US20180009881A1 - Polypeptides - Google Patents

Polypeptides Download PDF

Info

Publication number
US20180009881A1
US20180009881A1 US15/717,230 US201715717230A US2018009881A1 US 20180009881 A1 US20180009881 A1 US 20180009881A1 US 201715717230 A US201715717230 A US 201715717230A US 2018009881 A1 US2018009881 A1 US 2018009881A1
Authority
US
United States
Prior art keywords
polypeptide
suitably
icvd
mutagenesis
stability
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/717,230
Other languages
English (en)
Inventor
Scott Crowe
Mike West
Kevin Roberts
Tim Carlton
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
VHsquared Ltd
Original Assignee
VHsquared Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by VHsquared Ltd filed Critical VHsquared Ltd
Publication of US20180009881A1 publication Critical patent/US20180009881A1/en
Assigned to VHSQUARED LIMITED reassignment VHSQUARED LIMITED CONFIRMATORY ASSIGNMENT Assignors: CARLTON, Tim, CROWE, SCOTT, ROBERTS, KEVIN, WEST, MIKE
Priority to US16/950,758 priority Critical patent/US12173054B2/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1267Gram-positive bacteria
    • C07K16/1282Clostridium (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/241Tumor Necrosis Factors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • A61K2039/541Mucosal route
    • A61K2039/542Mucosal route oral/gastrointestinal
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/35Valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/577Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention relates to polypeptides comprising a region which is capable of binding a target with high affinity, especially those comprising immunoglobulin chain variable domains (ICVD) as well as to constructs comprising said polypeptides and pharmaceutical compositions comprising such polypeptides and constructs.
  • the polypeptides, constructs and pharmaceutical compositions of the invention are all suitable for oral administration.
  • the present invention also relates to methods of increasing the intestinal stability of a polypeptide comprising an immunoglobulin chain variable domain, methods of making a polypeptide comprising an immunoglobulin chain variable domain, and methods which utilise such polypeptides, constructs comprising such polypeptides, nucleic acids encoding such polypeptides, cDNA and vectors comprising nucleic acids encoding such polypeptides, host cells expressing or capable of expressing such polypeptides, pharmaceutical compositions comprising such polypeptides and to uses of such polypeptides.
  • therapeutic polypeptides including antibodies.
  • therapeutic polypeptides are administered either directly or indirectly into the circulation, via a systemic route.
  • many therapeutic polypeptides would ideally be delivered via the oral route.
  • Delivering therapeutic polypeptides orally could provide the following advantages: (a) direct targeting to the gastrointestinal tract (GIT) for localised treatment of gastrointestinal diseases (Jones and Martino 2015 Crit Rev Biotechnol 20:1-15), (b) the risk of adverse immune reactions could be reduced due to the naturally immuno-tolerant nature of the GIT, ensuring the long-term safety of repeatedly ingesting therapeutic polypeptide materials, (c) without the stringent regulatory requirements of manufacturing injectable therapeutic polypeptides, production costs could be reduced and (d) higher levels of patient acceptance and long term compliance could be achieved (Shaji and Patole Indian J Pharm Sci 2008 70(3):269-277).
  • CDRs complementarity determining regions
  • Polypeptides of the present invention may, in at least some embodiments, have one or more of the following advantages compared to substances of the prior art:
  • the present inventors have produced surprisingly advantageous polypeptides comprising immunoglobulin chain variable domains, suitable for oral administration. These polypeptides are particularly advantageous due to their increased intestinal stability (i.e. increased stability in the intestinal tract). It may be expected that these polypeptides have particular utility in the prevention or treatment of diseases of the gastrointestinal tract such as autoimmune and/or inflammatory disease such as inflammatory bowel disease, or in the prevention or treatment of infection from intestinal tract resident pathogenic microbe. Also provided are methods of increasing the intestinal stability of a polypeptide comprising an immunoglobulin chain variable domain and methods of making a polypeptide comprising an immunoglobulin chain variable domain having increased stability.
  • the present invention provides a polypeptide comprising an immunoglobulin chain variable domain comprising three complementarity determining regions (CDR1-CDR3) and four framework regions, wherein: (a) at least one lysine residue in CDR1, CDR2 and/or CDR3 has been substituted with at least one histidine residue, and/or (b) at least one arginine residue in CDR1, CDR2 and/or CDR3 has been substituted with at least one histidine residue; wherein the polypeptide has increased intestinal stability relative to a corresponding polypeptide not having said histidine substitutions.
  • CDR1-CDR3 three complementarity determining regions
  • a method of making a polypeptide comprising an immunoglobulin chain variable domain comprising an immunoglobulin chain variable domain, wherein the immunoglobulin chain variable domain comprises three complementarity determining regions (CDR1-CDR3) and four framework regions, wherein the method comprises the step of substituting: (a) at least one lysine residue in CDR1, CDR2 and/or CDR3 with at least one histidine residue, and/or (b) at least one arginine residue in CDR1, CDR2 and/or CDR3 with at least one histidine residue wherein the polypeptide has increased intestinal stability relative to a corresponding polypeptide not having said histidine substitutions.
  • CDR1-CDR3 complementarity determining regions
  • polypeptide comprising a region which is capable of binding a target with high affinity wherein: (a) at least one lysine residue in the region has been substituted with at least one histidine residue, and/or (b) at least one arginine residue in the region has been substituted with at least one histidine residue; wherein the polypeptide has increased intestinal stability relative to a corresponding polypeptide not having said histidine substitutions.
  • FIG. 1 Example TcdA dose-response curve on Vero cells
  • FIG. 2A Potency of anti-TNF ICVDs Q65B1, ID8F-EV, ID43F and ID44F (Experiment 1) against human TNF in the TNFR2/TNF interference ELISA
  • FIG. 2B Potency of anti-TNF ICVDs Q65B1 and ID8F-EV (Experiment 2) against human TNF in the TNFR2/TNF interference ELISA
  • FIG. 3A Stability of anti-TNF ICVDs Q65B1, ID8F-EV, ID43F and ID44F in mouse small intestinal supernatant after 6 hours incubation
  • FIG. 3B Stability of anti-TNF ICVDs Q65B1 and ID8F-EV in human faecal and mouse small intestinal supernatant after 16 hour incubation
  • FIG. 4 Potency of ICVDs ID32F and ID34F against human TNF in the TNFR2/TNF interference ELISA
  • FIG. 5A Stability of anti-TNF ICVDs ID32F and ID34F in mouse small intestinal supernatant after 16 hours incubation
  • FIG. 5B Stability of anti-TNF ICVDs ID32F and ID34F in human faecal supernatant pool 4 after 16 hours incubation
  • FIG. 6A TcdB 027 neutralisation by ID45B-ID50B in the Vero cell cytotoxicity assay
  • FIG. 6B Stability of anti-TcdB ICVDs ID45B-ID50B in human faecal supernatant pool 4 after 30 minutes incubation, analysed by western blot
  • FIG. 7 TcdB 027 neutralisation by ID2B, ID20B, ID21B and ID22B in the Vero cell cytotoxicity assay
  • FIG. 8A ID2B trypsin assay—stained polyacrylamide gel
  • FIG. 8B ID20B and ID21B trypsin assays—stained polyacrylamide gels
  • FIG. 8C ID22B trypsin assay—stained polyacrylamide gel
  • FIG. 9 Stability of anti-TcdB ICVDs ID2B and ID21B in human faecal supernatants after 1 hour incubation
  • FIG. 10B Stability of anti-TcdB ICVDs ID1B, ID24B, ID25B and ID27B in human faecal supernatant pool 2 after 1 hour incubation
  • FIG. 11B ID24B and 25B trypsin assays—stained polyacrylamide gels
  • FIG. 11C ID27B trypsin assay—stained polyacrylamide gel
  • FIG. 12A TcdB 017 neutralisation by bihead constructs ID41B and ID43B in the Vero cell cytotoxicity assay
  • FIG. 12B Stability of anti-TcdB bihead constructs ID41B and ID43B in C. difficile negative human faecal supernatant pool 2 after 4 hour incubation (three repeat ELISAs)
  • FIG. 12C Stability of anti-TcdB bihead constructs ID41B and ID43B in C. difficile negative human faecal supernatant pool 3 after 4 hour incubation (three repeat ELISAs)
  • FIG. 12D Stability of anti-TcdB bihead constructs ID41B and ID43B in C. difficile negative human faecal supernatant pool 4 after 4 hour incubation (three repeat ELISAs)
  • FIG. 13A TcdA 087 neutralisation by ID17A and ID29A in the Vero cell cytotoxicity assay
  • FIG. 13B Stability of anti-TcdA bihead constructs ID17A and ID29A in human faecal supernatants after 1 hour incubation
  • SEQ ID NO: 1 Polypeptide sequence of anti-TNF-alpha ICVD Q65B1
  • SEQ ID NO: 2 Polypeptide sequence of anti-TNF-alpha ICVD ID8F-EV (ID32F)
  • SEQ ID NO: 3 Polypeptide sequence of anti-TNF-alpha ICVD ID43F
  • SEQ ID NO: 4 Polypeptide sequence of anti-TNF-alpha ICVD ID44F
  • SEQ ID NO: 5 Polypeptide sequence of anti-TNF-alpha ICVD ID34F
  • SEQ ID NO: 6 Polypeptide sequence of anti-TcdB ICVD B10F1
  • SEQ ID NO: 7 Polypeptide sequence of anti-TcdB ICVD Q31B1
  • SEQ ID NO: 8 Polypeptide sequence of anti-TcdB ICVD ID1B
  • SEQ ID NO: 10 Polypeptide sequence of anti-TcdB ICVD ID20B
  • SEQ ID NO: 11 Polypeptide sequence of anti-TcdB ICVD ID21B
  • SEQ ID NO: 12 Polypeptide sequence of anti-TcdB ICVD ID22B
  • SEQ ID NO: 13 Polypeptide sequence of anti-TcdB ICVD ID24B
  • SEQ ID NO: 14 Polypeptide sequence of anti-TcdB ICVD ID25B
  • SEQ ID NO: 15 Polypeptide sequence of anti-TcdB ICVD ID27B
  • SEQ ID NO: 16 Polypeptide sequence of anti-TcdB construct ID41B
  • SEQ ID NO: 17 Polypeptide sequence of anti-TcdB construct ID43B
  • SEQ ID NO: 18 Polypeptide sequence of anti-TcdB ICVD ID45B
  • SEQ ID NO: 19 Polypeptide sequence of anti-TcdB ICVD ID46B
  • SEQ ID NO: 20 Polypeptide sequence of anti-TcdB ICVD ID47B
  • SEQ ID NO: 21 Polypeptide sequence of anti-TcdB ICVD ID48B
  • SEQ ID NO: 22 Polypeptide sequence of anti-TcdB ICVD ID49B
  • SEQ ID NO: 23 Polypeptide sequence of anti-TcdB ICVD ID50B
  • SEQ ID NO: 24 Polypeptide sequence of anti-TcdA construct ID17A
  • SEQ ID NO: 25 Polypeptide sequence of anti-TcdA construct ID29A
  • SEQ ID NO: 32 Polypeptide sequence of anti-IL-6R ICVD 7F6
  • SEQ ID NO: 33 Polypeptide sequence of anti-IL-6R ICVD ID-3V
  • SEQ ID NO: 34 Polypeptide sequence of anti-IL-6R ICVD 5G9
  • SEQ ID NO: 35 Polypeptide sequence of anti-IL-6R ICVD ID-54V
  • Polypeptides are organic polymers consisting of a number of amino acid residues bonded together in a chain.
  • polypeptide is used interchangeably with ‘protein’ and ‘peptide’.
  • Polypeptides are said to be antigen-binding when they contain one or more stretches of amino acid residues which form an antigen-binding site, capable of binding to an epitope on a target antigen with an affinity (suitably expressed as a Kd value, a Ka value, a kon-rate and/or a koff-rate, as further described herein).
  • Antigen-binding polypeptides include polypeptides such as antibodies, antibodies modified to comprise additional binding regions, and antigen-binding fragments.
  • a polypeptide may comprise a region which is capable of binding a target with high affinity (suitably expressed as a Kd value, a Ka value, a k on -rate and/or a k off -rate, as further described herein).
  • a target with high affinity suitable for binding a target with high affinity
  • Such polypeptides include DARPins (Binz et al. Journal of Molecular Biology 332(2):489-503), AffimersTM, FynomersTM, Centyrins, Nanofitins® and cyclic peptides.
  • a conventional antibody or immunoglobulin (Ig) is a protein comprising four polypeptide chains: two heavy (H) chains and two light (L) chains. Each chain is divided into a constant region and a variable domain.
  • the heavy chain variable domains are abbreviated herein as VHC, and the light (L) chain variable domains are abbreviated herein as VLC. These domains, domains related thereto and domains derived therefrom, are referred to herein as immunoglobulin chain variable domains.
  • the VHC and VLC domains can be further subdivided into regions of hypervariability, termed “complementarity determining regions” (“CDRs”), interspersed with regions that are more conserved, termed “framework regions” (“FRs”).
  • CDRs complementarity determining regions
  • each VHC and VLC is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the conventional antibody tetramer of two heavy immunoglobulin chains and two light immunoglobulin chains is formed with the heavy and the light immunoglobulin chains inter-connected by e.g. disulfide bonds, and the heavy chains similarity connected.
  • the heavy chain constant region includes three domains, CH1, CH2 and CH3.
  • the light chain constant region is comprised of one domain, CL.
  • the variable domain of the heavy chains and the variable domain of the light chains are binding domains that interact with an antigen.
  • the constant regions of the antibodies typically mediate the binding of the antibody to host tissues or factors, including various cells of the immune system (e.g. effector cells) and the first component (C1q) of the classical complement system.
  • the term antibody includes immunoglobulins of types IgA, IgG, IgE, IgD, IgM (as well as subtypes thereof), wherein the light chains of the immunoglobulin may be kappa or lambda types.
  • immunoglobulin-gamma (IgG) antibodies assembled from two identical heavy (H)-chain and two identical light (L)-chain polypeptides is well established and highly conserved in mammals (Padlan 1994 Mol Immunol 31:169-217).
  • HCAbs heavy-chain antibodies
  • the H chain of the homodimeric protein contains a dedicated immunoglobulin chain variable domain, referred to as the VHH, which serves to associate with its cognate antigen (Muyldermans 2013 Annu Rev Biochem 82:775-797, Hamers-Casterman et al 1993 Nature 363(6428):446-448, Muyldermans et al 1994 Protein Eng 7(9):1129-1135, herein incorporated by reference in their entirety).
  • VHH immunoglobulin chain variable domain
  • the total number of amino acid residues in a VHH or VH may be in the region of 105-140, is suitably 108-130, and is most suitably 110-125.
  • an antigen-binding fragment refers to a portion of an antibody that specifically binds to a target (e.g. a molecule in which one or more immunoglobulin chains is not full length, but which specifically binds to a target).
  • An antigen-binding fragment comprises an immunoglobulin chain variable domain. Examples of binding fragments encompassed within the term antigen-binding fragment include:
  • Fab fragment (a monovalent fragment consisting of the VLC, VHC, CL and CH1 domains);
  • a F(ab′)2 fragment (a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region);
  • VH an immunoglobulin chain variable domain consisting of a VHC domain (Ward et al Nature 1989 341:544-546);
  • VL an immunoglobulin chain variable domain consisting of a VLC domain
  • V-NAR an immunoglobulin chain variable domain consisting of a VHC domain from chondrichthyes IgNAR (Roux et al 1998 Proc Natl Acad Sci USA 95:11804-11809 and Griffiths et al 2013 Antibodies 2:66-81, herein incorporated by reference in their entirety)
  • the polypeptide of the invention consists of an immunoglobulin chain variable domain.
  • the polypeptide of the invention is an antibody, a modified antibody containing additional antibody binding regions or an antibody fragment such as a VHH, a VH, a VL, a V-NAR, scFv, a Fab fragment or a F(ab′) 2 fragment
  • Polypeptides of the invention may for example be obtained by preparing a nucleic acid encoding the polypeptide using techniques for nucleic acid synthesis, followed by expression of the nucleic acid thus obtained (as detailed further herein).
  • immunoglobulin chain variable domains per se.
  • the principles of the invention disclosed herein are, however, equally applicable to at least any polypeptide comprising an immunoglobulin chain variable domain, such as antibodies and antibody fragments.
  • the immunoglobulin chain variable domains disclosed herein may be incorporated into a polypeptide such as a full length antibody.
  • McCoy et al Retrovirology 2014 11:83 who provide an anti-HIV VHH engineered as a fusion with a human Fc region (including hinge, CH2 and CH3 domains), expressed as a dimer construct.
  • polypeptide sequences and definitions of CDRs and FRs are as defined according to the Kabat system (Kabat et al, ibid).
  • a “corresponding” amino acid residue between a first and second polypeptide sequence is an amino acid residue in a first sequence which shares the same position according to the Kabat system with an amino acid residue in a second sequence, whilst the amino acid residue in the second sequence may differ in identity from the first.
  • corresponding residues will share the same number (and letter) if the framework and CDRs are the same length according to Kabat definition.
  • Alignment can be achieved manually or by using, for example, a known computer algorithm for sequence alignment such as NCBI BLAST v2.0 (BLASTP or BLASTN) using standard settings. Two or more polypeptides are ‘corresponding’ if they share the same sequence but for any changes specified.
  • NCBI BLAST v2.0 BLASTP or BLASTN
  • CDRs 1, 2 and 3 are the first, second and third underlined portions of each ICVD or construct.
  • FRs 1, 2, 3 and 4 are the first, second, third and fourth portions joining the CDRs of each ICVD.
  • the linker is also shown in the case of biheads.
  • Substitutions relative to unmodified comparators are shown italicised and emboldened. Substitution descriptions in brackets are referred-to by N-to-C-terminal numbering (as opposed to Kabat numbering).
  • Anti-TNF-alpha (SEQ ID NO: 1) Q65B1 EVQLVESGGGLVQPGGSLKLSCAASGFDFS SHWMY WVRQAPGKELEWLS EINTNGLITKYGDSVKG RFTVSRNNAANKMYLELTRLEPEDTALYYCAR NQKGLN KGQGTQVTVSS (SEQ ID NO: 2) ID32F/ID8F-EV EVQLVESGGGLVQPGGSLKLSCAASGFDFS SHWMY WVRQAPGKELEWLS EINTNGLIT YGDSVKG RFTVSRNNAANKMYLELTRLEPEDTALYYCAR NQKGLN KGQGTQVTVSS (SEQ ID NO: 3) ID43F EVQLVESGGGLVQPGGSLKLSCAASGFDFS SHWMY WVRQAPGKELEWLS EINTNGLIT YGDSVKG RFTVSRNNAANKMYLELTRLEPEDTALYYCAR NQKGLN KGQGTQVTVSS
  • At least one, such as two, such as three arginine and/or lysine residues in the CDRs of a polypeptide of the invention are substituted with a histidine residue.
  • one arginine and/or lysine residue is substituted.
  • the substitutions are made in at least one, such as at least two, such as three CDRs.
  • 1 to 3, such as 1 to 2, such as 1 substitution(s) are made in all three, two or one CDR(s) of a polypeptide of the invention.
  • no more than three, such as no more than 2 lysine and/or arginine residues are substituted.
  • each lysine and/or arginine residue in CDR1, CDR2 and/or CDR3 of a polypeptide of the invention has been substituted with at least one, more suitably one, histidine residue each.
  • each CDR of a polypeptide of the invention which includes a substitution is no shorter than 3, more suitably no shorter than 4, more suitably no shorter than 5, more suitably no shorter than 6, more suitably no shorter than 7, more suitably no shorter than 8, more suitably no shorter than 9, more suitably no shorter than 10, more suitably no shorter than 11, more suitably no shorter than 12, more suitably no shorter than 13 amino acids.
  • each CDR of a polypeptide of the invention which includes a substitution is no longer than 35, more suitably no longer than 30, more suitably no longer than 25, more suitably no longer than 23, more suitably no longer than 21, more suitably no longer than 20, more suitably no longer than 19, more suitably no longer than 18, more suitably no longer than 17 amino acids.
  • the polypeptide of the invention is no longer than 2000, more suitably no longer than 1500, more suitably no longer than 1200, more suitably no longer than 900, more suitably no longer than 700, more suitably no longer than 600, more suitably no longer than 500, more suitably no longer than 400, more suitably no longer than 300, more suitably no longer than 250, more suitably no longer than 200, more suitably no longer than 150 amino acids.
  • the residues within a CDR may be considered to belong to a particular fraction of that CDR.
  • a CDR consisting of fifteen amino acids can be considered to consist of three thirds: a first third (a window consisting of ARNEC, SEQ ID NO: 27), a second third (a window consisting of DQGHI, SEQ ID NO: 28) and a third third (a window consisting of LKMFP, SEQ ID NO: 29).
  • this CDR can be considered to consist of five fifths: a first fifth (a window consisting of ARN), a second fifth (a window consisting of ECD), a third fifth (a window consisting of QGH), a fourth fifth (a window consisting of ILK) and a fifth fifth (a window consisting of MFP).
  • the numbering of the fractions of a CDR is from N- to C-terminus.
  • a CDR consists of a number of residues such that division into fractions would result in a non-whole number of residues residing in each fraction (such as sevenths of a CDR consisting of ARNECDQGHILKMFP, SEQ ID NO: 26) then (a) if the CDR consists of an odd number of residues, then the number of residues in the central fraction (e.g. the second third or the third fifth, etc) is rounded up to the nearest odd number or (b) if the CDR consists of an even number of residues, then the number of residues in the central fraction is rounded up and to the nearest even number.
  • the fourth seventh of a CDR consisting of ARNECDQGHILKMFP is the window consisting of QGH and the second third of a CDR consisting of ARNECDQG (SEQ ID NO: 30) is the window consisting of NECD (SEQ ID NO: 31).
  • the at least one lysine and/or arginine residue is present in a window defined as the second third of CDR1 and/or the second third of CDR2 and/or the second third of CDR3 and/or the third fifth of CDR1 and/or the third fifth of CDR2 and/or the third fifth of CDR3 and/or the fourth seventh of CDR1 and/or the fourth seventh of CDR2 and/or the fourth seventh of CDR3.
  • a polypeptide according to the invention does not have an amino acid sequence which is exactly the same as (i.e. shares 100% sequence identity with) the amino acid sequence of a naturally occurring polypeptide.
  • a polypeptide comprising an immunoglobulin chain variable domain comprising three complementarity determining regions (CDR1-CDR3) and four framework regions, having: (a) at least one histidine residue in place of at least one lysine residue in CDR1, CDR2 and/or CDR3, and/or (b) at least one histidine residue in place of at least one arginine residue in CDR1, CDR2 and/or CDR3; wherein the polypeptide has increased intestinal stability relative to a corresponding progenitor polypeptide not having said histidine substitutions.
  • CDR1-CDR3 three complementarity determining regions
  • a progenitor polypeptide is suitably a polypeptide which has not undergone the inventive histidine substitutions disclosed herein.
  • the corresponding progenitor polypeptide is the ‘wild type’ polypeptide (for example an antibody) which was directly produced by an animal, for example by V(D)J recombination and somatic mutation (such as a llama, such as following immunisation), and which may have optionally undergone further synthetic modifications, before undergoing the inventive histidine substitutions disclosed herein.
  • Specificity refers to the number of different types of antigens or antigenic determinants to which a particular antigen-binding polypeptide can bind.
  • the specificity of an antigen-binding polypeptide is the ability of the antigen-binding polypeptide to recognise a particular antigen as a unique molecular entity and distinguish it from another.
  • Affinity represented by the equilibrium constant for the dissociation of an antigen with an antigen-binding polypeptide (Kd) is a measure of the binding strength between an antigenic determinant and an antigen-binding site on an antigen-binding polypeptide: the lesser the value of the Kd, the stronger the binding strength between an antigenic determinant and the antigen-binding polypeptide (alternatively, the affinity can also be expressed as the affinity constant (Ka), which is 1/Kd). Affinity can be determined by known methods, depending on the specific antigen of interest.
  • Avidity is the measure of the strength of binding between an antigen-binding polypeptide and the pertinent antigen. Avidity is related to both the affinity between an antigenic determinant and its antigen-binding site on the antigen-binding polypeptide and the number of pertinent binding sites present on the antigen-binding polypeptide.
  • polypeptides of the invention bind to their target with a dissociation constant (Kd) of 10 ⁇ 6 to 10 ⁇ 12 M, more suitably 10 ⁇ 7 to 10 ⁇ 12 M, more suitably 10 ⁇ 8 to 10 ⁇ 12 M and more suitably 10 ⁇ 9 to 10 ⁇ 12 M.
  • Kd dissociation constant
  • any Kd value less than 10 ⁇ 6 is considered to indicate specific binding.
  • Specific binding of an antigen-binding polypeptide to an antigen or antigenic determinant can be determined in any suitable known manner, including, for example, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, and the different variants thereof known in the art.
  • Potency is a measure of the activity of a therapeutic agent expressed in terms of the amount required to produce an effect of given intensity.
  • a highly potent agent evokes a greater response at low concentrations compared to an agent of lower potency that evokes a smaller response at low concentrations.
  • Potency is a function of affinity and efficacy.
  • Efficacy refers to the ability of therapeutic agent to produce a biological response upon binding to a target ligand and the quantitative magnitude of this response.
  • the term half maximal effective concentration (EC50) refers to the concentration of a therapeutic agent which causes a response halfway between the baseline and maximum after a specified exposure time. The therapeutic agent may cause inhibition or stimulation. It is commonly used, and is used herein, as a measure of potency.
  • a neutralising polypeptide for the purposes of the invention is a polypeptide which binds to an agent (such as TNF-alpha) inhibiting the binding of the agent to one or more of its cognate receptors (such as TNFR1 and TNFR2), as measured by ELISA.
  • a neutralising polypeptide for the purposes of the invention is a polypeptide which defends a cell from the effects of an agent (such as TNF-alpha) by, for example, inhibiting the biological effect of the agent.
  • a neutralising polypeptide for the purposes of the invention is a polypeptide which defends a cell from the effects of a toxin (such as Clostridium Difficile Toxin A or B—“TcdA/TcdB”) by, for example, inhibiting the biological effect of the toxin.
  • a neutralising polypeptide for the purposes of the invention is a polypeptide which binds to IL-6R (and therefore the IL-6R/IL-6 complex), inhibiting binding of the IL-6R/IL-6 complex to gp130, as measured by ELISA.
  • the effectiveness (e.g. neutralising ability) of a therapeutic agent can be ascertained using a potency assay.
  • a particularly suitable potency assay is the measurement of Vero cell viability using Alamar Blue (Fields and Lancaster American Biotechnology Laboratory 1993 11(4):48-50). Using a range of known concentrations of a toxin, this assay can be performed to ascertain the ability of a therapeutic polypeptide to neutralise the effects of the toxin by producing a dose-response curve and/or by ascertaining the half maximal effective concentration (EC50) of the therapeutic polypeptide.
  • This Vero Cell Cytotoxicity Standard Assay is used herein and detailed further in the Examples section below.
  • TNFR2/TNF Interference ELISA Assay Another particularly suitable potency assay is the Standard TNFR2/TNF Interference ELISA Assay (detailed further in the Examples section below), which tests the effectiveness of a therapeutic agent in blocking TNF-alpha binding to TNFR2, in respect of a range of known concentrations of agent, producing a dose-response curve and/or by ascertaining the half maximal effective concentration (EC50) of the therapeutic polypeptide.
  • EC50 half maximal effective concentration
  • Another particularly suitable potency assay is the Standard gp130 ELISA Assay (detailed further in the Examples section below), which tests the effectiveness of a therapeutic agent in blocking the sIL-6/IL-6R complex binding to gp130, in respect of a range of known concentrations of agent, producing a dose-response curve and/or by ascertaining the half maximal effective concentration (EC50) of the therapeutic polypeptide.
  • Standard gp130 ELISA Assay (detailed further in the Examples section below), which tests the effectiveness of a therapeutic agent in blocking the sIL-6/IL-6R complex binding to gp130, in respect of a range of known concentrations of agent, producing a dose-response curve and/or by ascertaining the half maximal effective concentration (EC50) of the therapeutic polypeptide.
  • the potency of the polypeptide of the invention is substantially the same as the potency of a corresponding polypeptide not having histidine substitutions of the invention.
  • the polypeptide of the invention or the polypeptide of the methods of the invention inhibits binding of a binding agent to a binding partner, such as TNF-alpha to TNFR2 in the Standard TNF/TNFR2 Interference ELISA Assay, with an EC50 of 300 nM or less, more suitably 200 nM or less, more suitably 100 nM or less, more suitably 80 nM or less, more suitably 60 nM or less, more suitably 40 nM or less, more suitably 20 nM or less, more suitably 10 nM or less, more suitably 5 nM or less.
  • a binding agent such as TNF-alpha to TNFR2 in the Standard TNF/TNFR2 Interference ELISA Assay
  • the EC50 of the polypeptide of the invention or the polypeptide of the methods of the invention is increased by no more than 300 pM, more suitably no more than 200 pM, more suitably no more than 100 pM, more suitably no more than 50 pM, more suitably no more than 25 pM, more suitably no more than 10 pM, more suitably no more than 5 pM, relative to a corresponding polypeptide not having histidine substitutions of the invention, such as in inhibiting binding of TNF-alpha to TNFR2 in the Standard TNF/TNFR2 Interference ELISA Assay.
  • the EC50 of the polypeptide of the invention or the polypeptide of the methods of the invention is increased by no more than 500%, more suitably 400%, more suitably 300%, more suitably 200%, more suitably 100%, more suitably 70%, more suitably 60%, more suitably 50%, more suitably 40%, more suitably 30%, more suitably 25%, more suitably 20%, more suitably 15%, more suitably 10%, more suitably 5%, more suitably 2%, more suitably 1%, relative to a corresponding polypeptide not having histidine substitutions of the invention, such as in inhibiting binding of TNF-alpha to TNFR2 in the Standard TNF/TNFR2 Interference ELISA Assay.
  • the polypeptide of the invention or the polypeptide of the methods of the invention neutralizes the cytotoxicity of a toxin, such as TcdA or TcdB, in the Vero Cell Cytotoxicity Standard Assay with an EC50 of 100 nM or less, more suitably 80 nM or less, more suitably 60 nM or less, more suitably 40 nM or less, more suitably 30 nM or less, more suitably 20 nM or less, more suitably 10 nM or less, more suitably 9 nM or less, more suitably 8 nM or less, more suitably 7 nM or less, jmore suitably 6 nM or less more suitably 5 nM or less, more suitably 4 nM or less, more suitably 3 nM or less, more suitably 2 nM or less, more suitably 1 nM or less.
  • a toxin such as TcdA or TcdB
  • the EC50 of the polypeptide of the invention or the polypeptide of the methods of the invention is increased by no more than 200 nM, more suitably 150 nM, more suitably 100 nM, more suitably 80 nM, more suitably 60 nM, more suitably 40 nM, more suitably 20 nM, more suitably 10 nM, more suitably 5 nM, relative to a corresponding polypeptide not having histidine substitutions of the invention, in neutralising the cytotoxicity of a toxin, such as TcdA or TcdB, in the Vero Cell Cytotoxicity Standard Assay.
  • a toxin such as TcdA or TcdB
  • the EC50 of the polypeptide of the invention or the polypeptide of the methods of the invention is increased by no more than 500%, more suitably 400%, more suitably 300%, more suitably 200%, more suitably 100%, more suitably 70%, more suitably 60%, more suitably 50%, more suitably 40%, more suitably 30%, more suitably 25%, more suitably 20%, more suitably 15%, more suitably 10%, more suitably 5%, more suitably 2%, more suitably 1%, relative to a corresponding polypeptide not having histidine substitutions of the invention, in neutralising the cytotoxicity of a toxin, such as TcdA or TcdB, in the Vero Cell Cytotoxicity Standard Assay.
  • a toxin such as TcdA or TcdB
  • the polypeptide of the invention or the polypeptide of the methods of the invention inhibits binding of a binding agent to a binding partner, such the sIL-6/IL-6R complex binding to gp130 in the Standard gp130 ELISA Assay, with an EC50 of 300 nM or less, more suitably 200 nM or less, more suitably 100 nM or less, more suitably 80 nM or less, more suitably 60 nM or less, more suitably 40 nM or less, more suitably 20 nM or less, more suitably 10 nM or less, more suitably 5 nM or less, more suitably 1 nM or less, more suitably 0.5 nM or less, more suitably 0.3 nM or less, more suitably 0.2 nM or less, more suitably 0.15 nM or less.
  • the EC50 of the polypeptide of the invention or the polypeptide of the methods of the invention is increased by no more than 300 pM, more suitably no more than 200 pM, more suitably no more than 100 pM, more suitably no more than 80 pM, more suitably no more than 70 pM, more suitably no more than 60 pM, more suitably no more than 50 pM, more suitably no more than 25 pM, more suitably no more than 20 pM, more suitably no more than 15 pM, more suitably no more than 10 pM, more suitably no more than 5 pM, relative to a corresponding polypeptide not having histidine substitutions of the invention, such as in inhibiting binding of a binding agent to a binding partner, such the sIL-6/IL-6R complex binding to gp130 in the Standard gp130 ELISA Assay.
  • the EC50 of the polypeptide of the invention or the polypeptide of the methods of the invention is increased by no more than 600%, more suitably no more than 500%, more suitably 400%, more suitably 300%, more suitably 200%, more suitably 100%, more suitably 70%, more suitably 60%, more suitably 50%, more suitably 40%, more suitably 30%, more suitably 25%, more suitably 20%, more suitably 15%, more suitably 10%, more suitably 5%, more suitably 2%, more suitably 1%, relative to a corresponding polypeptide not having histidine substitutions of the invention, such the sIL-6/IL-6R complex binding to gp130 in the Standard gp130 ELISA Assay.
  • substitutions may be made to a polypeptide with the objective of introducing pH sensitivity, for example to significantly reduce the affinity of an antibody for an antigen upon entry of the antibody into the acidic endosome.
  • the substitutions of the present invention suitably do not invoke substantial pH sensitivity.
  • the substitutions to the polypeptide of the invention or the substitutions to the polypeptide of the methods of the invention are not for engineering pH dependency of target binding.
  • the affinity of the polypeptide of the invention or the polypeptide of the methods of the invention remains substantially the same at any pH from 3 to 9, more suitably any pH from 4 to 8.
  • the GIT is an organ system responsible for consuming and digesting foodstuffs, absorbing nutrients, and expelling waste.
  • the GIT consists of the mouth, oesophagus, stomach, small intestine (duodenum, jejunum and ileum) and large intestine (cecum, colon, rectum and anal canal).
  • the intestinal tract as opposed to the gastrointestinal tract, consists of only the small intestine and the large intestine.
  • Various pathogens may colonise, and various diseases may manifest in, different areas of the gastrointestinal tract.
  • the different parts of the gastrointestinal tract each contain a complex mixture of digestive enzymes. These digestive enzymes include proteases, lipases, amylases and nucleases.
  • proteases include serine proteases, threonine proteases, cysteine proteases, aspartate proteases, glutamic acid proteases and metalloproteases. Proteases are involved in digesting polypeptide chains into shorter fragments by splitting the peptide bonds that link amino acid residues (proteolysis). Some detach the terminal amino acids from the protein chain (exopeptidases); others attack internal peptide bonds of a protein (endopeptidases).
  • the intestinal tract comprises a vast array of different proteases.
  • Proteolysis in the intestinal tract can be highly promiscuous such that a wide range of protein substrates are hydrolysed by the wide variety of proteases present. This is the case for proteases which cleave the wide array of ingested polypeptides in the intestinal tract into smaller polypeptide fragments.
  • the substitutions made to the polypeptide of the invention or to the polypeptide of the methods of the invention increase the stability of the polypeptide to one or more proteases present in the small or large intestine, relative to a corresponding polypeptide not having histidine substitutions of the invention.
  • the proteases include proteases originating from intestinal microbiota or pathogenic bacteria, for example wherein the proteases are cell membrane-attached proteases, secreted proteases and/or proteases released on cell lysis.
  • the one or more proteases are selected from the group consisting of trypsin, chymotrypsin, host inflammatory proteases, proteases originating from microbiota and proteases originating from pathogenic bacteria such as C. difficile -specific proteases.
  • the intestinal tract is a mammalian intestinal tract, such as a human, simian, murine, bovine, ovine, canine, feline, equine or porcine intestinal tract.
  • substitutions made to the polypeptide of the invention, or substitutions made to the polypeptide of the methods of the invention increase the stability of the polypeptide in the intestinal tract, or in a model of the intestinal tract, such as in the small and/or large intestine, such as in the duodenum, jejunum, ileum cecum, colon, rectum and/or anal canal, relative to a corresponding polypeptide not having histidine substitutions of the invention.
  • the model of the intestinal tract is the Standard Human Faecal Supernatant Intestinal Tract Model, the Standard Mouse Small Intestinal Supernatant Intestinal Tract Model, or the Standard Trypsin Intestinal Tract Model.
  • the stability of a polypeptide of the invention or the polypeptide of the methods of the invention is increased by at least 1%, more suitably 2%, more suitably 3%, more suitably 5%, more suitably 7%, more suitably 10%, more suitably 15%, more suitably 20%, more suitably 30%, more suitably 40%, more suitably 50%, more suitably 60%, more suitably 70%, relative to a corresponding polypeptide not having histidine substitutions of the invention, after 6 or 16 hours incubation in the Standard Mouse Small Intestinal Supernatant Intestinal Tract Model.
  • the stability of a polypeptide of the invention or the polypeptide of the methods of the invention is increased by at least 1%, more suitably 2%, more suitably 3%, more suitably 5%, more suitably 7%, more suitably 10%, more suitably 15%, more suitably 20%, more suitably 25%, more suitably 30%, more suitably 40%, more suitably 50%, more suitably 60%, more suitably 70%, relative to a corresponding polypeptide not having histidine substitutions of the invention, after 30 minutes, 1 hour, 4 hours or 16 hours incubation in the Standard Human Faecal Supernatant Intestinal Tract Model.
  • At least 5% Suitably at least 10%, more suitably at least at least 20%, more suitably at least 25%, more suitably at least 30%, more suitably at least 35%, more suitably at least 40%, more suitably at least 50%, more suitably at least 60% of the polypeptide of the invention or the polypeptide of the methods of the invention remains viable, as determined for example by the Standard gp130 ELISA Assay when the ICVD is an anti-IL-6R ICVD, after 4 hours incubation in the Standard Mouse Small Intestinal Supernatant Intestinal Tract Model.
  • the stability of a polypeptide of the invention or the polypeptide of the methods of the invention is increased by at least 1%, more suitably 2%, more suitably 3%, more suitably 5%, more suitably 7%, more suitably 10%, more suitably 15%, more suitably 20%, more suitably 30%, more suitably 40%, more suitably 50%, more suitably 60%, more suitably 70%, relative to a corresponding polypeptide not having histidine substitutions of the invention, after 4 hours incubation in the Standard Mouse Small Intestinal Supernatant Intestinal Tract Model.
  • the stability of a polypeptide of the invention or the polypeptide of the methods of the invention is increased by at least 1%, more suitably 2%, more suitably 3%, more suitably 5%, more suitably 7%, more suitably 10%, more suitably 15%, more suitably 20%, more suitably 25%, more suitably 30%, more suitably 40%, more suitably 50%, more suitably 60%, more suitably 70%, relative to a corresponding polypeptide not having histidine substitutions of the invention, after 16 hours incubation in the Standard Human Faecal Supernatant Intestinal Tract Model.
  • the percentage of ‘viable’ ICVD remaining after incubation refers to the proportion of intact ICVD (for example in the Standard Western Blot Stability Assay), or the proportion of functional ICVD (for example in the Standard TNFR2/TNF Interference ELISA Assay when the ICVD is an anti-TNF-alpha ICVD or Standard Toxin ELISA Assay when the ICVD is an anti-toxin ICVD).
  • the percentage of ‘viable’ ICVD remaining after incubation refers to the proportion of intact ICVD (for example in the Standard Western Blot Stability Assay), or the proportion of functional ICVD (for example in the Standard gp130 ELISA Assay when the ICVD is an anti-IL-6R ICVD).
  • Diseases of the gastrointestinal tract refer to diseases involving the gastrointestinal tract, namely the oesophagus, stomach, small intestine (duodenum, jejunum and ileum) and large intestine (cecum, colon, rectum and anal canal).
  • the polypeptide of the invention or the polypeptide of the methods of the invention may be used in the treatment or prevention of such diseases.
  • the polypeptide of the invention or the polypeptide of the methods of the invention is used in local and/or topical treatment or prevention of such diseases.
  • Autoimmune diseases develop when the immune system responds adversely to normal body tissues. Autoimmune disorders may result in damage to body tissues, abnormal organ growth and/or changes in organ function. The disorder may affect only one organ or tissue type or may affect multiple organs and tissues. Organs and tissues commonly affected by autoimmune disorders include blood components such as red blood cells, blood vessels, connective tissues, endocrine glands such as the thyroid or pancreas, muscles, joints and skin. An inflammatory disease is a disease characterised by inflammation. Many inflammatory diseases are autoimmune diseases and vice-versa.
  • IBDs chronic inflammatory bowel diseases
  • Ulcerative colitis is defined as a condition where the inflammatory response and morphologic changes remain confined to the colon. The rectum is involved in 95% of patients. Inflammation is largely limited to the mucosa and consists of continuous involvement of variable severity with ulceration, edema, and hemorrhage along the length of the colon (Hendrickson et al 2002 Clin.
  • Ulcerative colitis is usually manifested by the presence of blood and mucus mixed with stool, along with lower abdominal cramping which is most severe during the passage of bowel movements.
  • the presence of diarrhoea with blood and mucus differentiates ulcerative colitis from irritable bowel syndrome, in which blood is absent.
  • the presentation of Crohn's disease is usually subtle, which leads to a later diagnosis.
  • Factors such as the location, extent, and severity of involvement determine the extent of symptoms.
  • Patients who have ileocolonic involvement usually have postprandial abdominal pain, with tenderness in the right lower quadrant and an occasional inflammatory mass.
  • composition of the invention is for use in the treatment of an autoimmune and/or inflammatory disease of the gastrointestinal tract, suitably selected from the list consisting of Crohn's disease, ulcerative colitis, irritable bowel syndrome, diabetes type II, glomerulonephritis, autoimmune hepatitis, Sjogren's syndrome, coeliac disease and drug- or radiation-induced mucositis (most suitably Crohn's disease).
  • an autoimmune and/or inflammatory disease of the gastrointestinal tract suitably selected from the list consisting of Crohn's disease, ulcerative colitis, irritable bowel syndrome, diabetes type II, glomerulonephritis, autoimmune hepatitis, Sjogren's syndrome, coeliac disease and drug- or radiation-induced mucositis (most suitably Crohn's disease).
  • Viral, bacterial, parasitic and other pathogenic infections can occur in the gastrointestinal tract. These may be confined to the gastrointestinal tract or initiated in the gastrointestinal tract before spreading to other parts of the body.
  • the polypeptide of the invention may be used for the treatment or prevention of bacterial infection including infection by common bacterial gastrointestinal tract pathogens including Escherichia coli, Salmonella, Campylobacter, Vibrio cholerae, Shigella, Clostridium perfringens, Clostridium difficile, Bacillus cereus, Vibrio parahaemolyticus and Yersinia enerocolitica.
  • the polypeptide of the invention may be used for the treatment or prevention of viral infection including common viral gastrointestinal tract pathogens which include rotavirus, norovirus and small round viruses.
  • the polypeptide of the invention is for use in the treatment or prevention of nosocomial infection.
  • the polypeptide of the invention is for use in the treatment or prevention of C. difficile infection.
  • the polypeptide of the invention binds to a target accessible via the intestinal tract, such as a target within the intestinal tract.
  • the target is a deleterious agent originating from an intestinal tract resident pathogenic microbe.
  • the target is a target originating from host microbiota which may induce pathogenesis, a host cell, host derived inflammatory mediators or a protein involved in disease pathogenesis.
  • the target is selected from the group consisting of: TNF-alpha, C. difficile toxin A, or C. difficile toxin B.
  • the target is selected from the group consisting of: IL-6R, TNF-alpha, C. difficile toxin A, or C. difficile toxin B.
  • a construct according to the invention comprises multiple polypeptides and therefore may suitably be multivalent. Such a construct may comprise at least two identical polypeptides according to the invention.
  • a construct consisting of two identical polypeptides according to the invention is a “homobihead”.
  • a construct comprising a polypeptide of the invention In one aspect of the invention there is provided a construct comprising two or more (possibly identical) polypeptides of the invention.
  • a construct may comprise at least two polypeptides which are different, but are both still polypeptides according to the invention (a “heterobihead”).
  • such a construct may comprise (a) at least one polypeptide according to the invention and (b) at least one polypeptide such as an antibody or antigen-binding fragment thereof, which is not a polypeptide of the invention (also a “heterobihead”).
  • the at least one polypeptide of (b) may bind TNF-alpha, TcdA or TcdB (for example via a different epitope to that of (a)), or alternatively may bind to another target altogether.
  • the different polypeptide (b) binds to, for example, another pro inflammatory cytokine or chemokine or their respective receptors, other inflammatory mediators or immunologically relevant ligands involved in human pathological processes.
  • Constructs can be multivalent and/or multispecific.
  • a multivalent construct (such as a bivalent construct) comprises two or more binding polypeptides therefore presents two or more sites at which attachment to one or more antigens can occur.
  • An example of a multivalent construct could be a homobihead or a heterobihead.
  • a multispecific construct (such as a bispecific construct) comprises two or more different binding polypeptides which present two or more sites at which either (a) attachment to two or more different antigens can occur or (b) attachment to two or more different epitopes on the same antigen can occur.
  • An example of a multispecific construct could be a heterobihead.
  • a multispecific construct is multivalent.
  • the polypeptides comprised within the construct are antibody fragments. More suitably, the polypeptides comprised within the construct are selected from the list consisting of: a VHH, a VH, a VL, a V-NAR, scFv, a Fab fragment or a F(ab′)2 fragment. More suitably, the polypeptides comprised within the construct are VHHs.
  • the polypeptides of the invention can be linked to each other directly (i.e. without use of a linker) or via a linker.
  • the linker is suitably a polypeptide and will be selected so as to allow binding of the polypeptides to their epitopes. If used for therapeutic purposes, the linker is suitably non-immunogenic in the subject to which the polypeptides are administered.
  • the polypeptides are all connected by linkers.
  • the linker is of the format (G 4 S) x . Most suitably ⁇ is 6.
  • the polypeptide of the invention is for use as a medicament, delivered by oral administration, suitably for use in the treatment or prevention of diseases of the gastrointestinal tract (see supra).
  • the polypeptide of the invention or the polypeptide of the methods of the invention may also be used in the treatment or prevention of other medical conditions by oral administration such as metabolic disorders, such as obesity.
  • the polypeptide of the invention is intended to have local effect in the intestinal tract.
  • the polypeptide of the invention or the polypeptide of the methods of the invention is not for use in the treatment or prevention of diseases by delivery into the circulation in therapeutically effective quantities.
  • a method of treating diseases of the gastrointestinal tract comprising administering to a person in need thereof a therapeutically effective amount of the inventive polypeptide.
  • a therapeutically effective amount of a polypeptide is an amount which is effective, upon single or multiple dose administration to a subject, in neutralising the biological effects of a chosen target to a significant extent in a subject.
  • a therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the polypeptide to elicit a desired response in the individual.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the polypeptide are outweighed by the therapeutically beneficial effects.
  • the polypeptide of the invention can be incorporated into pharmaceutical compositions suitable for oral administration to a subject.
  • the polypeptide of the invention can be in the form of a pharmaceutically acceptable salt.
  • composition comprising a polypeptide of the invention and one or more pharmaceutically acceptable diluents or carriers.
  • a pharmaceutical composition of the invention may be formulated for oral delivery.
  • the pharmaceutical compositions of the invention may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions, dispersions or suspensions, tablets, pills and powders. Solid dosage forms are preferred.
  • the pharmaceutical composition may comprise a pharmaceutically acceptable excipient, and suitably may be used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
  • the composition of the invention or pharmaceutical composition of the invention comprises a polypeptide of the invention and a pharmaceutically acceptable excipient such as a carrier.
  • pharmaceutically acceptable carriers include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof.
  • Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the polypeptide of the invention.
  • compositions may include antiadherents, binders, coatings, disintegrants, flavours, colours, lubricants, sorbents, preservatives, sweeteners, freeze dry excipients (including lyoprotectants) or compression aids.
  • the polypeptide of the invention is lyophilised before being incorporated into a pharmaceutical composition.
  • a polypeptide of the invention may also be provided with an enteric coating.
  • An enteric coating is a polymer barrier applied on oral medication which protects the polypeptide from the low pH of the stomach.
  • Materials used for enteric coatings include fatty acids, waxes, shellac, plastics, and plant fibers.
  • Suitable enteric coating components include methyl acrylate-methacrylic acid copolymers, cellulose acetate succinate, hydroxy propyl methyl cellulose phthalate, hydroxy propyl methyl cellulose acetate succinate (hypromellose acetate succinate), polyvinyl acetate phthalate (PVAP), methyl methacrylate-methacrylic acid copolymers, sodium alginate and stearic acid.
  • Suitable enteric coatings include pH-dependent release polymers. These are polymers which are insoluble at the highly acidic pH found in the stomach, but which dissolve rapidly at a less acidic pH. Thus, suitably, the enteric coating will not dissolve in the acidic juices of the stomach (pH ⁇ 3), but will do so in the higher pH environment present in the small intestine (pH above 6) or in the colon (pH above 7.0).
  • the pH-dependent release polymer is selected such that the polypeptide of the invention will be released at about the time that the dosage reaches the target region of the intestinal tract.
  • the composition of the invention may be formulated in a buffer, in order to stabilise the pH of the composition, at a concentration between 5-50, or more suitably 15-40 or more suitably 25-30 g/litre.
  • suitable buffer components include physiological salts such as sodium citrate and/or citric acid.
  • physiological salts such as sodium citrate and/or citric acid.
  • buffers contain 100-200, more suitably 125-175 mM physiological salts such as sodium chloride.
  • the buffer is selected to have a pKa close to the pH of the composition or the physiological pH of the patient.
  • Exemplary polypeptide concentrations in a pharmaceutical composition may range from about 10 ng/mL to about 200 mg/mL, such as about 50 ng/mL to about 100 mg/mL, such as about 1 ug/mL to about 80 mg/mL, such as about 10 ⁇ g/mL to about 50 mg/mL, such as about 50 ug/mL to about 30 mg/mL, such as about 100 ug/mL to about 20 mg/mL, or about 1 mg/mL to about 200 mg/ml or from about 50 mg/mL to about 200 mg/mL, or from about 150 mg/mL to about 200 mg/mL.
  • An aqueous formulation of the polypeptide of the invention may be prepared in a pH-buffered solution, e.g., at pH ranging from about 4.0 to about 7.0, or from about 5.0 to about 6.0, or alternatively about 5.5.
  • suitable buffers include phosphate-, histidine-, citrate-, succinate-, acetate-buffers and other organic acid buffers.
  • the buffer concentration can be from about 1 mM to about 100 mM, or from about 5 mM to about 50 mM, depending, for example, on the buffer and the desired tonicity of the formulation.
  • the tonicity of the pharmaceutical composition may be altered by including a tonicity modifier.
  • Such tonicity modifiers can be charged or uncharged chemical species.
  • Typical uncharged tonicity modifiers include sugars or sugar alcohols or other polyols, preferably trehalose, sucrose, mannitol, glycerol, 1,2-propanediol, raffinose, sorbitol or lactitol (especially trehalose, mannitol, glycerol or 1,2-propanediol).
  • Typical charged tonicity modifiers include salts such as a combination of sodium, potassium or calcium ions, with chloride, sulfate, carbonate, sulfite, nitrate, lactate, succinate, acetate or maleate ions (especially sodium chloride or sodium sulphate); or amino acids such as arginine or histidine.
  • the aqueous formulation is isotonic, although hypertonic or hypotonic solutions may be suitable.
  • the term “isotonic” denotes a solution having the same tonicity as some other solution with which it is compared, such as physiological salt solution or serum.
  • Tonicity agents may be used in an amount of about 5 mM to about 350 mM, e.g., in an amount of 1 mM to 500 nM.
  • at least one isotonic agent is included in the composition.
  • a surfactant may also be added to the pharmaceutical composition to reduce aggregation of the formulated polypeptide and/or minimize the formation of particulates in the formulation and/or reduce adsorption.
  • exemplary surfactants include polyoxyethylensorbitan fatty acid esters (Tween), polyoxyethylene alkyl ethers (Brij), alkylphenylpolyoxyethylene ethers (Triton-X), polyoxyethylene-polyoxypropylene copolymer (Poloxamer, Pluronic), and sodium dodecyl sulfate (SDS).
  • suitable polyoxyethylenesorbitan-fatty acid esters are polysorbate 20, and polysorbate 80.
  • Exemplary concentrations of surfactant may range from about 0.001% to about 10% w/v.
  • a lyoprotectant may also be added in order to protect the polypeptide of the invention against destabilizing conditions during the lyophilization process.
  • known lyoprotectants include sugars (including glucose, sucrose, mannose and trehalose); polyols (including mannitol, sorbitol and glycerol); and amino acids (including alanine, glycine and glutamic acid). Lyoprotectants can be included in an amount of about 10 mM to 500 mM.
  • the dosage ranges for administration of the pharmaceutical composition of the invention are those to produce the desired therapeutic effect.
  • the dosage range required depends on the precise nature of the pharmaceutical composition, the target region of the intestinal tract, the nature of the formulation, the age of the patient, the nature, extent or severity of the patient's condition, contraindications, if any, and the judgement of the attending physician. Variations in these dosage levels can be adjusted using standard empirical routines for optimisation.
  • the increased intestinal stability of a polypeptide of the invention means that a lower dose may be delivered orally than would otherwise need to be delivered orally in the case of a corresponding polypeptide not having histidine substitutions of the invention.
  • Suitable daily dosages of a polypeptide of the invention or pharmaceutical composition of the invention are in the range of 50 ng-50 mg per kg, such as 50 ug-40 mg per kg, such as 5-30 mg per kg of (e.g. human) body weight, such as less than 25, such as less than 20, such as less than 15, such as less than 10 mg, such as less than 50 ug, such as less than 50 ng per kg of body weight.
  • the unit dose will typically will be in the region of 250-2000 mg per dose, such as from less than 1000 mg, such as less than 700 mg, such as less than 400 mg, such as less than 100 mg, such as less than 100 ug, such as less than 50 ug, such as less than 10 ug, such as less than 100 ng, such as less than Song.
  • a dose may be administered daily or more frequently, for example 2, 3 or 4 times per day or less frequently for example every other day, once per week, once per fortnight or once per month.
  • Treatment of diseases also embraces treatment of exacerbations thereof and also embraces treatment of patients in remission from disease symptoms to prevent relapse of disease symptoms.
  • a pharmaceutical composition of the invention may also comprise one or more active agents (e.g. active agents suitable for treating diseases such as those mentioned herein). It is within the scope of the invention to use the pharmaceutical composition of the invention in therapeutic methods for the treatment of bacterial infection, autoimmune and/or inflammatory diseases as an adjunct to, or in conjunction with, other established therapies normally used in the treatment of bacterial, autoimmune and/or inflammatory diseases.
  • active agents e.g. active agents suitable for treating diseases such as those mentioned herein.
  • possible combinations include combinations with, for example, one or more active agents selected from the list comprising: 5-aminosalicylic acid, or a prodrug thereof (such as sulfasalazine, olsalazine or bisalazide); corticosteroids (e.g. prednisolone, methylprednisolone, or budesonide); immunosuppressants (e.g.
  • anti-TNF-alpha antibodies e.g., infliximab, adalimumab, certolizumab pegol or golimumab
  • anti-IL12/IL23 antibodies e.g., ustekinumab
  • anti-IL-6R antibodies or small molecule IL12/IL23 inhibitors e.g., apilimod
  • Anti-alpha-4-beta-7 antibodies e.g., vedolizumab
  • MAdCAM-1 blockers e.g., PF-00547659
  • antibodies against the cell adhesion molecule alpha-4-integrin e.g., natalizumab
  • antibodies against the IL2 receptor alpha subunit e.g., daclizumab or basiliximab
  • JAK3 inhibitors e.g., tofacitinib or R348
  • Syk inhibitors e.g., tofacitinib or R348
  • possible combinations include combinations with, for example, one or more active agents selected from the list comprising C. difficile toxoid vaccine, ampicillin, amoxicillin, vancomycin, metronidazole, fidaxomicin, linezolid, nitazoxanide, rifaximin, ramoplanin, difimicin, clindamycin, cephalosporins (such as second and third generation cephalosporins), fluoroquinolones (such as gatifloxacin or moxifloxacin), macrolides (such as erythromycin, clarithromycin, azithromycin), penicillins, aminoglycosides, trimethoprim-sulfamethoxazole, chloramphenicol, tetracycline, imipenem, meropenem, antibacterial agents, bactericides, or bacteriostats. Possible combinations also include combinations with one or more active agents which are
  • compositions of the invention in combination with one or more further active agents, for example one or more active agents described above.
  • pharmaceutical composition or polypeptide is administered sequentially, simultaneously or separately with at least one active agent selected from the list above.
  • each of components (A) and (B) is formulated in admixture with a pharmaceutically-acceptable adjuvant, diluent or carrier.
  • the combination product may be either a single (combination) formulation or a kit-of-parts.
  • this aspect of the invention encompasses a combination formulation including a pharmaceutical composition of the present invention and another therapeutic agent, in admixture with a pharmaceutically acceptable adjuvant, diluent or carrier.
  • the invention also encompasses a kit of parts comprising components:
  • composition of the present invention in admixture with a pharmaceutically acceptable adjuvant, diluent or carrier;
  • a formulation including one or more other active agents in admixture with a pharmaceutically-acceptable adjuvant, diluent or carrier, which components (i) and (ii) are each provided in a form that is suitable for administration in conjunction with the other.
  • component (i) of the kit of parts is thus component (A) above in admixture with a pharmaceutically acceptable adjuvant, diluent or carrier.
  • component (ii) is component (B) above in admixture with a pharmaceutically acceptable adjuvant, diluent or carrier.
  • the one or more other active agents i.e. component (B) above
  • component (B) is more than one further active agent, these further active agents can be formulated with each other or formulated with component (A) or they may be formulated separately. In one embodiment component (B) is one other therapeutic agent. In another embodiment component (B) is two other therapeutic agents.
  • the combination product (either a combined preparation or kit-of-parts) of this aspect of the invention may be used in the treatment or prevention of an autoimmune disease (e.g. the autoimmune diseases mentioned herein).
  • vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • a plasmid which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
  • a viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian and yeast vectors). Other vectors (e.g.
  • non-episomal mammalian vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • certain vectors are capable of directing the expression of genes to which they are operatively linked.
  • Such vectors are referred to herein as “recombinant expression vectors” (or simply, “expression vectors”).
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
  • the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g. replication defective retroviruses.
  • recombinant host cell (or simply “host cell”), as used herein, is intended to refer to a cell into which a recombinant expression vector has been introduced. Such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell.
  • a polynucleotide encoding a polypeptide of the invention.
  • a vector comprising the polynucleotide or cDNA comprising said polynucleotide.
  • a host cell transformed with said vector, which is capable of expressing the polypeptide of the invention.
  • the host cell is a mammalian cell, a plant cell, a yeast cell such as a yeast cell belonging to the genera Aspergillus, Saccharomyces, Kluyveromyces, Hansenula or Pichia, such as S. cerevisiae or P. Pastoris; or a bacterial cell such as E. coli.
  • Polypeptides of the invention can be obtained and manipulated using the techniques disclosed for example in Green and Sambrook 2012 Molecular Cloning: A Laboratory Manual 4 th Edition Cold Spring Harbour Laboratory Press.
  • substitutions made to the polypeptide of the invention, or substitutions made in the methods of the invention are introduced synthetically.
  • the substitutions are not introduced by V(D)J recombination or somatic mutation.
  • artificial gene synthesis may be used to produce a polypeptide according to the invention (Nambiar et al 1984 Science 223:1299-1301, Sakamar and Khorana 1988 Nucl. Acids Res 14:6361-6372, Wells et al 1985 Gene 34:315-323 and Grundstrom et al 1985 Nucl. Acids Res 13:3305-3316, herein incorporated by reference in their entirety).
  • a gene encoding a polypeptide of the invention can be synthetically produced by, for example, solid-phase DNA synthesis. Entire genes may be synthesized de novo, without the need for precursor template DNA.
  • the building blocks are sequentially coupled to the growing oligonucleotide chain in the order required by the sequence of the product.
  • the product is released from the solid phase to solution, deprotected, and collected. Products can be isolated by high-performance liquid chromatography (HPLC) to obtain the desired oligonucleotides in high purity (Verma and Eckstein 1998 Annu Rev Biochem 67:99-134).
  • the constructs of the invention may be fused genetically at the DNA level i.e. a polynucleotide construct which encodes the complete construct comprising one or more polypeptides.
  • One way of joining multiple polypeptides via the genetic route is by linking the polypeptide coding sequences via a labile peptide linker coding sequence.
  • the carboxy-terminal end of the first polypeptide may be linked to the amino-terminal end of the next polypeptide via a labile peptide linker coding sequence.
  • This linking mode can be extended in order to link polypeptides for the construction of tri-, tetra-, etc. functional constructs.
  • a method for producing multivalent (such as bivalent) VHH polypeptide constructs is disclosed in WO96/34103 (herein incorporated by reference in its entirety).
  • Mutations can be made to the DNA or cDNA that encode polypeptides which are silent as to the amino acid sequence of the polypeptide, but which provide preferred codons for translation in a particular host.
  • the preferred codons for translation of a nucleic acid in, e.g., E. coli and S. cerevisiae, are known.
  • Mutation of polypeptides can be achieved for example by substitutions, additions or deletions to a nucleic acid encoding the polypeptide.
  • a substitution is the replacement of a residue with a different residue in the same, corresponding location.
  • the substitutions, additions or deletions to a nucleic acid encoding the polypeptide can be introduced by many synthetic methods, including for example error-prone PCR, shuffling, oligonucleotide-directed mutagenesis, assembly PCR, PCR mutagenesis, in vivo mutagenesis, cassette mutagenesis, recursive ensemble mutagenesis, exponential ensemble mutagenesis, site-specific mutagenesis (Ling et al 1997 Anal Biochem 254(2):157-178, herein incorporated by reference in its entirety), gene reassembly, Gene Site Saturation Mutagenesis (GSSM), synthetic ligation reassembly (SLR) or a combination of these methods.
  • GSSM Gene Site Saturation Mut
  • the modifications, additions or deletions to a nucleic acid can also be introduced by a method comprising recombination, recursive sequence recombination, phosphothioate-modified DNA mutagenesis, uracil-containing template mutagenesis, gapped duplex mutagenesis, point mismatch repair mutagenesis, repair-deficient host strain mutagenesis, chemical mutagenesis, radiogenic mutagenesis, deletion mutagenesis, restriction-selection mutagenesis, restriction-purification mutagenesis, ensemble mutagenesis, chimeric nucleic acid multimer creation, or a combination thereof.
  • polypeptides comprising immunoglobulin chain variable domains such as VHs and VHHs can be achieved using a suitable expression vector such as a prokaryotic cell such as bacteria, for example E. coli (for example according to the protocols disclosed in WO94/04678 and WO96/34103, which are incorporated herein by reference).
  • a suitable expression vector such as a prokaryotic cell such as bacteria, for example E. coli (for example according to the protocols disclosed in WO94/04678 and WO96/34103, which are incorporated herein by reference).
  • Expression of immunoglobulin chain variable domains such as VHs and VHHs can also be achieved using eukaryotic cells, for example insect cells, CHO cells, Vero cells or suitably yeast cells such as yeasts belonging to the genera Aspergillus, Saccharomyces, Kuyveromyces, Hansenula or Pichia.
  • S. cerevisiae is used (for example according to the protocols disclosed in WO94/025591
  • a polypeptide of the invention can be produced in a fungus such as a yeast (for example, S. cerevisiae ) comprising growth of the fungus on a medium comprising a carbon source wherein 50-100 wt % of said carbon source is ethanol, according to the methods disclosed in WO02/48382.
  • a yeast for example, S. cerevisiae
  • a carbon source wherein 50-100 wt % of said carbon source is ethanol
  • polypeptide method of increasing the intestinal stability of a polypeptide or method of making a polypeptide according to any one of clauses 1 to 4, wherein the substitutions increase the stability of the polypeptide in a model of the intestinal tract, such as in the small and/or large intestine, such as in the duodenum, jejunum, ileum cecum, colon, rectum and/or anal canal, relative to a corresponding polypeptide not having said histidine substitutions.
  • the intestinal stability and potency of a polypeptide comprising an immunoglobulin chain variable domain can be assayed using the following methods.
  • the methods below refer to
  • ICVDs are equally applicable to any polypeptide which comprises an ICVD, such as an antibody.
  • Ex vivo samples from human faeces and mouse small intestine samples are highly relevant matrices for estimation of stability in the human intestinal tract.
  • Such samples contain native host-produced, and associated microbial-produced, proteases along with any chaotropic agents or surfactants that may influence ICVD stability in the presence of proteases.
  • the enzymatic cleavage sites of at least some proteases present in the small intestine from murine and human origin are well characterised and conserved between the two species.
  • Murine small intestinal supernatants were found to be a particularly stringent challenge in terms of total protease activity by comparison to small intestinal samples from pigs and clinically-derived human lavage samples of the small intestine.
  • the intestinal tract models detailed below which utilise ex vivo samples from human faeces and mouse small intestine, therefore allow one to assay the stability of a polypeptide comprising an ICVD in an environment which is highly representative of the conditions of the intestinal tract.
  • the percentage of viable ICVD remaining after incubation is assessed after incubation in an intestinal tract model using an appropriate assay such as the Standard Western Blot Stability Assay (for assaying proportions of intact ICVD) or the Standard TNFR2/TNF Interference ELISA Assay or Standard Toxin ELISA Assay (both for assaying proportions of functional ICVD).
  • 1 ⁇ PBS is added to faecal samples at a ratio of 1 or 2 mLs 1 ⁇ PBS per gram of faeces.
  • the samples are then vortexed to homogeneity.
  • the resulting material is referred to as a faecal slurry (in the case of a very limited number of particularly firm samples used in the examples below, it was necessary to add 3 mLs 1 ⁇ PBS per gram faeces in order to generate a homogenous faecal slurry).
  • slurries are centrifuged at 4.5 k rpm or 13.5 k rpm (4° C.) for 1-5 minutes to remove the bulk of the solid material and all cellular material.
  • the supernatant from the first spin is then re-centrifuged at 13.5 k rpm (4° C.) for 5 minutes, leaving only the soluble fraction, including proteases.
  • Supernatants from multiple individuals are pooled together such that each pool represents the combined protease output from the faeces of multiple individuals.
  • ICVD (or antibody) solutions at 250 ⁇ g/mL in 0.1% BSA.
  • dilute the 250 ⁇ g/mL ICVD into the supernatant matrix to give a final ICVD concentration (at time zero) of 20 ⁇ g/mL.
  • Once homogenous immediately remove one volume of the sample matrix plus 20 ⁇ g/mL ICVD and mix with an equal volume of 2 ⁇ protease stop solution. Mix the stopped matrix solution on ice and immediately freeze at ⁇ 80 degrees C. This is the time zero sample. Incubate the remaining test matrix sample plus 20 ⁇ g/mL ICVD at 37 degrees C.
  • the Standard TNFR2/TNF Interference ELISA Assay or the Standard Toxin ELISA Assay the amount of viable ICVD remaining after incubation in a matrix sample at a given timepoint is divided by the amount present at the zero timepoint. The resulting figure is then multiplied by 100 to give % stability. In the case of the Standard Western Blot Stability Assay, this provides proportion of intact ICVD. In the case of the Standard TNFR2/TNF Interference ELISA Assay or the Standard Toxin ELISA Assay, this provides the proportion of functional ICVD.
  • mice C57BL/6 (‘black 6’) mice are sacrificed.
  • the small intestine including the full duodenum, jejunum and ileum are excised from the body cavity of mice carefully so as to minimise unnecessary tissue damage.
  • the solid contents of the small intestine are collected and the internal surface of the small intestine flushed with 1 mL 0.9% saline (to preserve the native pH of the intestinal contents).
  • the 1 mL intestinal washout solution and intestinal contents samples are then mixed together and homogenised fully by vortexing to generate a small intestinal slurry.
  • slurries are centrifuged at 13.5 k rpm (4° C.) for 2 minutes to remove the bulk of the solid material and all cellular material.
  • the supernatant from the first spin are then re-centrifuged at 13.5 k rpm (4° C.) for 5 minutes, leaving only the soluble fraction, including proteases.
  • Supernatants from multiple mice (5 on average per pool) are mixed together such that each pool represents the combined protease output from the small intestine of multiple mice.
  • the supernatants are used in the same manner as described above under The Standard Human Faecal Supernatant Intestinal Tract Model under ‘Performing the Assay’.
  • ICVD from the stopped zero timepoint Match the volume of sample from the 30 minute timepoint to the volume added for the zero timepoint, so that any loss/degradation of ICVD over time is evident by eye on the final blot (the same applies for other timepoints such as 15 minute, 1 hour, 2 hour, etc, which may also be used). If possible, include un-treated standards of the test ICVD (at 100 and 10 ng) to confirm that the transfer and detection systems are performing correctly.
  • the amount of viable ICVD in a matrix sample at a given timepoint is divided by the amount present at the zero timepoint. The resulting figure is then multiplied by 100 to give % stability.
  • Block buffer plus 2 ⁇ Protease inhibitor is used as the assay diluent to prepare ICVD solutions prior to addition to the ELISA plate, when the ICVD sample is present in a digestive matrix such as mouse small intestinal supernatant or human faecal supernatant that may otherwise interfere with the performance of the ELISA.
  • a digestive matrix such as mouse small intestinal supernatant or human faecal supernatant that may otherwise interfere with the performance of the ELISA.
  • 1/200 dilution of 0.1 M PMSF solution Sigma 93482 can be used to achieve 0.5 mM PMSF.
  • EDTA must also be added to a final concentration of 2.5 mM.
  • Sigmafast protease Inhibitor cocktail (Sigma S8830, contains AEBSF (4-(2-Aminoethyl) benzenesulfonyl fluoride, Bestatin, E-64, Pepstatin A, Phosphoramidon, Leupeptin, Aprotinin) is used in this buffer.
  • a stock of 20 ⁇ protease inhibitor solution can be made by adding 1 tab of Sigmafast Protease Inhibitor Cocktail (Sigma S8830) to 5 mL protease stop buffer (1 ⁇ PBS, 2% BSA, 5 mM EDTA). This solution may be stored for 2 weeks at 2-8° C. and diluted into block buffer on the day of the ELISA.
  • This assay is designed to test anti-TcdA specific ICVDs for their ability to bind to Clostridium difficile toxin A bound to an ELISA plate.
  • the plate coating toxin for this assay is full-length TcdA VP110463 (087).
  • This assay is designed to test anti-TcdB specific ICVDs for their ability to bind to Clostridium difficile TcdB Cell Binding Domain (CBD-B) bound to an ELISA plate. It is critical to check before running this assay that the ICVD being tested does not bind elsewhere on TcdB, otherwise no signal will be observed.
  • CBD-B Clostridium difficile TcdB Cell Binding Domain
  • an assay blank (no ICVD).
  • ELISAs include a protease inhibitor -stopped time zero matrix control (containing no ICVD) to check for background signal in the assay. This should be diluted in Block buffer plus 2 ⁇ protease inhibitor and should match the top concentration of matrix that contains an ICVD sample tested on the plate. Keep samples chilled during preparation if they are prepared from a digestive matrix. Prepare enough of each sample to add to the plate in triplicate at 50 ⁇ L/well
  • This assay detects binding of recombinant human TNF to the fusion protein, Enbrel (etanercept).
  • This protein is comprised of soluble TNRF2 bound to the Fc region of human IgG, and can be used for capture of TNF ⁇ . This interaction can be competed for by anti-TNF ICVDs, causing reduced binding of TNF ⁇ to Enbrel. Bound TNF is then detected by an anti-hTNF ⁇ antibody. Therefore, high signal in this ELISA represents a low concentration of anti-TNF ICVD, and vice versa. Due to an overnight incubation step with the primary detection antibody, this assay usually takes approximately one and a half days to complete.
  • Block buffer plus 2 ⁇ Protease inhibitor is used as the assay diluent to prepare ICVD and TNF solutions, prior to mixing and addition to the ELISA plate, when the ICVD sample is present in a digestive matrix such as mouse small intestinal supernatant or human faecal supernatant that may otherwise interfere with the performance of the ELISA.
  • a digestive matrix such as mouse small intestinal supernatant or human faecal supernatant that may otherwise interfere with the performance of the ELISA.
  • 1/200 dilution of 0.1 M PMSF solution Sigma 93482 can be used to achieve 0.5 mM PMSF.
  • EDTA must also be added to a final concentration of 2.5 mM.
  • Sigmafast protease Inhibitor cocktail (Sigma S8830, contains AEBSF (4-(2-Aminoethyl) benzenesulfonyl fluoride, Bestatin, E-64, Pepstatin A, Phosphoramidon, Leupeptin, Aprotinin) is used in this buffer.
  • a stock of 20 ⁇ protease inhibitor solution can be made by adding 1 tab of Sigmafast Protease Inhibitor Cocktail (Sigma S8830) to 5 mL protease stop buffer (1 ⁇ PBS, 2% BSA, 5 mM EDTA). This solution may be stored for 2 weeks at 2-8° C. and diluted into block buffer on the day of the ELISA.
  • Step 6 equal volumes of diluted ICVD and TNF ⁇ are mixed before addition to the ELISA plate.
  • This step effectively dilutes by twofold the concentrations of ICVD and TNF ⁇ . Therefore, the final concentration of TNF ⁇ on the plate will be 2.5 ng/ml and the final concentration of the ICVD standard curve will be from 0.02 nM to 5 nM.
  • This dilution should be accounted for when estimating appropriate sample dilution factors.
  • the TMB substrate reaction may progress quickly. The colour of the plate should be checked periodically, and if a very bright blue colour appears before 30 mins, the reaction should be stopped since very high absorbance can lead to high background. Appropriate controls should include triplicate wells of: BSA only, no ICVD (i.e.
  • TNF ⁇ 2.5 ng/ml TNF ⁇ only
  • no TNF ⁇ i.e. 5 nM ICVD only
  • a no-ICVD matrix sample that has been stopped by the addition of 2 ⁇ protease stop solution should be added to TNF.
  • the lowest dilution (or highest concentration) of the background matrix in the control should match the lowest dilution (or highest concentration) of digestive matrix in the highest ICVD concentration mixed with TNF/applied to the plate.
  • Routine subculture of Vero cells can be achieved as follows:
  • plates should be prepared the day before use in the cytotoxicity assay. However, plates may also be prepared on the day of use if necessary. If the latter is the case, prepare plates in the morning (for use in the afternoon) and ensure that at least 3 hours are allowed for cell attachment to the microplate prior to use. A fully confluent flask of Vero cells should be used to make the cell suspension for plating.
  • the appropriate concentration of toxin to use should be determined beforehand by conducting a toxin dose-response experiment on Vero cells. Prepare 10 serial dilutions of toxin in a 12 well dilution trough. Use the remaining two wells for 0.01% Triton and a medium only control. Prepare a minimum of 330 ⁇ L of each solution in the dilution trough (this allows three replicates at 100 ⁇ l each). If there is no indication of how potent the toxin preparation is in advance, choose a broad dilution range for the preliminary experiment. This can be repeated over a finer concentration range, if necessary. Apply these solutions to Vero cells in a flat-bottomed microplate, incubate and process the plate as described above.
  • an ICVD, or full antibody, for neutralisating activity against a given concentration of toxin the minimum concentration of each toxin preparation capable of inducing the maximum reduction in cell viability is selected.
  • An exemplary toxin dose-response curve on Vero cells is provided in FIG. 1 .
  • the horizontal bar indicates toxin concentrations suitable for use in the main neutralisation assay.
  • the objective of this assay is to measure the potency of anti-IL-6R ICVDs by measuring interference in the binding to gp130 of a sIL-6/IL-6R complex.
  • This assay detects binding of hIL-6R/hIL-6 complexes to recombinant human gp130. This interaction can be competitively inhibited by anti-IL-6R ICVDs, causing reduced binding of hIL-6R-hIL-6 complexes to gp130. Therefore, high signal in this ELISA represents a low concentration of anti-IL-6R ICVD, and vice versa.
  • Block buffer 1% BSA in 1 ⁇ PBS, pH 7.3-7.5
  • Biotinylated goat anti-IL-6R polyclonal antibody (R&D systems BAF227); resuspended at 250 ug/ml in sterile PBS.
  • TMB substrate Microwell Peroxidase substrate System 2-C, KPL, 50-70-00
  • the objective of this assay is to measure the remaining concentration of active anti-IL-6R ICVDs which have previously been incubated in the presence of proteolytic material, such as mouse small intestinal supernatant or human faecal extract, thereby elucidating the impact on the ICVD of any proteolysis which may have taken place during incubation and therefore the proteolytic stability of the anti-IL-6R ICVDs.
  • proteolytic material such as mouse small intestinal supernatant or human faecal extract
  • high signal in this ELISA represents a low concentration or low affinity of anti-IL-6R ICVD remaining active, and vice versa.
  • the % survival is the percentage concentration of active ICVD, interpolated using the standard curve, maintained between a sample before and after digestion.
  • Block buffer 1% BSA in 1 ⁇ PBS, pH 7.3-7.5
  • Biotinylated goat anti-IL-6R polyclonal antibody (R&D systems BAF227); resuspended at 250 ug/ml in sterile PBS.
  • TMB substrate Microwell Peroxidase substrate System 2-C, KPL, 50-70-00
  • Q65B1 is an anti-TNF-alpha ICVD isolated, cloned and purified from a llama immunised with soluble human recombinant TNF-alpha. Residue K59 of the Q65B1 polypeptide sequence was substituted with alanine, histidine or glutamine and the impact of each substitution on intestinal tract stability and potency was tested.
  • DNA encoding each ICVD was cloned into vector pMEK222, expressed, and purified from the periplasm of E. coli (either by Talon or Nickel NTA column). All ICVDs tested here carry an identical C-terminal Flag-His6 tag.
  • Residue K59 resides in CDR2 of Q65B1.
  • Q65B1 with a K59A substitution is labelled “ID43F”
  • Q65B1 with a K59H substitution is labelled “ID8F-EV”
  • Q65B1 with a K59Q substitution is labelled “ID44F”.
  • Dose-response curves of each ICVD were generated using the Standard TNFR2/TNF Interference ELISA Assay, which were used to generate EC50 values ( FIG. 2A and Table 3).
  • ICVDs were digested in mouse small intestinal material for 6 hours according to the Standard Mouse Small Intestinal Supernatant Intestinal Tract Model. Percentage stability of ICVDs was calculated using the Standard TNFR2/TNF Interference ELISA Assay. The results are shown in FIG. 3A .
  • Q65B1 and ID8F-EV were digested in mouse small intestinal material for 16 hours according to the Standard Mouse Small Intestinal Supernatant Intestinal Tract Model. Percentage stability of ICVDs were calculated using the Standard TNFR2/TNF Interference ELISA Assay. The results are shown on the right hand side of FIG. 3B .
  • Q65B1 and ID8F-EV were digested for 16 hours in human faecal supernatant according to the the Standard Human Faecal Supernatant Intestinal Tract Model. Percentage stability of ICVDs were calculated using the Standard TNFR2/TNF Interference ELISA Assay. The results are shown on the left hand side of FIG. 3B .
  • K59A and K59Q reduced potency compared to K59 and K59H (see FIG. 2A , ID43F and ID44F vs Q65B1 and ID8F-EV, respectively). It can be seen from FIGS. 2A and 2B that any observed variation in the potency of ID8F-EV (K59H) relative to Q65B1 (K59) may be down to experimental variation and that these ICVDs have substantially the same potency.
  • K59A and K59Q reduced stability in mouse small intestinal material after 6 hours incubation, compared to K59 (see FIG. 3A , ID43F and ID44F vs Q65B1, respectively) and compared to K59H (see FIG. 3A , ID8F-EV).
  • K59H increased stability in mouse small intestinal material after 6 hours incubation and after 16 hours incubation, compared to K59 (see FIG. 3A and FIG. 3B , ID8F-EV vs Q65B1).
  • ID8F-EV and Q65B1 were undifferentiated in stability after 16 hours incubation in this human faecal supernatant assay ( FIG. 3B ).
  • ID34F DNA encoding ID34F was cloned and expressed in yeast.
  • Dose-response curves of each ICVD were generated using the Standard TNFR2/TNF Interference ELISA Assay. A concentration range of 0-3 nM was used ( FIG. 4 ).
  • ICVDs were digested for 16 hours in mouse small intestinal material according to the Standard Mouse Small Intestinal Supernatant Intestinal Tract Model. Percentage stability of ICVDs was calculated using the Standard TNFR2/TNF Interference ELISA Assay. The results are shown in FIG. 5A .
  • ICVDs were digested for 16 hours in human faecal supernatant according to the Standard Human Faecal Supernatant Intestinal Tract Model. Percentage stability of ICVDs was calculated using the Standard TNFR2/TNF Interference ELISA Assay. The results are shown in FIG. 5B .
  • ID45B is a modified anti-TcdB ICVD derived from a progenitor ICVD (Q31B1).
  • Q31B1 was isolated, cloned and purified from a llama immunised with TcdB toxoids prepared by formalin inactivation of purified TcdB.
  • Residue R107 of the ID45B polypeptide sequence was substituted with alanine, histidine, glutamine, phenylalanine or tryptophan and the impact of each substitution on intestinal stability and potency was tested.
  • DNA encoding each ICVD was cloned into vector pMEK222, expressed, and purified from the periplasm of E. coli (either by Talon or Nickel NTA column). All ICVDs tested here carry an identical C-terminal Flag-His6 tag.
  • Residue R107 resides in CDR3 of ID45B.
  • the substituted ICVDs were labelled according to Table 4.
  • Dose-response curves of each ICVD were generated using the Vero Cell Cytotoxicity Standard Assay ( FIG. 6A ).
  • ICVDs were digested for 30 minutes in human faecal supernatant pool 4 according to the Standard Human Faecal Supernatant Intestinal Tract Model. Percentage survival of ICVDs was calculated using the Standard Western Blot Stability Assay. The results are shown in FIG. 6B .
  • R107H Whilst both R107H and R107F substitutions resulted in a similar minor potency reduction, R107H resulted in the highest intestinal stability increase of all substitutions tested (see FIG. 6B , ID46B—an approximate 35% increase in recovery compared to 0 mins, compared to ID45B R107). The R107F substitution, in contrast, resulted in an approximate 10% decrease compared to R107 ( FIG. 6B , ID49B).
  • R107H provided the largest increase in stability, with only a minor impact on potency.
  • ID2B is a modified anti-TcdB ICVD derived from a progenitor ICVD (Q31B1). Residues R53 and R56 in CDR2 of the ID2B polypeptide sequence were both substituted with histidine residues (making “ID20B”). Independently, residues R107 and R109 in CDR3 of the ID2B polypeptide sequence were each substituted with a histidine residue (the sole R107H substitution making “ID21B” and the sole R109H substitution making “ID22B”). These ICVDs are summarised in Table 5. The impact of these substitutions on trypsin stability, intestinal stability and potency was tested.
  • DNA encoding ID2B was cloned into vector pMEK222, expressed, and purified from the periplasm of E. coli.
  • ID2B carries a C-terminal Flag-His6 tag.
  • DNA encoding ID20B, ID21B and ID22B was cloned and expressed in yeast.
  • Dose-response curves of each ICVD were generated using TcdB from the 027 C. difficile ribotype in the Vero Cell Cytotoxicity Standard Assay ( FIG. 7 ).
  • the ICVDs were assayed for trypsin stability.
  • a buffered (10 mM acetic acid, pH 3.2, containing 0.01% thimerosal) aqueous suspension of TPCK-treated Trypsin-agarose beads (trypsin from bovine pancreas; T4019; Sigma Aldrich) is used for the assay.
  • the beads are washed 3 times with water (250 ⁇ l beads+1.25 ml water) followed by washing 5 times with Trypsin buffer (TRYP buffer; 1 mM Tris-HCl, 20 mM CaCl2 [pH 8.0]).
  • TRYP buffer 1 mM Tris-HCl, 20 mM CaCl2 [pH 8.0]
  • ID2B and ID21B were digested for 1 hour in Faecal Pools 3 and 4 ( FIG. 9 ) according to the Standard Human Faecal Supernatant Intestinal Tract Model. Percentage stability of ICVDs was calculated using the Standard Toxin ELISA Assay.
  • the faecal supernatant stability of ID21B was substantially increased in both pool 3 ( C. diff positive patient faeces) and pool 4 ( C. diff negative patent faeces) compared to unsubstituted ID2B ( FIG. 9 ).
  • ID1B is a modified anti-TcdB ICVD derived from a progenitor ICVD (B10F1).
  • B10F1 was isolated, cloned and purified from a llama immunised with 100 ug of TcdB toxoids prepared by formalin inactivation of purified TcdB.
  • Residue R58 in CDR2 of the ID1B polypeptide sequence was substituted with a histidine residue (making “ID24B”).
  • residues R105 and R108 in CDR3 of the ID1B polypeptide sequence were each substituted with a histidine residue (the R105H substitution making “ID27B” and the R108H substitution making “ID25B”).
  • ICVDs are summarised in Table 6. The impact of these substitutions on intestinal stability and potency was tested.
  • DNA encoding ID1B, ID24B, ID25B and ID27B was cloned and expressed in yeast.
  • Dose-response curves of each ICVD were generated using TcdB from the 027 C. difficile ribotype in the Vero Cell Cytotoxicity Standard Assay ( FIG. 10A ).
  • ID1B, ID24B, ID25B and ID27B were digested for 1 hour in Faecal Pool 2 ( FIG. 10B ) according to the Standard Human Faecal Supernatant Intestinal Tract Model. Percentage survival of ICVDs was calculated using the Standard Toxin ELISA Assay.
  • the ICVDs were assayed for trypsin stability, in the manner described in Example 5 above ( FIGS. 11A-C ).
  • the density of the main band in the ID1B gel appears to reduce to a greater extent over the time periods tested than that of the substituted ICVDs ( FIGS. 11B-11C ) and therefore the substituted ICVDs appear to be more stable than unsubstituted ID1B in this trypsin assay.
  • FIG. 10B The faecal supernatant stability of all substituted ICVDs was increased ( FIG. 10B ).
  • the more central R105H CDR3 substitution ( FIG. 10B , ID27B) provided a greater faecal supernatant stability increase than the more peripheral R108H CDR3 substitution ( FIG. 10B , ID25B). This indicates that such substitutions may be more stabilising when made in a central ‘window’ of a CDR.
  • ID41B is an anti-TcdB bivalent construct consisting of modified versions of wild type ICVDs Q31B1 and B10F1.
  • An R108H (CDR3) substitution was made in the B10F1 arm of ID41B (making “ID43B”). The impact of this substitution on potency and intestinal stability was tested.
  • DNA encoding ID41B and ID43B was cloned and expressed in yeast.
  • Dose-response curves of each construct were generated using TcdB from the 017 C. difficile ribotype in the Vero Cell Cytotoxicity Standard Assay ( FIG. 12A ).
  • the R108H substitution (ID43B) had a very minor impact on potency ( FIG. 12A ). In the majority of faecal supernatant assays (six out of nine across all faecal pools), the R108H substitution in ID43B resulted in increased stability ( FIGS. 12B-12D ).
  • ID17A is an anti-TcdA bivalent construct consisting of modified versions of wild type ICVDs B4F10 and Q34A3 (B4F10 and Q34A3 were isolated, cloned and purified from a llama immunised with TcdA toxoids prepared by formalin inactivation of purified TcdA).
  • Dose-response curves of each construct were generated using TcdA in the Vero Cell Cytotoxicity Standard Assay ( FIG. 13A ).
  • 7F6 is an anti-IL-6R ICVD. 7F6 was isolated, cloned and purified from a llama immunised with soluble human recombinant IL-6R.
  • Residue R102 in CDR3 of the 7F6 polypeptide sequence was substituted with a histidine residue (making “ID-3V”) and the impact of this substitution on potency and intestinal stability was tested.
  • DNA encoding 7F6 and ID-3V was cloned and expressed in E. coli.
  • Dose-response curves were generated using the standard gp130 ELISA assay and these were used to generate EC 50 values (Table 7, graph not shown).
  • ICVDs were digested for 4 hours in mouse small intestinal material according to the Standard Mouse Small Intestinal Supernatant Intestinal Tract Model. Percentage stability of ICVDs was calculated using the Standard gp130 ELISA assay. The results are shown in Table 8.
  • ICVDs were digested for 16 hours in human faecal supernatant according to the Standard Human Faecal Supernatant Intestinal Tract Model. Percentage stability of ICVDs was calculated using the Standard gp130 ELISA assay. The results are shown in Table 9.
  • 5G9 is an anti-IL-6R ICVD. 5G9 was isolated, cloned and purified from a llama immunised with soluble human recombinant IL-6R.
  • Residue R105 in CDR3 of the 5G9 polypeptide sequence was substituted with a histidine residue (making “ID-54V”) and the impact of this substitution on potency and intestinal stability was tested.
  • DNA encoding 5G9 and ID-54V was cloned and expressed in E. coli.
  • Dose-response curves were generated using the standard gp130 ELISA assay and these were used to generate EC50 values (Table 10, graph not shown).
  • ICVDs were digested for 4 hours in mouse small intestinal material according to the Standard Mouse Small Intestinal Supernatant Intestinal Tract Model. Percentage stability of ICVDs was calculated using the Standard gp130 ELISA assay. The results are shown in Table 11.
  • ICVDs were digested for 16 hours in human faecal supernatant according to the Standard Human Faecal Supernatant Intestinal Tract Model. Percentage stability of ICVDs was calculated using the Standard gp130 ELISA assay. The results are shown in Table 12.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Transplantation (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
US15/717,230 2015-03-31 2017-09-27 Polypeptides Abandoned US20180009881A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/950,758 US12173054B2 (en) 2015-03-31 2020-11-17 Polypeptides

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
EP15162115.8 2015-03-31
EP15162115 2015-03-31
EP16152320 2016-01-21
EP16152320.4 2016-01-21
PCT/EP2016/057024 WO2016156468A1 (en) 2015-03-31 2016-03-31 Polypeptides

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2016/057024 Continuation WO2016156468A1 (en) 2015-03-31 2016-03-31 Polypeptides

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/950,758 Continuation US12173054B2 (en) 2015-03-31 2020-11-17 Polypeptides

Publications (1)

Publication Number Publication Date
US20180009881A1 true US20180009881A1 (en) 2018-01-11

Family

ID=55661405

Family Applications (2)

Application Number Title Priority Date Filing Date
US15/717,230 Abandoned US20180009881A1 (en) 2015-03-31 2017-09-27 Polypeptides
US16/950,758 Active 2038-02-18 US12173054B2 (en) 2015-03-31 2020-11-17 Polypeptides

Family Applications After (1)

Application Number Title Priority Date Filing Date
US16/950,758 Active 2038-02-18 US12173054B2 (en) 2015-03-31 2020-11-17 Polypeptides

Country Status (11)

Country Link
US (2) US20180009881A1 (https=)
EP (1) EP3277713B1 (https=)
JP (1) JP2018511346A (https=)
KR (1) KR20170132749A (https=)
CN (1) CN107438620A (https=)
AU (1) AU2016239951A1 (https=)
CA (1) CA2981103A1 (https=)
HK (1) HK1250040A1 (https=)
IL (1) IL254591B (https=)
SG (1) SG11201706882VA (https=)
WO (1) WO2016156468A1 (https=)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10633438B2 (en) 2015-03-31 2020-04-28 Vhsquared Limited Polypeptides
US10772839B2 (en) 2016-03-31 2020-09-15 Vhsquared Limited Compositions
US11623952B2 (en) 2019-06-21 2023-04-11 Sorriso Pharmaceuticals, Inc. IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides
US11667719B2 (en) 2019-06-21 2023-06-06 Sorriso Pharmaceuticals, Inc. VHH immunoglobulin chain variable domain that binds to IL-7R and methods of use thereof for treating autoimmune and/or inflammatory diseases
US11684677B2 (en) * 2016-09-30 2023-06-27 Sorriso Pharmaceuticals, Inc. Compositions
US12173054B2 (en) 2015-03-31 2024-12-24 Sorriso Pharmaceuticals, Inc. Polypeptides
US12234279B2 (en) 2015-03-31 2025-02-25 Sorriso Pharmaceuticals, Inc. Peptide construct having a protease-cleavable linker
US12570736B2 (en) 2019-06-21 2026-03-10 Sorriso Pharmaceuticals, Inc. Compositions

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP7190675B2 (ja) * 2018-08-23 2022-12-16 パナソニックIpマネジメント株式会社 ノロウイルスに結合する抗体、複合体、それを用いた検出装置及び検出方法
WO2020144164A1 (en) 2019-01-07 2020-07-16 Bactolife Aps Pathogen binding proteins
WO2021252549A1 (en) * 2020-06-09 2021-12-16 Inozyme Pharma, Inc. Soluble enpp1 or enpp3 proteins and uses thereof
DE102021107901A1 (de) 2021-03-29 2022-09-29 Andritz Küsters Gmbh Anlage und Verfahren zum Verfestigen von Fasern umfassenden Lagen zu einer Vliesbahn

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070020267A1 (en) * 2003-08-01 2007-01-25 Genentech, Inc. Anti-VEGF antibodies
US20110028695A1 (en) * 2007-11-27 2011-02-03 Hilde Adi Pierrette Revets Method for obtaining polypeptide constructs comprising two or more single domain antibodies
US20140044730A1 (en) * 2012-08-13 2014-02-13 Regeneron Pharmaceuticals, Inc. ANTI-PCSK9 ANTIBODIES WITH pH-DEPENDENT BINDING CHARACTERISTICS
US20150017183A1 (en) * 2011-12-20 2015-01-15 Adaerata, Limited Partnership Single domain antibodies as inhibitors of pcsk9
US20150147318A1 (en) * 2012-06-06 2015-05-28 Zoetis Llc Caninized anti-ngf antibodies and methods thereof
US9527925B2 (en) * 2011-04-01 2016-12-27 Boehringer Ingelheim International Gmbh Bispecific binding molecules binding to VEGF and ANG2

Family Cites Families (153)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3300077A (en) 1965-02-18 1967-01-24 Clinch Tite Corp Pallet enclosure
JP3443119B2 (ja) 1989-08-07 2003-09-02 ペプテック リミテッド 腫瘍壊死因子結合リガンド
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
DK0590060T3 (da) 1991-06-21 1998-05-11 Univ Cincinnati Oralt indgivelige terapeutiske proteiner samt fremgangsmåde til fremstilling
DK1621554T4 (da) 1992-08-21 2012-12-17 Univ Bruxelles Immunoglobuliner blottet for lette kæder
ES2162863T3 (es) 1993-04-29 2002-01-16 Unilever Nv Produccion de anticuerpos o fragmentos (funcionalizados) de los mismos derivados de inmunoglobulinas de cadena pesada de camelidae.
US5512459A (en) 1993-07-20 1996-04-30 Bionebraska, Inc. Enzymatic method for modification or recombinant polypeptides
DE69432309D1 (de) 1993-09-20 2003-04-24 Anadis Ltd Verfahren zur herstellung von immunoglobulinen aus colostrum und deren verwendung in pharmazeutischen zusammensetzungen
EP0739981A1 (en) 1995-04-25 1996-10-30 Vrije Universiteit Brussel Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
DK1027439T3 (da) 1997-10-27 2010-05-10 Bac Ip Bv Multivalente antigenbindende proteiner
EP0954978B1 (en) 1998-03-12 2011-11-30 VHsquared Limited New products comprising inactivated yeasts or moulds provided with active antibodies
ES2299244T3 (es) 1998-05-13 2008-05-16 Domantis Limited Sistema de exposicion de fagos para la seleccion de proteinas correctamente plegadas.
AUPP702498A0 (en) 1998-11-09 1998-12-03 Silverbrook Research Pty Ltd Image creation method and apparatus (ART77)
GB9909301D0 (en) 1999-04-22 1999-06-16 Kci Medical Ltd Wound treatment apparatus employing reduced pressure
UA81743C2 (uk) 2000-08-07 2008-02-11 Центокор, Инк. МОНОКЛОНАЛЬНЕ АНТИТІЛО ЛЮДИНИ, ЩО СПЕЦИФІЧНО ЗВ'ЯЗУЄТЬСЯ З ФАКТОРОМ НЕКРОЗУ ПУХЛИН АЛЬФА (ФНПα), ФАРМАЦЕВТИЧНА КОМПОЗИЦІЯ, ЩО ЙОГО МІСТИТЬ, ТА СПОСІБ ЛІКУВАННЯ РЕВМАТОЇДНОГО АРТРИТУ
CZ303983B6 (cs) 2000-12-13 2013-07-31 Unilever N. V. Zpusob výroby heterologního proteinu
CA2450793A1 (en) 2001-06-20 2002-12-27 Prochon Biotech Ltd. Antibodies that block receptor protein tyrosine kinase activation, methods of screening for and uses thereof
TWI334439B (en) 2001-08-01 2010-12-11 Centocor Inc Anti-tnf antibodies, compositions, methods and uses
JP2005289809A (ja) 2001-10-24 2005-10-20 Vlaams Interuniversitair Inst Voor Biotechnologie Vzw (Vib Vzw) 突然変異重鎖抗体
US9770517B2 (en) 2002-03-01 2017-09-26 Immunomedics, Inc. Anti-Trop-2 antibody-drug conjugates and uses thereof
US8658773B2 (en) 2011-05-02 2014-02-25 Immunomedics, Inc. Ultrafiltration concentration of allotype selected antibodies for small-volume administration
WO2004009776A2 (en) 2002-07-19 2004-01-29 Abbott Biotechnology Ltd. TREATMENT OF TNFα RELATED DISORDERS
MY150740A (en) 2002-10-24 2014-02-28 Abbvie Biotechnology Ltd Low dose methods for treating disorders in which tnf? activity is detrimental
EP1900753B1 (en) 2002-11-08 2017-08-09 Ablynx N.V. Method of administering therapeutic polypeptides, and polypeptides therefor
US20060034833A1 (en) 2002-11-08 2006-02-16 Els Beirnaert Single domain antibodies directed against interferron-gamma and uses therefor
US20060034845A1 (en) 2002-11-08 2006-02-16 Karen Silence Single domain antibodies directed against tumor necrosis factor alpha and uses therefor
WO2004041863A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Single domain antibodies directed against interferon- gamma and uses therefor
EP1558645B1 (en) 2002-11-08 2011-07-27 Ablynx N.V. Stabilized single domain antibodies in pharmaceutical composition adapted for inhalation
CA2817265A1 (en) 2003-04-11 2004-10-28 Medimmune, Llc Recombinant il-9 antibodies and uses thereof
SI2311873T1 (sl) * 2004-01-07 2018-12-31 Novartis Vaccines And Diagnostics, Inc. M-CSF-specifična monoklonska protitelesa in njihova uporaba
US8007827B2 (en) 2004-04-02 2011-08-30 Impax Laboratories, Inc. Pharmaceutical dosage forms having immediate release and/or controlled release properties
TW201705980A (zh) 2004-04-09 2017-02-16 艾伯維生物技術有限責任公司 用於治療TNFα相關失調症之多重可變劑量療法
CN1985064B (zh) 2004-07-14 2011-08-24 尤利乌斯·布卢姆有限公司 可旋转支承的操纵臂的操纵机构
BRPI0516681A (pt) 2004-11-25 2008-09-16 Unilever Nv sistema de entrega de anticorpos ao trato gastrointestinal, vetor de expressão, microorganismos transformados, método de entrega de anticorpos, imunoglobulinas de cadeia pesada e seu uso, produto alimentìcio e seu método de fabricação e utensìlio de distribuição
US7234616B2 (en) 2004-12-27 2007-06-26 Bel-Art Products, Inc. Friction arrangement for hosiery donning aid
WO2006071877A2 (en) 2004-12-27 2006-07-06 Progenics Pharmaceuticals (Nevada), Inc. Orally deliverable and anti-toxin antibodies and methods for making and using them
US8188223B2 (en) 2005-05-18 2012-05-29 Ablynx N.V. Serum albumin binding proteins
BRPI0611901A2 (pt) 2005-06-14 2012-08-28 Amgen, Inc composição, liofilizado, kit, e, processo para preparar uma composição
US20070042399A1 (en) 2005-06-23 2007-02-22 Imperial College Innovations Limited Biological materials and uses thereof
SI2452694T1 (sl) 2005-06-30 2019-05-31 Janssen Biotech, Inc. Protitelesa proti-IL-23, sestavki in postopki uporabe
ES2626610T3 (es) 2005-08-30 2017-07-25 Intrexon Actobiotics Nv Bacterias de ácido láctico productoras del anti-TNF alfa para el tratamiento de la enfermedad inflamatoria intestinal
PT1931710T (pt) 2005-08-31 2017-03-28 Merck Sharp & Dohme Anticorpos anti-il-23 manipulados
WO2007048022A2 (en) 2005-10-21 2007-04-26 Alexion Pharmaceuticals, Inc. Antibody-polypeptide fusion proteins and methods for producing and using same
CN101370832B (zh) * 2005-12-02 2014-07-02 健泰科生物技术公司 结合多肽及其用途
AU2006326867A1 (en) 2005-12-20 2007-06-28 Cephalon Australia Pty Ltd Chimeric antibodies with part New World primate binding regions
US20110059101A9 (en) 2006-03-13 2011-03-10 Ablynx N.V. Amino Acid Sequences Directed Against Il-6 And Polypetides Comprising The Same For The Treatment Of Diseases And Disorders Associated With Il-6 Mediated Signalling
CA2646508A1 (en) * 2006-03-17 2007-09-27 Biogen Idec Ma Inc. Stabilized polypeptide compositions
US20080026820A1 (en) 2006-07-05 2008-01-31 Aruze Gaming America, Inc. Slot machine and playing method thereof
US20080031770A1 (en) 2006-08-02 2008-02-07 Douglas Heselton Apparatus and method for using ozone as a disinfectant
WO2008020079A1 (en) 2006-08-18 2008-02-21 Ablynx N.V. Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling
MX2009002756A (es) 2006-09-12 2009-05-25 Cosmo Technologies Ltd Composiciones farmaceuticas para la administracion oral o rectal de sustancias proteinicas.
US20100129379A1 (en) 2006-09-25 2010-05-27 John Carpenter Stabilized antibody formulations and uses thereof
WO2008042067A2 (en) 2006-09-28 2008-04-10 Illumina, Inc. Compositions and methods for nucleotide sequencing
CA2667466A1 (en) 2006-10-27 2008-05-02 Ablynx N.V. Intranasal delivery of polypeptides and proteins
TW200823720A (en) 2006-11-27 2008-06-01 Asustek Comp Inc Portable computer
US20080145420A1 (en) 2006-12-13 2008-06-19 Simon Michael R HUMAN SECRETORY IgA FOR THE TREATMENT OF CLOSTRIDIUM DIFFICILE ASSOCIATED DISEASES
WO2008075356A2 (en) 2006-12-19 2008-06-26 Shay Bushinsky Interactive broadcast system and method
EP2102244A2 (en) 2006-12-19 2009-09-23 Ablynx N.V. Amino acid sequences directed against a metalloproteinase from the adam family and polypeptides comprising the same for the treatment of adam-related diseases and disorders
TWI317699B (en) 2006-12-25 2009-12-01 Ind Tech Res Inst Device and method for removing residues
US7459949B2 (en) 2007-01-30 2008-12-02 Mosaid Technologies Incorporated Phase detector circuit and method therefor
US20160031971A9 (en) 2007-02-20 2016-02-04 Tufts University Methods and compositions with a recombinant neutralizing binding protein for treating toxin exposure
US8246950B2 (en) 2007-02-20 2012-08-21 Aptalis Pharma Limited Stable digestive enzyme compositions
EP2121757A2 (en) 2007-02-21 2009-11-25 Ablynx N.V. Amino acid sequences directed against vascular endothelial growth factor and polypeptides comprising the same for the treatment of conditions and diseases characterized by excessive and/or pathological angiogenesis or neovascularization
ES2393814T3 (es) 2007-04-04 2012-12-28 Sigmoid Pharma Limited Una composición farmacéutica oral
US7807168B2 (en) 2007-04-10 2010-10-05 Vaccinex, Inc. Selection of human TNFα specific antibodies
EP2144930A1 (en) 2007-04-18 2010-01-20 ZymoGenetics, Inc. Single chain fc, methods of making and methods of treatment
US20080260820A1 (en) 2007-04-19 2008-10-23 Gilles Borrelly Oral dosage formulations of protease-resistant polypeptides
TW201531484A (zh) 2007-05-21 2015-08-16 Alder Biopharmaceuticals Inc 抗TNF-α之抗體及其用途
GB0724331D0 (en) * 2007-12-13 2008-01-23 Domantis Ltd Compositions for pulmonary delivery
CA2696263C (en) 2007-08-15 2017-06-13 Bing Liu Monospecific and multispecific antibodies and method of use
TWM333751U (en) 2007-09-07 2008-06-01 Jarllytec Co Ltd Supporting-type pivot structure
US20100239682A1 (en) 2007-09-17 2010-09-23 Antoine Andremont Colonic delivery of antimicrobial agents
EP2725035A1 (en) 2007-10-02 2014-04-30 Avaxia Biologics, Inc. Antibody therapy for use in the digestive tract
US20090149433A1 (en) 2007-11-13 2009-06-11 Meritage Pharma, Inc. Compositions for the treatment of inflammation of the gastrointestinal tract
EA019181B1 (ru) 2008-02-07 2014-01-30 Тотал Петрокемикалс Рисерч Фелюй Дегидратация спиртов в присутствии инертного компонента
KR102057826B1 (ko) 2008-04-11 2019-12-20 추가이 세이야쿠 가부시키가이샤 복수 분자의 항원에 반복 결합하는 항원 결합 분자
LT2285408T (lt) 2008-06-05 2019-01-25 Ablynx N.V. Aminorūgščių sekos, nukreiptos prieš viruso apvalkalo baltymus, ir tokias sekas turintys polipeptidai, skirti virusinių ligų gydymui
US20110112229A1 (en) 2008-08-14 2011-05-12 Nippon Paper Chemicals Co., Ltd. Dispersion resin composition, and paint composition, ink composition, adhesive composition and primer composition, containing the dispersion resin composition
GB0815264D0 (en) 2008-08-21 2008-09-24 Syntaxin Ltd Non-cytotoxic proteins
WO2010045506A2 (en) 2008-10-16 2010-04-22 Kathleen Cogan Farinas Sustained drug delivery system
WO2010043424A1 (en) 2008-10-17 2010-04-22 Friedrich Streffer A method for digesting a biomass comprising lignin together with cellulose and/or hemicellulose
BRPI0919879A2 (pt) 2008-10-29 2016-02-16 Wyeth Llc métodos para purificação de moléculas de ligação a antígeno de domínio único
CA2738243C (en) 2008-10-29 2020-09-29 Wyeth Llc Formulations of single domain antigen binding molecules
US8697654B2 (en) 2008-12-18 2014-04-15 E I Du Pont De Nemours And Company Peptide linkers for effective multivalent peptide binding
WO2010085643A1 (en) 2009-01-22 2010-07-29 University Of Miami Targeting il-7 signaling as a therapy for multiple sclerosis and other il-7 signaling dependent disorders
NZ595461A (en) 2009-04-10 2013-01-25 Ablynx Nv Improved amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of il-6r related diseases and disorders
US9056050B2 (en) 2009-04-13 2015-06-16 Curemark Llc Enzyme delivery systems and methods of preparation and use
CN101964403A (zh) 2009-07-23 2011-02-02 比克国际(天津)有限公司 一种电池组的封装方法及电池组
CN102090373A (zh) 2009-12-11 2011-06-15 中国医学科学院血液病医院(血液学研究所) 模拟人克隆氏病的小鼠结肠炎模型及其制备方法和用途
EP3603624A1 (en) 2009-12-24 2020-02-05 Rani Therapeutics, LLC Therapeutic agent preparations for delivery into a lumen of the intestinal tract using a swallowable drug delivery device
CL2010000019A1 (es) 2010-01-11 2010-06-11 Univ Chile Anticuerpo monoclonal contra el tnf humano y sus fragmentos, secuencias nucleotidicas que lo codifican, vector de expresion y celulas que las contienen, composiciones y kit que comprenden el anticuerpo, uso de los mismos y metodo para su obtencion.
PE20170687A1 (es) 2010-01-28 2017-06-13 Glaxo Group Ltd Proteinas de enlace a cd127
EP2533814A2 (en) 2010-02-11 2012-12-19 Ablynx N.V. Delivery of immunoglobulin variable domains and constructs thereof
AR080291A1 (es) 2010-02-24 2012-03-28 Rinat Neuroscience Corp Anticuerpos antagonistas anti receptor de il-7 y procedimientos
WO2011139629A2 (en) 2010-04-26 2011-11-10 Biogen Idec Ma Inc. Light targeting molecules and uses thereof
WO2011135040A1 (en) 2010-04-30 2011-11-03 F. Hoffmann-La Roche Ag Fluorescent antibody fusion protein, its production and use
WO2011135026A1 (en) 2010-04-30 2011-11-03 Ablynx Nv Amino acid sequences of nanobodies directed against p19 subunit of the heterodimeric cytokine il-23
EP2567433B1 (en) 2010-05-04 2016-06-29 Johnson Controls Technology Company Variable speed drive
CN103119062A (zh) 2010-07-16 2013-05-22 埃博灵克斯股份有限公司 修饰的单结构域抗原结合分子及其应用
EP2632949B1 (en) 2010-10-25 2017-09-13 National Research Council of Canada Clostridium difficile-specific antibodies and uses thereof
US9460623B2 (en) 2010-11-22 2016-10-04 International Business Machines Corporation Parking management
AR084210A1 (es) 2010-12-08 2013-05-02 Abbott Lab PROTEINAS DE UNION AL TNF-a
US8566574B2 (en) 2010-12-09 2013-10-22 International Business Machines Corporation Secure encrypted boot with simplified firmware update
US8634563B2 (en) 2010-12-17 2014-01-21 Microsoft Corporation Attribute based encryption using lattices
AU2012234282B2 (en) 2011-03-28 2015-07-16 Ablynx Nv Method for producing solid formulations comprising immunoglobulin single variable domains
MX2018012383A (es) 2011-03-30 2023-03-07 Chugai Pharmaceutical Co Ltd Método para alterar la retención en plasma e inmunogenicidad de la molécula de union al antígeno.
MX361242B (es) 2011-03-30 2018-11-30 Ablynx Nv Anticuerpos de dominio sencillo contra tnf-alfa y usos de los mismos.
SG10201805064SA (en) 2011-06-23 2018-07-30 Ablynx Nv Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains
PE20141522A1 (es) 2011-08-17 2014-11-17 Glaxo Group Ltd Proteinas y peptidos modificados
KR20140084201A (ko) 2011-10-19 2014-07-04 알렉시온 파마 홀딩 알칼리성 포스파타제 및/또는 나트륨이뇨 펩티드를 포함하는 조성물 및 그의 사용 방법
EP2583980A1 (en) 2011-10-19 2013-04-24 Effimune Antibodies directed against the alpha chain of IL7 receptor - their use for the preparation of drug candidates
GB2504139B (en) 2012-07-20 2014-12-31 Argen X Bv Antibodies to highly conserved targets produced by the immunisation of Camelidae species
DE102011121237A1 (de) 2011-12-14 2013-06-20 Universitätsklinikum Hamburg-Eppendorf Einzeldomänen-Antikörper gegen Clostridium difficile Toxin CDTa
DE102011121238A1 (de) 2011-12-14 2013-06-20 Universitätsklinikum Hamburg-Eppendorf Einzeldomänen-antikörper gegen clostridium difficile toxine
US8874636B2 (en) 2012-01-03 2014-10-28 Teletech Holdings, Inc. Method for providing support services using consumer selected specialist and specialist ratings
CU24120B1 (es) * 2012-03-01 2015-08-27 Ct De Inmunología Molecular Anticuerpos recombinantes con especificidad dual por los gangliósidos n-acetil gm3 y n-glicolil gm3
EP2849723B1 (en) 2012-05-18 2018-05-02 Genentech, Inc. High-concentration monoclonal antibody formulations
WO2014004746A2 (en) 2012-06-26 2014-01-03 Harvard Bioscience, Inc. Methods and compositions for promoting the structural integrity of scaffolds for tissue engineering
JP2014026709A (ja) 2012-07-30 2014-02-06 International Business Maschines Corporation ライブラリ・ストリング間でのカートリッジの移動方法、システム、及びプログラム
BR112015003851A2 (pt) 2012-08-21 2017-08-08 Glaxo Group Ltd composições compreendendo um domínio variável único e mesilato de camostato (cm)
CA2887682A1 (en) 2012-10-09 2014-04-17 Biogen Idec Ma Inc. Combination therapies and uses for treatment of demyelinating disorders
KR101911438B1 (ko) 2012-10-31 2018-10-24 삼성전자주식회사 이중 특이 항원 결합 단백질 복합체 및 이중 특이 항체의 제조 방법
US20140186365A1 (en) 2013-01-03 2014-07-03 Institute For Cancer Research D/B/A The Research Institute Of Fox Chase Cancer Center Antibodies that specifically bind to serum albumin without interfering with albumin's capability to interact with the fcrn
CN113005091A (zh) 2013-02-06 2021-06-22 细胞基因公司 具有改进特异性的修饰的t淋巴细胞
AU2014229282B2 (en) 2013-03-15 2017-02-02 Glaxosmithkline Intellectual Property (No.2) Limited Low concentration antibody formulations
WO2015009996A1 (en) 2013-07-19 2015-01-22 The Trustees Of The University Of Pennsylvania Compositions and methods for treating eosinophilic esophagitis
US20150058173A1 (en) 2013-08-20 2015-02-26 Sears Brands, Llc Sales promotion using product comparison
US20160228371A1 (en) 2013-10-18 2016-08-11 Abbvie Inc. Stable solid units and methods of making the same
US9416197B2 (en) 2013-11-01 2016-08-16 Ibc Pharmaceuticals, Inc. Bispecific antibodies that neutralize both TNF-α and IL-6: novel therapeutic agent for autoimmune disease
WO2015100409A2 (en) 2013-12-26 2015-07-02 Tufts University Methods, compositions and kits for treating a subject using a recombinant neutralizing binding protein
JP6832707B2 (ja) 2014-03-26 2021-02-24 セル メディカ スイッツァランド アーゲー TNFαに対する結合メンバー
US10220076B2 (en) 2014-05-15 2019-03-05 Incube Labs, Llc Pharmaceutical compositions and methods for fabrication of solid masses comprising glucose regulating proteins
EP2955196A1 (en) 2014-06-10 2015-12-16 Effimune Antibodies directed against CD127
EA202193002A2 (ru) 2014-09-03 2022-03-31 Бёрингер Ингельхайм Интернациональ Гмбх Соединение, нацеленное на ил-23a и фно-альфа, и его применение
US20160115247A1 (en) 2014-10-23 2016-04-28 Singh Biotechnology, Llc Single domain antibodies directed against intracellular antigens
EP3237000A1 (en) 2014-12-23 2017-11-01 Pfizer Inc Stable aqueous antibody formulation for anti tnf alpha antibodies
US20170260266A1 (en) 2015-03-11 2017-09-14 Glaxosmithkline Intellectual Property Development Limited Tslp binding proteins
WO2016156474A1 (en) 2015-03-31 2016-10-06 Vhsquared Limited Polypeptide comprising an immunoglobulin chain variable domain which binds to clostridium difficile toxin a
EP3277706A1 (en) 2015-03-31 2018-02-07 VHsquared Limited Polypeptide comprising an immunoglobulin chain variable domain which binds to clostridium difficile toxin b
WO2016156468A1 (en) 2015-03-31 2016-10-06 Vhsquared Limited Polypeptides
SG11201706840WA (en) 2015-03-31 2017-09-28 Vhsquared Ltd Peptide construct having a protease-cleavable linker
CA3255406A1 (en) 2015-03-31 2025-07-03 Sorriso Pharmaceuticals, Inc. Tnf-alpha binding polypeptides
EP3078675A1 (en) 2015-04-10 2016-10-12 Ares Trading S.A. Induction dosing regimen for the treatment of tnf alpha mediated disorders
GB201510758D0 (en) 2015-06-18 2015-08-05 Ucb Biopharma Sprl Novel TNFa structure for use in therapy
EP3405491A1 (en) 2016-01-21 2018-11-28 VHsquared Limited Polypeptides
SG11201807402PA (en) 2016-03-31 2018-09-27 Vhsquared Ltd Compositions
EP3519438A1 (en) 2016-09-30 2019-08-07 VHsquared Limited Compositions
JP6986559B2 (ja) 2016-12-09 2022-01-05 オセ イムノセラピューティクス Cd127に対して方向付けられた抗体及びポリペプチド
WO2018225063A1 (en) 2017-06-04 2018-12-13 Rappaport Family Institute For Research In The Medical Sciences Method of predicting personalized response to cancer treatment with immune checkpoint inhibitors and kits therefor
AR112341A1 (es) 2017-08-02 2019-10-16 Lilly Co Eli ANTICUERPOS BIESPECÍFICOS ANTI-TNF- / ANTI-IL-23 DE IgG
CA3144567A1 (en) 2019-06-21 2020-12-24 Scott Crowe Polypeptides
US12559552B2 (en) 2019-06-21 2026-02-24 Sorriso Pharmaceuticals, Inc. IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides
KR20220063148A (ko) 2019-06-21 2022-05-17 소리소 파마슈티컬스 인크. 조성물

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070020267A1 (en) * 2003-08-01 2007-01-25 Genentech, Inc. Anti-VEGF antibodies
US20110028695A1 (en) * 2007-11-27 2011-02-03 Hilde Adi Pierrette Revets Method for obtaining polypeptide constructs comprising two or more single domain antibodies
US9527925B2 (en) * 2011-04-01 2016-12-27 Boehringer Ingelheim International Gmbh Bispecific binding molecules binding to VEGF and ANG2
US20150017183A1 (en) * 2011-12-20 2015-01-15 Adaerata, Limited Partnership Single domain antibodies as inhibitors of pcsk9
US20150147318A1 (en) * 2012-06-06 2015-05-28 Zoetis Llc Caninized anti-ngf antibodies and methods thereof
US20140044730A1 (en) * 2012-08-13 2014-02-13 Regeneron Pharmaceuticals, Inc. ANTI-PCSK9 ANTIBODIES WITH pH-DEPENDENT BINDING CHARACTERISTICS

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10633438B2 (en) 2015-03-31 2020-04-28 Vhsquared Limited Polypeptides
US12173054B2 (en) 2015-03-31 2024-12-24 Sorriso Pharmaceuticals, Inc. Polypeptides
US12234279B2 (en) 2015-03-31 2025-02-25 Sorriso Pharmaceuticals, Inc. Peptide construct having a protease-cleavable linker
US10772839B2 (en) 2016-03-31 2020-09-15 Vhsquared Limited Compositions
US10980748B2 (en) 2016-03-31 2021-04-20 Vhsquared Ltd. Compositions
US11684677B2 (en) * 2016-09-30 2023-06-27 Sorriso Pharmaceuticals, Inc. Compositions
US11623952B2 (en) 2019-06-21 2023-04-11 Sorriso Pharmaceuticals, Inc. IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides
US11667719B2 (en) 2019-06-21 2023-06-06 Sorriso Pharmaceuticals, Inc. VHH immunoglobulin chain variable domain that binds to IL-7R and methods of use thereof for treating autoimmune and/or inflammatory diseases
US12247079B2 (en) 2019-06-21 2025-03-11 Sorriso Pharmaceuticals, Inc. Polynucleotides encoding, and method of making, a polypeptide comprising a VHH which binds interleukin-receptor (IL-7R)
US12559552B2 (en) 2019-06-21 2026-02-24 Sorriso Pharmaceuticals, Inc. IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides
US12570736B2 (en) 2019-06-21 2026-03-10 Sorriso Pharmaceuticals, Inc. Compositions

Also Published As

Publication number Publication date
IL254591A0 (en) 2017-11-30
HK1250040A1 (zh) 2018-11-23
CN107438620A (zh) 2017-12-05
IL254591B (en) 2022-07-01
AU2016239951A1 (en) 2017-09-07
SG11201706882VA (en) 2017-09-28
US20210317195A1 (en) 2021-10-14
EP3277713A1 (en) 2018-02-07
WO2016156468A1 (en) 2016-10-06
US12173054B2 (en) 2024-12-24
JP2018511346A (ja) 2018-04-26
KR20170132749A (ko) 2017-12-04
EP3277713B1 (en) 2025-09-10
CA2981103A1 (en) 2016-10-06

Similar Documents

Publication Publication Date Title
US12173054B2 (en) Polypeptides
US12234279B2 (en) Peptide construct having a protease-cleavable linker
US20250277043A1 (en) Polynucleotides encoding, and method of making, a polypeptide comprising a vhh which binds interleukin- receptor (il-7r)
US10633438B2 (en) Polypeptides
US11623952B2 (en) IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides
HK40084553A (en) Polypeptides
HK1250041B (en) Polypeptides

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

AS Assignment

Owner name: VHSQUARED LIMITED, UNITED KINGDOM

Free format text: CONFIRMATORY ASSIGNMENT;ASSIGNORS:CROWE, SCOTT;WEST, MIKE;ROBERTS, KEVIN;AND OTHERS;REEL/FRAME:047765/0847

Effective date: 20160816

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: ADVISORY ACTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION