dependent cellular phagocytosis
- OX40SF2IgG1S267E/L328F antibody had similar binding affinity to macrophage with the OX40SF2IgG1 antibody
- the OX40SF2IgG1V12 antibody although active in ADCP assay, had significantly reduced binding to macrophage ( FIG. 4C ).
- Antibody-mediated CDC were studied in an assay evaluating lysis HEK-Blue: OX40 cells in the presence of rabbit complement.
- the OX40SF2IgG1 antibody did not lead to significant CDC activity toward HEK-Blue:OX40 target cells up to 10,000 ng/ml.
- neither the V12 nor S267E/L328F mutations facilitated higher CDC activities relative to the antibody with the native human IgG1 Fc domain ( FIG. 4D ).
- Diebolder et al. identified a set of Fc mutations (E345R, E430G, and S440Y) which induced hexamerization of IgG1 antibody when bound to cell surface antigen, and enhanced antibody effector functions ADCC and CDC (Diebolder et al. (2014) Science 343: 1260-3). It was hypothesized that such multimerized antibody may enhance the agonism of anti-TNFR superfamily antibody by facilitating the aggregation of TNFR superfamily member, which is a prerequisite for receptor activation.
- E345R, E430G and S440Y mutations or the mutations in combination were engineered on anti-OX40 antibody SF2 on IgG1, and the resulting antibodies OX40SF2IgG1E345R, OX40SF2IgG1E430G, OX40SF2IgG1 E345R/E430G and OX40SF2IgG1 E345R/E430G/S440Y as shown in Table 3 were characterized.
- OX40SF2IgG1E345R, OX40SF2IgG1E430G and OX40SF2IgG1E345R/E430G antibodies exist as monomers in solution, just as OX40SF2IgG1.
- SEC analyses revealed a ⁇ 900 kDa peak for the triple mutated antibody OX40SF2IgG1E345R/E430G/S440Y, indicating the presence of a hexamer for that antibody. This observation is consistent with the reported finding that E345R/E430G/S440Y mutations promote hexamer formation readily in solution phase (Diebolder et al. (2014) Science 343: 1260-3.
- the generated antibodies OX40SF2IgG1E345R, OX40SF2IgG1E430G, OX40SF2IgG1E345R/E430G and OX40SF2IgG1E345R/E430G/S440Y were further engineered to have either the Nanoluc® luciferase or the fluorescently labeled Halo Tag® attached to the C-terminus of antibody light chain as the donor and acceptor, respectively.
- the tagged antibodies showed comparable functional activities in HEK-Blue NF ⁇ B reporter assay as corresponding un-tagged antibodies (data not shown).
- the degree of antibody association at the cell surface was in the following order: OX40SF2IgG1E345R/E430G>OX40SF2IgG1E345R/E430G/S440Y>OX40SF2IgG1E345R>OX40SF2IgG1E430G>OX40SF2IgG1.
- the engineered antibodies were characterized in HEK-BlueTM NF ⁇ B reporter assay to evaluate the effect of E345R, E430G and S440Y substitutions on agonistic activity of the antibodies. All generated antibodies demonstrated agonistic activity. OX40SF2IgG1E345R demonstrated the most improved agonistic activity when compared to the activity of OX40 ligand ( FIG. 6A ) albeit that the antibody did not have the highest degree of multimerization ( FIG. 5 ).
- OX40SF2IgG1E430G demonstrated the least improved agonistic activity while OX40SF2IgG1 E345R/E430G and OX40SF2IgG1E345R/E430G/S440Y demonstrated degree of agonism between OX40SF2IgG1E345R and OX40SF2IgG1E430G ( FIG. 6A ).
- E345 is a conserved residue among IgG subtypes. E345R mutation was also engineered on anti-OX40 antibody with the silent IgG2sigma Fc, resulting in antibody OX40SF2IgG2sigmaE345R.
- HEK-BlueTM NF ⁇ B reporter assay revealed that while OX40SF2IgG2sigma has little agonistic activity ( FIG. 6C ), the OX40SF2IgG2sigmaE345R showed agonism in a dose-dependent manner ( FIG. 6D ). This indicated that E345R mutation can facilitate agonism enhancement across multiple IgG subtypes.
- E345R mutation can facilitate the agonism of anti-OX40 antibody with either IgG1 or IgG2sigma Fc independent of Fc ⁇ RIIB crosslinking
- the effect of Fc ⁇ RIIB crosslinking was nonetheless studied by HEK-BlueTM NF ⁇ B reporter assay in which the engineered antibodies were applied to HEK-Blue: OX40 cells co-cultured with Raji cells. It was observed that the presence of Raji cells can further boost the agonism of OX40SF2IgG1E345R antibody, with over two-fold increases in activity across test concentrations compared to the case without Raji cell co-culturing ( FIG. 6B ).
- E345R mutation improved ADCC of the anti-OX40 antibody.
- OX40SF2IgG1E345R had improved ADCC when compared to OX40SF2IgG1 ( FIG. 7A ).
- OX40SF2IgG2sigma demonstrated no ADCC activity, and introduction of E345R mutation onto OX40SF2IgG2sigma had no effect on ADCC.
- the ADCP activities of the anti-OX40 antibodies with E345R mutation were also studied by the phagocytosis of GFP-expressed HEK-Blue: OX40 cells by differentiated macrophages.
- OX40SF2IgG1 antibody dose-dependently mediated killing of HEK-Blue: OX40 target cells by the macrophages, while introduction of the E345R mutation only marginally enhanced the ADCP activity of OX40SF2IgG1 antibody ( FIG. 7B ).
- OX40SF2IgG2sigma had no ADCP activity
- introduction of the E345R mutation onto OX40SF2IgG2sigma improved ADCP ( FIG. 7B ).
- Antibody-mediated CDC were studied in an assay evaluating lysis HEK-Blue: OX40 cells in the presence of rabbit complement. Although OX40SF2IgG1 antibody did not mediate significant CDC activity toward HEK-Blue:OX40 target cells, the E345R mutation dose-dependently facilitated OX40SF2IgG1 antibody with higher CDC activity. In contrast, the OX40SF2IgG2sigma antibody did not have CDC activity in this assay, and the E345R mutation on OX40SF2IgG2sigma antibody did not change its silencing in CDC activity ( FIG. 7C ).
- Agonistic antibodies directed against immunostimulatory TNFR superfamily members are emerging as promising drugs for cancer therapy.
- Recent Fc engineering efforts have been directed towards optimizing anti-TNFR superfamily antibodies for their antitumor immunity by enhancing their agonistic activity via optimizing their engagement with Fc ⁇ RIIB by introducing substitutions S267E/L328F and V12 into the Fc (Chu et al. (2008) Mol Immunol 45: 3926-33; Mimoto et al. (2013) Protein Eng Des Sel 26: 589-98).
- the reported S267E/L328F and V12 mutations enhanced the binding of engineered anti-OX40 antibodies to Fc ⁇ RIIB expressed in either transfected Expi293F cells or Raji cells and enhanced their agonistic activity in cross-linking dependent manner.
- the degree of agonism was comparable for both S267E/L328F and V12 mutations.
- S267E/L328F and V12 mutations in the OX40 antibodies disrupted antibody binding to Fc ⁇ RIIIA while enhancing binding to Fc ⁇ RIIB, which is consistent with that reported by Mimoto (Mimoto et al. (2013) Protein Eng Des Sel 26: 589-98.
- S267E/L328F and V12 mutations completely abrogated ADCC of the engineered anti-OX40 antibodies, which is largely mediated by Fc ⁇ RIIIA expressed on NK cells.
- the multimerized antibodies showed enhanced agonistic activity in the absence of Fc ⁇ RIIB-expressing cells, presumably due to the facilitation of increased clustering of OX40 on cells.
- the double E345R/E430G and triple E345R/E430G/S440Y mutations resulted in higher antibody multimerization when compared to the singular mutation alone, the single E345R mutation resulted in antibodies with the highest agonistic activity. While not wishing to be bound by any particular theory, it is thought that the oligomerized antibody with E345R mutation has a more favorable configuration in promoting the clustering of OX40 receptors than the antibody with E430G mutation.
- E345R mutation enhanced agonism independent of Fc ⁇ RIIB crosslinking
- Fc ⁇ RIIB-expressing cells further enhanced agonism of antibodies with E345R mutation.
- This further boost of agonism depended on the interaction of the engineered antibody with Fc ⁇ RIIB expressed on Raji cells as the boost of agonism was not observed on IgGsigma antibody silent in binding Fc ⁇ R and the agonism was abrogated by pre-blocking Fc ⁇ RIIB expressed on Raji cells. It has been reported that the multimerized antibody has higher affinity to Fc ⁇ receptors compared to antibody in monomer (Luo et al. (2009) MAbs 1: 491-504).
- OX40SF2E345R/E430G/S440Y which is partially a hexamer form in solution, has much potent binding to Fc ⁇ RIIB expressed on transfected Expi293F cells, compared to OX40SF2IgG1 and OX40SF2IgG1E345R antibodies, which exist as monomers in solution (data not shown).
- OX40SF2IgG1E345R bound to OX40 on the cell surface may have increased binding to Fc ⁇ RIIB on Raji cells, which in turn further stabilize antibody multimerization and facilitate receptor clustering that lead to the boost of agonism.
- the E345R mutation introduced into the anti-OX40 antibodies enhanced the potency of ADCC activity of the antibodies.
- the effect was specific for engineered antibody on IgG1, which is capable of binding to Fc ⁇ RIIIA, but not for antibody on IgG2sigma, which does not bind Fc ⁇ RIIIA.
- OX40SF2IgG1S267E/L328F antibody demonstrated similar binding potency to Fc ⁇ RI as OX40SF2IgG1 but abrogated binding to Fc ⁇ RIIIA. Besides, the degree of enhanced Fc ⁇ RIIA binding was just to a level comparable to its binding to the high affinity Fc ⁇ RI receptor. As a result, OX40SF2IgG1S267E/L328F antibody showed similar binding potency to macrophage as OX40SF2IgG1 and it did not show enhanced ADCP activity relative to OX40SF2IgG1.
- the OX40SF2IgG1V12 antibody has reduced binding to Fc ⁇ RI and Fc ⁇ RIIIA, and unchanged binding potency to Fc ⁇ RIIA, which might explain its significantly reduced binding to macrophages. Nonetheless, the OX40SF2IgG1V12 antibody showed a similar ADCP activity as OX40SF2IgG1. The reason for this discrepancy is unknown. Similarly, no significant increase in ADCP activity was observed for OX40SF2IgG1 antibody with E345R mutation, although such mutation significantly enhanced the ADCC activity of the engineered antibody. Interestingly, although OX40SF2IgG2sigma did not have ADCP activity, the E345R mutation conferred significant ADCP activity to this antibody with silent Fc.
- Each of the several Fc engineering approaches evaluated in this study offer a unique property in simultaneously enhancing the agonistic activity and modulating effect functions of the engineered antibodies.
- various engineering approaches can be envisioned for therapeutic antibodies binding TNFR superfamily members.
- antibodies binding CD40 and CD27 may benefit from improved agonistic activity but minimal ADCC to minimize risk of cell depletion. Therefore, S267E/L328F or V12 on IgG1 or E345R on IgG2sigma could be used to generate improved CD40 and CD27 antibodies.
- ADCC activity is desired for example to eliminate regulatory T cells
- E345R mutation on IgG1 can be used.
- antibodies binding to OX40 or GITR may benefit from improved agonistic activity and enhanced ADCC.
- the E345R mutation can facilitate higher agonism independent of Fc ⁇ RIIB crosslinking, which may equip antibody with defined therapeutic activity regardless of Fc ⁇ R expression levels in the local microenvironment, particularly an advantage for those cancer types with low Fc ⁇ R expressing cells infiltrated.
- the non-dependency on Fc ⁇ RIIB crosslinking may stimulate agonism non-specifically, which may lead to undesired off-target effects.
- the S267E/L328F or V12 mutations could be used.
- Other factors, including the altered binding activities to different Fc receptors, the immunogenicity, PK profile and developability of the engineered antibody should also be considered in the choice of the optimal engineering approach.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US15/668,895 US20180044430A1 (en) | 2016-08-12 | 2017-08-04 | FC Engineered Anti-TNFR Superfamily Member Antibodies Having Enhanced Atonistic Activity and Methods of Using Them |
US16/840,830 US11359029B2 (en) | 2016-08-12 | 2020-04-06 | FC engineered anti-TNFR superfamily member antibodies having enhanced agonistic activity and methods of using them |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201662374347P | 2016-08-12 | 2016-08-12 | |
US15/668,895 US20180044430A1 (en) | 2016-08-12 | 2017-08-04 | FC Engineered Anti-TNFR Superfamily Member Antibodies Having Enhanced Atonistic Activity and Methods of Using Them |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/840,830 Continuation US11359029B2 (en) | 2016-08-12 | 2020-04-06 | FC engineered anti-TNFR superfamily member antibodies having enhanced agonistic activity and methods of using them |
Publications (1)
Publication Number | Publication Date |
---|---|
US20180044430A1 true US20180044430A1 (en) | 2018-02-15 |
Family
ID=61158615
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/668,895 Abandoned US20180044430A1 (en) | 2016-08-12 | 2017-08-04 | FC Engineered Anti-TNFR Superfamily Member Antibodies Having Enhanced Atonistic Activity and Methods of Using Them |
US16/840,830 Active US11359029B2 (en) | 2016-08-12 | 2020-04-06 | FC engineered anti-TNFR superfamily member antibodies having enhanced agonistic activity and methods of using them |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/840,830 Active US11359029B2 (en) | 2016-08-12 | 2020-04-06 | FC engineered anti-TNFR superfamily member antibodies having enhanced agonistic activity and methods of using them |
Country Status (11)
Country | Link |
---|---|
US (2) | US20180044430A1 (ja) |
EP (1) | EP3497126A4 (ja) |
JP (2) | JP7009448B2 (ja) |
KR (1) | KR102554331B1 (ja) |
CN (1) | CN109843916B (ja) |
AU (1) | AU2017308734A1 (ja) |
CA (1) | CA3033665A1 (ja) |
IL (1) | IL264515A (ja) |
MA (1) | MA45941A (ja) |
SG (1) | SG11201900744SA (ja) |
WO (1) | WO2018031400A1 (ja) |
Cited By (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2019040808A1 (en) * | 2017-08-25 | 2019-02-28 | Janssen Biotech, Inc. | TYPE III FIBRONECTIN BINDER FCγRII DOMAINS, THEIR CONJUGATES AND MULTISPECIFIC MOLECULES COMPRISING THE SAME |
WO2020041361A1 (en) * | 2018-08-20 | 2020-02-27 | The General Hospital Corporation | Antagonistic anti-tumor necrosis factor receptor superfamily polypeptides |
WO2020061210A1 (en) * | 2018-09-18 | 2020-03-26 | Merrimack Pharmaceuticals, Inc. | Anti-tnfr2 antibodies and uses thereof |
CN112574315A (zh) * | 2019-09-30 | 2021-03-30 | 深圳市菲鹏生物制药股份有限公司 | 改变效应功能的Fc变体及其融合蛋白 |
EP3964525A4 (en) * | 2019-04-23 | 2022-12-28 | Joint Stock Company "Biocad" | MONOCLONAL ANTIBODY THAT BINDS SPECIFICALLY TO GITR |
US11844814B2 (en) | 2013-02-07 | 2023-12-19 | The General Hospital Corporation | Methods for expansion or depletion of T-regulatory cells |
US11859002B2 (en) | 2016-05-13 | 2024-01-02 | The General Hospital Corporation | Antagonistic anti-tumor necrosis factor receptor 2 antibodies |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20200033794A (ko) | 2017-08-03 | 2020-03-30 | 알렉터 엘엘씨 | 항-trem2 항체 및 이의 사용 방법 |
EP4255929A2 (en) | 2020-12-02 | 2023-10-11 | Vib Vzw | An ltbr agonist in combination therapy against cancer |
BR112023020622A2 (pt) | 2021-04-25 | 2023-12-05 | Jiangsu Hengrui Pharmaceuticals Co Ltd | Anticorpo anti-masp2, fragmento de ligação ao antígeno do mesmo e uso médico do mesmo |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100104564A1 (en) * | 2005-03-29 | 2010-04-29 | Genevieve Hansen | Altered Antibody Fc Regions and Uses Thereof |
US20140242075A1 (en) * | 2011-05-30 | 2014-08-28 | Genmab B.V. | Antibody variants and uses thereof |
US20150175707A1 (en) * | 2012-07-06 | 2015-06-25 | Genmab B.V. | Dimeric protein with triple mutations |
US20180037634A1 (en) * | 2016-08-02 | 2018-02-08 | Visterra, Inc. | Engineered polypeptides and uses thereof |
Family Cites Families (72)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
ATE87659T1 (de) | 1986-09-02 | 1993-04-15 | Enzon Lab Inc | Bindungsmolekuele mit einzelpolypeptidkette. |
JP3101690B2 (ja) | 1987-03-18 | 2000-10-23 | エス・ビィ・2・インコーポレイテッド | 変性抗体の、または変性抗体に関する改良 |
US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
GB8823869D0 (en) | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
IL162181A (en) | 1988-12-28 | 2006-04-10 | Pdl Biopharma Inc | A method of producing humanized immunoglubulin, and polynucleotides encoding the same |
US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
US6255458B1 (en) | 1990-08-29 | 2001-07-03 | Genpharm International | High affinity human antibodies and human antibodies against digoxin |
DE69233254T2 (de) | 1991-06-14 | 2004-09-16 | Genentech, Inc., South San Francisco | Humanisierter Heregulin Antikörper |
US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
JP3720353B2 (ja) | 1992-12-04 | 2005-11-24 | メディカル リサーチ カウンシル | 多価および多重特異性の結合タンパク質、それらの製造および使用 |
AUPO591797A0 (en) | 1997-03-27 | 1997-04-24 | Commonwealth Scientific And Industrial Research Organisation | High avidity polyvalent and polyspecific reagents |
US6818749B1 (en) | 1998-10-31 | 2004-11-16 | The United States Of America As Represented By The Department Of Health And Human Services | Variants of humanized anti carcinoma monoclonal antibody cc49 |
US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
JP2003524644A (ja) | 2000-02-01 | 2003-08-19 | タノックス インコーポレイテッド | Cd40−結合性apc−活性化分子 |
WO2001083755A2 (en) | 2000-04-28 | 2001-11-08 | La Jolla Institute For Allergy And Immunology | Human anti-cd40 antibodies and methods of making and using same |
US6596541B2 (en) | 2000-10-31 | 2003-07-22 | Regeneron Pharmaceuticals, Inc. | Methods of modifying eukaryotic cells |
TWI313299B (en) | 2000-11-30 | 2009-08-11 | Medarex Inc | Transgenic transchromosomal rodents for making human antibodies |
IL166244A0 (en) | 2001-07-12 | 2006-01-15 | Jefferson Foote | Super humanized antibodies |
AR039067A1 (es) | 2001-11-09 | 2005-02-09 | Pfizer Prod Inc | Anticuerpos para cd40 |
US7550140B2 (en) | 2002-06-13 | 2009-06-23 | Crucell Holland B.V. | Antibody to the human OX40 receptor |
BRPI0410785A (pt) | 2003-05-23 | 2006-06-20 | Wyeth Corp | molécula de ácido nucleico isolada, célula hospedeira, animal transgênico não humano, proteìna isolada, oligonucleotìdeo anti-sentido, molécula de sirna, anticorpo isolado, métodos de triagem quanto aos compostos de teste capazes de inibir, de intensificar ou imitar a interação do gitrl com o gitr, para diagnosticar doenças, para tratar um paciente em risco ou diagnosticado com uma doença, para induzir e para inibir a proliferação de uma população celular contendo células t efetoras, de bloquear a supressão e de supressão de uma população celular que inclua células t efetoras na presença de células t reguladoras cd4+cd25+, e para tratar uma doença, composição farmacêutica, e, adjuvante de vacina |
US20050048054A1 (en) | 2003-07-11 | 2005-03-03 | Shino Hanabuchi | Lymphocytes; methods |
US7288638B2 (en) | 2003-10-10 | 2007-10-30 | Bristol-Myers Squibb Company | Fully human antibodies against human 4-1BB |
CN101124245A (zh) * | 2003-11-12 | 2008-02-13 | 比奥根艾迪克Ma公司 | 新生儿Fc受体(FcRn)-结合多肽变体、二聚体Fc结合蛋白及其相关方法 |
AU2005282700A1 (en) | 2004-09-02 | 2006-03-16 | Genentech, Inc. | Heteromultimeric molecules |
PT1866339E (pt) | 2005-03-25 | 2013-09-03 | Gitr Inc | Moléculas de ligação a gitr e suas utilizações |
EP3050963B1 (en) | 2005-03-31 | 2019-09-18 | Chugai Seiyaku Kabushiki Kaisha | Process for production of polypeptide by regulation of assembly |
ATE485057T1 (de) | 2005-05-26 | 2010-11-15 | Seattle Genetics Inc | Humanisierte antikörper gegen cd40 und verfahren zu ihrer anwendung |
DE102005028778A1 (de) | 2005-06-22 | 2006-12-28 | SUNJÜT Deutschland GmbH | Mehrlagige Folie mit einer Barriere- und einer antistatischen Lage |
US20110212086A1 (en) | 2006-01-19 | 2011-09-01 | Genzyme Corporation | GITR Antibodies For The Treatment of Cancer |
CA2646965C (en) | 2006-03-24 | 2016-06-21 | Jonathan H. Davis | Engineered heterodimeric protein domains |
EP2035456A1 (en) | 2006-06-22 | 2009-03-18 | Novo Nordisk A/S | Production of bispecific antibodies |
US20080226635A1 (en) | 2006-12-22 | 2008-09-18 | Hans Koll | Antibodies against insulin-like growth factor I receptor and uses thereof |
CA2693677C (en) | 2007-07-12 | 2018-02-13 | Tolerx, Inc. | Combination therapies employing gitr binding molecules |
CA2694488A1 (en) | 2007-07-31 | 2009-02-05 | Medimmune, Llc | Multispecific epitope binding proteins and uses thereof |
US8748356B2 (en) | 2007-10-19 | 2014-06-10 | Janssen Biotech, Inc. | Methods for use in human-adapting monoclonal antibodies |
KR101577843B1 (ko) | 2007-12-14 | 2015-12-16 | 브리스톨-마이어스 스큅 컴퍼니 | 인간 ox40 수용체에 대한 결합 분자 |
CA2710373A1 (en) | 2007-12-19 | 2009-07-09 | Ping Tsui | Design and generation of human de novo pix phage display libraries via fusion to pix or pvii, vectors, antibodies and methods |
US8242247B2 (en) | 2007-12-21 | 2012-08-14 | Hoffmann-La Roche Inc. | Bivalent, bispecific antibodies |
US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
US8227577B2 (en) | 2007-12-21 | 2012-07-24 | Hoffman-La Roche Inc. | Bivalent, bispecific antibodies |
US9266967B2 (en) | 2007-12-21 | 2016-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
US20100261620A1 (en) | 2008-10-14 | 2010-10-14 | Juan Carlos Almagro | Methods of Humanizing and Affinity-Maturing Antibodies |
CA2759233C (en) | 2009-04-27 | 2019-07-16 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
AU2010289677B2 (en) | 2009-09-03 | 2014-07-31 | Merck Sharp & Dohme Llc | Anti-GITR antibodies |
US10053513B2 (en) * | 2009-11-30 | 2018-08-21 | Janssen Biotech, Inc. | Antibody Fc mutants with ablated effector functions |
LT2506871T (lt) | 2009-11-30 | 2016-12-12 | Janssen Biotech, Inc. | Antikūno fc mutantai su pašalinta efektoriaus funkcija |
AU2011223782B2 (en) | 2010-03-04 | 2014-09-18 | Macrogenics, Inc. | Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof |
EA024701B1 (ru) | 2010-04-13 | 2016-10-31 | Селлдекс Терапьютикс Инк. | Антитела, связывающие cd27 человека, и их применение |
KR102152109B1 (ko) | 2010-04-20 | 2020-09-07 | 젠맵 에이/에스 | 이종이량체 항체 fc-함유 단백질 및 그의 생산 방법 |
EP2591001B1 (en) | 2010-07-09 | 2021-11-17 | Aduro Biotech Holdings, Europe B.V. | Agonistic antibody to cd27 |
EP2609118B1 (en) | 2010-08-23 | 2017-01-18 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
WO2013028231A1 (en) | 2011-08-23 | 2013-02-28 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
SG10201506906VA (en) | 2010-09-09 | 2015-10-29 | Pfizer | 4-1bb binding molecules |
JP6167040B2 (ja) | 2010-11-05 | 2017-07-19 | ザイムワークス,インコーポレイテッド | Fcドメイン中に突然変異を有する、安定したヘテロ二量体抗体の設計 |
GB201115280D0 (en) | 2011-09-05 | 2011-10-19 | Alligator Bioscience Ab | Antibodies, uses and methods |
US20130108641A1 (en) | 2011-09-14 | 2013-05-02 | Sanofi | Anti-gitr antibodies |
MX358862B (es) | 2011-11-04 | 2018-09-06 | Zymeworks Inc | Diseño de anticuerpo heterodimérico estable con mutaciones en el domino fc. |
CN109265552A (zh) | 2012-10-30 | 2019-01-25 | 埃派斯进有限公司 | 抗-cd40抗体及其使用方法 |
KR20200134340A (ko) | 2013-01-10 | 2020-12-01 | 젠맵 비. 브이 | 인간 IgG1 Fc 영역 변이체 및 그의 용도 |
SG11201507577RA (en) | 2013-03-15 | 2015-10-29 | Janssen Biotech Inc | Manufacturing methods to control c-terminal lysine, galactose and sialic acid content in recombinant proteins |
ES2687282T3 (es) * | 2013-03-18 | 2018-10-24 | Biocerox Products B.V. | Anticuerpos humanizados ANTI-CD134 (OX40) y sus usos |
RU2016100892A (ru) * | 2013-06-14 | 2017-07-19 | Байер Фарма Акциенгезельшафт | Антитела против tweakr и их применение |
MA40871A (fr) * | 2014-10-29 | 2017-09-05 | Novartis Ag | Expression directe d'anticorps |
DK3247728T3 (da) * | 2015-01-20 | 2020-07-13 | Igm Biosciences Inc | Tumornekrosefaktor-(tnf)-superfamiliereceptorbindende molekyler og anvendelser deraf |
CN107709364A (zh) * | 2015-04-07 | 2018-02-16 | 豪夫迈·罗氏有限公司 | 具有激动剂活性的抗原结合复合体及使用方法 |
WO2017093448A1 (en) | 2015-12-01 | 2017-06-08 | Genmab B.V. | Anti-dr5 antibodies and methods of use thereof |
-
2017
- 2017-08-04 JP JP2019507248A patent/JP7009448B2/ja active Active
- 2017-08-04 SG SG11201900744SA patent/SG11201900744SA/en unknown
- 2017-08-04 US US15/668,895 patent/US20180044430A1/en not_active Abandoned
- 2017-08-04 CA CA3033665A patent/CA3033665A1/en active Pending
- 2017-08-04 MA MA045941A patent/MA45941A/fr unknown
- 2017-08-04 AU AU2017308734A patent/AU2017308734A1/en active Pending
- 2017-08-04 EP EP17840053.7A patent/EP3497126A4/en active Pending
- 2017-08-04 KR KR1020197007003A patent/KR102554331B1/ko active IP Right Grant
- 2017-08-04 CN CN201780063333.0A patent/CN109843916B/zh active Active
- 2017-08-04 WO PCT/US2017/045466 patent/WO2018031400A1/en unknown
-
2019
- 2019-01-28 IL IL264515A patent/IL264515A/en unknown
-
2020
- 2020-04-06 US US16/840,830 patent/US11359029B2/en active Active
-
2021
- 2021-11-11 JP JP2021184366A patent/JP2022033769A/ja active Pending
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100104564A1 (en) * | 2005-03-29 | 2010-04-29 | Genevieve Hansen | Altered Antibody Fc Regions and Uses Thereof |
US20140242075A1 (en) * | 2011-05-30 | 2014-08-28 | Genmab B.V. | Antibody variants and uses thereof |
US20150175707A1 (en) * | 2012-07-06 | 2015-06-25 | Genmab B.V. | Dimeric protein with triple mutations |
US20180037634A1 (en) * | 2016-08-02 | 2018-02-08 | Visterra, Inc. | Engineered polypeptides and uses thereof |
Cited By (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11844814B2 (en) | 2013-02-07 | 2023-12-19 | The General Hospital Corporation | Methods for expansion or depletion of T-regulatory cells |
US11859002B2 (en) | 2016-05-13 | 2024-01-02 | The General Hospital Corporation | Antagonistic anti-tumor necrosis factor receptor 2 antibodies |
WO2019040808A1 (en) * | 2017-08-25 | 2019-02-28 | Janssen Biotech, Inc. | TYPE III FIBRONECTIN BINDER FCγRII DOMAINS, THEIR CONJUGATES AND MULTISPECIFIC MOLECULES COMPRISING THE SAME |
US11078263B2 (en) | 2017-08-25 | 2021-08-03 | Janssen Biotech, Inc. | Fc γ RIII binding fibronectin type III domains, their conjugates and multispecific molecules comprising them |
WO2020041361A1 (en) * | 2018-08-20 | 2020-02-27 | The General Hospital Corporation | Antagonistic anti-tumor necrosis factor receptor superfamily polypeptides |
WO2020061210A1 (en) * | 2018-09-18 | 2020-03-26 | Merrimack Pharmaceuticals, Inc. | Anti-tnfr2 antibodies and uses thereof |
CN113056487A (zh) * | 2018-09-18 | 2021-06-29 | 梅里麦克制药股份有限公司 | 抗tnfr2抗体及其用途 |
EP3964525A4 (en) * | 2019-04-23 | 2022-12-28 | Joint Stock Company "Biocad" | MONOCLONAL ANTIBODY THAT BINDS SPECIFICALLY TO GITR |
CN112574315A (zh) * | 2019-09-30 | 2021-03-30 | 深圳市菲鹏生物制药股份有限公司 | 改变效应功能的Fc变体及其融合蛋白 |
Also Published As
Publication number | Publication date |
---|---|
IL264515A (en) | 2019-02-28 |
US20200231693A1 (en) | 2020-07-23 |
SG11201900744SA (en) | 2019-02-27 |
CA3033665A1 (en) | 2018-02-15 |
AU2017308734A1 (en) | 2019-02-14 |
JP2019532025A (ja) | 2019-11-07 |
WO2018031400A1 (en) | 2018-02-15 |
JP7009448B2 (ja) | 2022-02-10 |
KR20190038629A (ko) | 2019-04-08 |
EP3497126A4 (en) | 2020-04-08 |
KR102554331B1 (ko) | 2023-07-10 |
CN109843916A (zh) | 2019-06-04 |
JP2022033769A (ja) | 2022-03-02 |
US11359029B2 (en) | 2022-06-14 |
MA45941A (fr) | 2019-06-19 |
EP3497126A1 (en) | 2019-06-19 |
CN109843916B (zh) | 2023-10-31 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11359029B2 (en) | FC engineered anti-TNFR superfamily member antibodies having enhanced agonistic activity and methods of using them | |
US10669344B2 (en) | Engineered antibodies and other Fc-domain containing molecules with enhanced agonism and effector functions | |
TWI707872B (zh) | 特異性結合多種癌症抗原的三特異性結合分子和其使用方法 | |
TWI761348B (zh) | 抗cd40抗體及其用途 | |
US20180194862A1 (en) | Bispecific binding proteins | |
JP2023051968A (ja) | 多重特異的NKp46結合タンパク質 | |
KR20170065029A (ko) | 증강된 면역 반응 및 암 요법을 위한 조성물 및 사용 방법 | |
JP2018126150A (ja) | Tl1aと結合する抗体およびその使用 | |
TWI810541B (zh) | 靶向ox40及fap之雙特異性抗原結合分子 | |
JP2022516881A (ja) | 抗ctla4抗体およびその使用方法 | |
JP2022540620A (ja) | 胸腺間質性リンパ球新生因子(tslp)受容体シグナル伝達に干渉する薬剤 | |
CA3199839A1 (en) | Anti-cd19 agent and b cell targeting agent combination therapy for treating b cell malignancies | |
RU2817602C2 (ru) | Молекулы антител, которые связывают cd137 и ox40 | |
CA3229822A1 (en) | Cd33 x v?2 multispecific antibodies for the treatment of cancer | |
CN117999286A (zh) | 用于治疗癌症的CD33 x Vδ2多特异性抗体 | |
EP4077392A1 (en) | Mesothelin-targeted cd40 agonistic multispecific antibody constructs for the treatment of solid tumors | |
WO2018229715A1 (en) | Compositions comprising anti-cd32b antibodies and methods of use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: ADVISORY ACTION MAILED |
|
STCV | Information on status: appeal procedure |
Free format text: NOTICE OF APPEAL FILED |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |