US20160115247A1 - Single domain antibodies directed against intracellular antigens - Google Patents

Single domain antibodies directed against intracellular antigens Download PDF

Info

Publication number
US20160115247A1
US20160115247A1 US14/922,081 US201514922081A US2016115247A1 US 20160115247 A1 US20160115247 A1 US 20160115247A1 US 201514922081 A US201514922081 A US 201514922081A US 2016115247 A1 US2016115247 A1 US 2016115247A1
Authority
US
United States
Prior art keywords
sdab
stat3
seq
sdabs
tnf
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US14/922,081
Other languages
English (en)
Inventor
Sunanda Singh
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Singh Biotechnology LLC
Original Assignee
Singh Biotechnology LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Singh Biotechnology LLC filed Critical Singh Biotechnology LLC
Priority to US14/922,081 priority Critical patent/US20160115247A1/en
Assigned to SINGH BIOTECHNOLOGY, LLC reassignment SINGH BIOTECHNOLOGY, LLC ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: SINGH, SUNANDA, DR.
Publication of US20160115247A1 publication Critical patent/US20160115247A1/en
Assigned to SINGH BIOTECHNOLOGY, LLC reassignment SINGH BIOTECHNOLOGY, LLC NOTICE OF ASSIGNEE'S CHANGE OF ADDRESS Assignors: SINGH BIOTECHNOLOGY, LLC
Abandoned legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/241Tumor Necrosis Factors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3015Breast
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/303Liver or Pancreas
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3069Reproductive system, e.g. ovaria, uterus, testes, prostate
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • C07K16/4208Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig
    • C07K16/4241Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig against anti-human or anti-animal Ig
    • G01N33/574
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854Immunoglobulins
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854Immunoglobulins
    • G01N33/686Anti-idiotype
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6872Intracellular protein regulatory factors and their receptors, e.g. including ion channels
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/94Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving narcotics or drugs or pharmaceuticals, neurotransmitters or associated receptors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • Sequence Listing is provided as a file titled “Sequence_Listing_STP25.txt,” created Sep. 30, 2015, last modified Oct. 22, 2015, and is 83,000 bytes in size.
  • the information in the electronic format of the Sequence Listing is incorporated herein by reference in its entirety.
  • sdAbs single-domain antibodies
  • sdAbs single antigen-binding proteins or as an antigen-binding domain in larger protein or polypeptide
  • advantages of sdAbs include: only a single domain is required to bind an antigen with high affinity and with high selectivity; sdAbs can be expressed from a single gene and require no post-translational modification; sdAbs are highly stable to heat, pH, proteases and other denaturing agents or conditions; sdAbs are inexpensive to prepare; and sdAbs can access targets and epitopes not accessible to conventional antibodies.
  • Other treatments include the use of therapeutic proteins or agents that contain an exogenous targeting sequence so that the therapeutic agent can be recognized by receptors in the cell membrane, enabling the therapeutic agent to cross the cell membrane and enter the cell. Once the therapeutic agent is inside the cell, the therapeutic agent can interact with the target component in order to treat the disease.
  • exogenous targeting sequence can limit the cell type that is targeted by the therapeutic agent, and adds to the cost of manufacturing the therapeutic agent.
  • compositions and methods to treat or prevent a disease that do not rely on exogenous targeting sequences or chemical compositions in order to enter the cell, and that are effective in targeting only the affected cells in the body.
  • the present invention relates to single-domain antibodies (sdAbs), proteins and polypeptides comprising the sdAbs.
  • the sdAbs are directed against intracellular components that cause a condition or disease.
  • the invention also includes nucleic acids encoding the sdAbs, proteins and polypeptides, and compositions comprising the sdAbs.
  • the invention includes the use of the compositions, sdAbs, proteins or polypeptides for prophylactic, therapeutic or diagnostic purposes.
  • the invention also includes the use of monoclonal antibodies directed towards the sdAbs of the invention.
  • One embodiment of the invention is a single-domain antibody (sdAb) directed against an intracellular component.
  • the intracellular component can be, for example, a protein, nucleic acid, lipid, carbohydrate, STAT1, STAT2, STAT3, STAT4, STAT5a, STAT5b, STAT6, TNF-alpha, and KRAS.
  • the invention is directed towards an anti-STAT3 sdAb.
  • the anti-STAT3 sdAb comprises an amino acid sequence set forth in SEQ ID NO:3 or SEQ ID NO:4.
  • the invention is directed towards an isolated polypeptide comprising an amino acid sequence encoding an anti-STAT sdAb, such as, for example, the polypeptide set forth in SEQ ID NO:3 or SEQ ID NO:4.
  • the invention is directed towards a host cell, and the host cell expresses the amino acid sequence of the sdAb such as, for example, the amino acid set forth in SEQ ID NO:3 or SEQ ID NO:4.
  • One embodiment of the invention is a pharmaceutical composition comprising a sdAb, or a polypeptide, and a pharmaceutically acceptable carrier.
  • the sdAb comprises an anti-STAT3 sdAb comprising an amino acid sequence set forth in SEQ ID NO:3 or SEQ ID NO:4
  • the polypeptide comprises an isolated polypeptide comprising an amino acid sequence set forth in SEQ ID NO:3 or SEQ ID NO:4.
  • Another embodiment of the invention is a method to diagnose a disorder mediated by STAT3 in a subject, the method comprising the steps of a) contacting a biological sample with the sdAb, or a polypeptide; b) determining the amount of STAT3 in the biological sample; and c) comparing the amount determined in step (b) with a standard, a difference in amount indicating the presence of the disorder.
  • Another embodiment of the invention is a method of preventing or treating a disease or disorder, or preventing recurrence of a disease mediated by STAT3, or for use in the treatment of cancer, or diseases caused by abnormal cellular proliferation, comprising administering an anti-STAT3 sdAb, or a polypeptide, to a subject in need thereof.
  • the sdAb comprises an anti-STAT3 sdAb comprising an amino acid sequence set forth in SEQ ID NO:3 or SEQ ID NO:4
  • the polypeptide comprises an isolated polypeptide comprising an amino acid sequence set forth in SEQ ID NO:3 or SEQ ID NO:4.
  • the anti-TNF-alpha sdAb comprises an amino acid sequence set forth in SEQ ID NO:5, SEQ ID NO:6 or SEQ ID NO:7.
  • the invention also comprises an isolated polypeptide comprising an amino acid sequence set forth in SEQ ID NO:5, SEQ ID NO:6 or SEQ ID NO:7.
  • Another embodiment of the invention is a host cell expressing the amino acid sequence set forth in SEQ ID NO:5, SEQ ID NO:6 or SEQ ID NO:7.
  • the invention is also a pharmaceutical composition
  • a sdAb or a polypeptide and a pharmaceutically acceptable carrier.
  • the sdAb comprises an anti-TNF-alpha sdAb comprising an amino acid sequence set forth in SEQ ID NO:5, SEQ ID NO:6 or SEQ ID NO:7
  • the polypeptide comprises an isolated polypeptide comprising an amino acid sequence set forth in SEQ ID NO:5, SEQ ID NO:6 or SEQ ID NO:7.
  • Another embodiment of the invention is a method to diagnose a disorder mediated by TNF-alpha in a subject, the method comprising the steps of a) contacting a biological sample with a sdAb or a polypeptide; b) determining the amount of TNF-alpha in the biological sample; and c) comparing the amount determined in step (b) with a standard, a difference in amount indicating the presence of the disorder.
  • the invention describes a method of preventing or treating a disease or disorder or recurrence of a disease or disorder mediated by TNF-alpha, or for use in the treatment of cancer, or diseases caused by abnormal cellular proliferation, comprising administering an anti-TNF-alpha sdAb, or a polypeptide, to a mammal in need thereof.
  • the anti-TNF-alpha sdAb comprises an amino acid sequence set forth in SEQ ID NO:5, SEQ ID NO:6 or SEQ ID NO:7
  • the polypeptide comprises isolated polypeptide, the isolated polypeptide comprising an amino acid sequence set forth in SEQ ID NO:5, SEQ ID NO:6 or SEQ ID NO:7.
  • the anti-KRAS sdAb comprises an amino acid sequence set forth in SEQ ID NO:2.
  • the invention comprises an isolated polypeptide, wherein the isolated polypeptide comprises an amino acid sequence set forth in SEQ ID NO:2.
  • the invention comprises a host cell expressing the amino acid sequence set forth in SEQ ID NO:2.
  • compositions comprising a sdAb or a polypeptide, and a pharmaceutically acceptable carrier.
  • the sdAb comprises an anti-KRAS sdAb comprising an amino acid sequence set forth in SEQ ID NO:2
  • the polypeptide comprises isolated polypeptide comprising an amino acid sequence set forth in SEQ ID NO:2.
  • An additional embodiment of the invention is method to diagnose a disorder mediated by KRAS in a subject, the method comprising the steps of a) contacting a biological sample with a sdAb or a polypeptide; b) determining the amount of KRAS in said biological sample; and c) comparing the amount determined in step (b) with a standard, a difference in amount indicating the presence of the disorder.
  • the sdAb comprises an anti-KRAS sdAb comprising an amino acid sequence set forth in SEQ ID NO: 2 and the polypeptide comprises isolated polypeptide comprising an amino acid sequence set forth in SEQ ID NO:2.
  • the invention also comprises a method of treating a disease using an anti-KRAS sdAb, the method comprising administering an effective amount of an anti-KRAS sdAb to a subject in need thereof.
  • the invention describes a method of preventing or treating a disease or disorder, or the recurrence of a disease or disorder, mediated by KRAS, or for use in the treatment of cancer, or diseases caused by abnormal cellular proliferation, comprising administering an anti-KRAS sdAb or a polypeptide, to a mammal in need thereof.
  • the anti-KRAS sdAb comprises an amino acid sequence set forth in SEQ ID NO: 2
  • the polypeptide comprises isolated polypeptide comprising an amino acid sequence set forth in SEQ ID NO: 2.
  • the invention describes a method of administering the sdAb of the invention, the method comprising intravenous administration, intramuscular administration, oral administration, rectal administration, intraocular administration, enteral administration, parenteral administration, subcutaneous administration, transdermal administration, administered as eye drops, administered as nasal spray, administered by inhalation or nebulization, topical administration, and administered as an implantable drug.
  • the invention describes a method of treating a disease, preventing a disease or preventing the reoccurrence of a disease using the sdAb of the invention in combination with one or more compounds.
  • the one or more compounds is a transcriptional inhibitor.
  • the invention describes a method of measuring the levels of a sdAb, the method comprising the steps of a) generating a mouse monoclonal antibody directed against one or more domains of the sdAb; b) performing an immunoassay to determine the amount of sdAb in a subject; and c) quantifying the amount of sdAb in the subject.
  • FIG. 1 is a schematic map of VHH13 anti-STAT3 sdAb expression vector pTT21-stt VHH13;
  • FIG. 2 is a schematic map of VHH14 anti-STAT3 sdAb expression vector pTT21-stt VHH14;
  • FIG. 3 depicts the results of an immunoprecipitation assay using anti-STAT3 bacterial VHH13 STAT3 (SEQ ID NO:3) and anti-STAT3 bacterial VHH14 STAT3 (SEQ ID NO:4);
  • FIG. 4 depicts the results of an immunoprecipitation assay using anti-STAT3 bacterial VHH13 STAT3 (SEQ ID NO:3);
  • FIG. 5 illustrates the growth inhibition of anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb in the MDA-MB-231 xenograft model, dosed at 0.5 mg/kg/day;
  • FIG. 6 illustrates the growth inhibition of anti-STAT3 bacterial VHH13 (SEQ. ID. NO. 3) sdAb in MDA-MB-231 xenograft model at doses ranging from 1 mg/kg twice daily to 2 mg/kg twice daily or 2 mg/kg/day;
  • FIG. 7 illustrates the growth inhibition of anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb in the MDA-MB-231 xenograft model, dosed at 5 mg/kg/twice daily;
  • FIG. 8 illustrates the growth inhibition of anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb in the DU145 xenograft model, dosed at 5 mg/kg/twice daily;
  • FIG. 9 illustrates the growth inhibition of anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb in the PANC-1 xenograft model, dosed at 5 mg/kg/twice daily;
  • FIG. 10 illustrates the growth inhibition of anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb in the MCF-7 xenograft model, dosed at 1 mg/kg/three times daily;
  • FIG. 11 illustrates the growth inhibition of anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb in the BT-474 xenograft model, dosed at 1 mg/kg/three times daily;
  • FIG. 12 illustrates the cytotoxicity of TNF-alpha in U937 cells
  • FIG. 13 illustrates the cytotoxicity of Staurosporine in U937 cells
  • FIG. 14 illustrates inhibition of TNF-alpha cytotoxicity by anti-TNF-alpha sdAbs.
  • antigenic determinant refers to the epitope on the antigen recognized by the antigen-binding molecule (such as an sdAb or polypeptide of the invention) and more in particular by the antigen-binding site of the antigen-binding molecule.
  • antigenic determinant and epipitope may also be used interchangeably.
  • An amino acid sequence that can bind to, that has affinity for and/or that has specificity for a specific antigenic determinant, epitope, antigen or protein is said to be “against” or “directed against” the antigenic determinant, epitope, antigen or protein.
  • the sdAbs, polypeptides and proteins described herein can contain so-called “conservative” amino acid substitutions, which can generally be described as amino acid substitutions in which an amino acid residue is replaced with another amino acid residue of similar chemical structure and which has little or essentially no influence on the function, activity or other biological properties of the polypeptide. Conservative amino acid substitutions are well known in the art.
  • Conservative substitutions are substitutions in which one amino acid within the following groups (a)-(e) is substituted by another amino acid within the same group: (a) small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro and Gly; (b) polar, negatively charged residues and their (uncharged) amides: Asp, Asn, Glu and Gln; (c) polar, positively charged residues: His, Arg and Lys; (d) large aliphatic, nonpolar residues: Met, Leu, Ile, Val and Cys; and (e) aromatic residues: Phe, Tyr and Trp.
  • a “domain” as used herein generally refers to a globular region of an antibody chain, and in particular to a globular region of a heavy chain antibody, or to a polypeptide that essentially consists of such a globular region.
  • the amino acid sequence and structure of an sdAb is typically made up of four framework regions or “FRs,” which are referred to as “Framework region 1” or “FR1”; as “Framework region 2” or“FR2”; as “Framework region 3” or “FR3”; and as “Framework region 4” or “FR4,” respectively.
  • the framework regions are interrupted by three complementarity determining regions or “CDRs,” which are referred as “Complementarity Determining Region 1” or “CDR1”; as “Complementarity Determining Region 2” or “CDR2”; and as “Complementarity Determining Region 3” or “CDR3,” respectively.
  • humanized sdAb means an sdAb that has had one or more amino acid residues in the amino acid sequence of the naturally occurring VHH sequence replaced by one or more of the amino acid residues that occur at the corresponding position in a VH domain from a conventional 4-chain antibody from a human. This can be performed by methods that are well known in the art.
  • the FRs of the sdAbs can be replaced by human variable FRs.
  • an “isolated” nucleic acid or amino acid has been separated from at least one other component with which it is usually associated, such as its source or medium, another nucleic acid, another protein/polypeptide, another biological component or macromolecule or contaminant, impurity or minor component.
  • mammal is defined as an individual belonging to the class Mammalia and includes, without limitation, humans, domestic and farm animals, and zoo, sports, and pet animals, such as cows, horses, sheep, dogs and cats.
  • “pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field. Preferred examples of such carriers or diluents include, but are not limited to, water, saline, Ringer's solutions, dextrose solution, PBS (phosphate-buffered saline), and 5% human serum albumin. Liposomes, cationic lipids and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with a therapeutic agent as defined above, use thereof in the composition of the present invention is contemplated.
  • a “quantitative immunoassay” refers to any means of measuring an amount of antigen present in a sample by using an antibody.
  • Methods for performing quantitative immunoassays include, but are not limited to, enzyme-linked immunosorbent assay (ELISA), specific analyte labeling and recapture assay (SALRA), liquid chromatography, mass spectrometry, fluorescence-activated cell sorting, and the like.
  • solution refers to a composition comprising a solvent and a solute, and includes true solutions and suspensions.
  • solutions include a solid, liquid or gas dissolved in a liquid and particulates or micelles suspended in a liquid.
  • the term “specificity” refers to the number of different types of antigens or antigenic determinants to which a particular antigen-binding molecule or antigen-binding protein molecule can bind.
  • the specificity of an antigen-binding protein can be determined based on affinity and/or avidity.
  • the affinity represented by the equilibrium constant for the dissociation of an antigen with an antigen-binding protein (KD), is a measure for the binding strength between an antigenic determinant and an antigen-binding site on the antigen-binding protein: the lesser the value of the KD, the stronger the binding strength between an antigenic determinant and the antigen-binding molecule (alternatively, the affinity can also be expressed as the affinity constant (KA), which is 1/KD).
  • affinity can be determined depending on the specific antigen of interest.
  • Avidity is the measure of the strength of binding between an antigen-binding molecule and the antigen. Avidity is related to both the affinity between an antigenic determinant and its antigen binding site on the antigen-binding molecule and the number of pertinent binding sites present on the antigen-binding molecule.
  • Specific binding of an antigen-binding protein to an antigen or antigenic determinant can be determined by any known manner, such as, for example, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays.
  • RIA radioimmunoassays
  • EIA enzyme immunoassays
  • the term “recombinant” refers to the use of genetic engineering methods (for example, cloning, and amplification) used to produce the sdAbs of the invention.
  • a “single domain antibody,” “sdAb” or “VHH” can be generally defined as a polypeptide or protein comprising an amino acid sequence that is comprised of four framework regions interrupted by three complementarity determining regions. This is represented as FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4.
  • An sdAb of the invention also includes a polypeptide or protein that comprises the sdAb amino acid sequence.
  • sdAbs are produced in camelids such as llamas, but can also be synthetically generated using techniques that are well known in the art.
  • variable domains present in naturally occurring heavy chain antibodies will also be referred to as “VHH domains,” in order to distinguish them from the heavy chain variable domains that are present in conventional 4-chain antibodies, referred to as “VH domains,” and from the light chain variable domains that are present in conventional 4-chain antibodies, referred to as “VL domains.”
  • VHH and sdAb are used interchangeably herein.
  • the numbering of the amino acid residues of a sdAb or polypeptide is according to the general numbering for VH domains given by Kabat et al. (“Sequence of proteins of immunological interest,” US Public Health Services, NIH Bethesda, Md., Publication No. 91).
  • FR1 of a sdAb comprises the amino acid residues at positions 1-30
  • CDR1 of a sdAb comprises the amino acid residues at positions 31-36
  • FR2 of a sdAb comprises the amino acids at positions 36-49
  • CDR2 of a sdAb comprises the amino acid residues at positions 50-65
  • FR3 of a sdAb comprises the amino acid residues at positions 66-94
  • CDR3 of a sdAb comprises the amino acid residues at positions 95-102
  • FR4 of a sdAb comprises the amino acid residues at positions 103-113.
  • target refers to any component, antigen, or moiety that is recognized by the sdAb.
  • intracellular target refers to any component, antigen, or moiety present inside a cell.
  • transmembrane target is a component, antigen, or moiety that is located within the cell membrane.
  • extracellular target refers to a component, antigen, or moiety that is located outside of the cell.
  • a “therapeutic composition” as used herein means a substance that is intended to have a therapeutic effect such as pharmaceutical compositions, genetic materials, biologics, and other substances.
  • Genetic materials include substances intended to have a direct or indirect genetic therapeutic effect such as genetic vectors, genetic regulator elements, genetic structural elements, DNA, RNA and the like.
  • Biologics include substances that are living matter or derived from living matter intended to have a therapeutic effect.
  • the phrases “therapeutically effective amount” and “prophylactically effective amount” refer to an amount that provides a therapeutic benefit in the treatment, prevention, or management of a disease or an overt symptom of the disease.
  • the therapeutically effective amount may treat a disease or condition, a symptom of disease, or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disease, the symptoms of disease, or the predisposition toward disease.
  • the specific amount that is therapeutically effective can be readily determined by an ordinary medical practitioner, and may vary depending on factors known in the art, such as, e.g., the type of disease, the patient's history and age, the stage of disease, and the administration of other therapeutic agents.
  • the present invention relates to single-domain antibodies (sdAbs) that are directed against intracellular components, as well as to proteins and polypeptides comprising the sdAbs and nucleotides encoding the proteins and polypeptides.
  • the invention can also relate to sdAbs that are directed against intercellular, transcellular and extracellular targets or antigens.
  • the invention also includes nucleic acids encoding the sdAbs, proteins and polypeptides, and compositions comprising the sdAbs.
  • the invention includes the use of the compositions, sdAbs, proteins or polypeptides for prophylactic, therapeutic or diagnostic purposes.
  • SdAbs have a number of unique structural characteristics and functional properties which make sdAbs highly advantageous for use as functional antigen-binding domains or proteins. SdAbs functionally bind to an antigen in the absence of a light chain variable domain, and can function as a single, relatively small, functional antigen-binding structural unit, domain or protein. This distinguishes sdAbs from the domains of conventional antibodies, which by themselves do not function as an antigen-binding protein or domain, but need to be combined with conventional antibody fragments such as Fab fragments or ScFv's fragment in order to bind an antigen.
  • one method for obtaining sdAbs includes (a) immunizing a Camelid with one or more antigens, (b) isolating peripheral lymphocytes from the immunized Camelid, obtaining the total RNA and synthesizing the corresponding cDNAs, (c) constructing a library of cDNA fragments encoding VHH domains, (d) transcribing the VHH domain-encoding cDNAs obtained in step (c) to mRNA using PCR, converting the mRNA to ribosome display format, and selecting the VHH domain by ribosome display, and (e) expressing the VHH domain in a suitable vector and, optionally purifying the expressed VHH domain.
  • Another method of obtaining the sdAbs of the invention is by preparing a nucleic acid encoding an sdAb using techniques for nucleic acid synthesis, followed by expression of the nucleic acid in vivo or in vitro. Additionally, the sdAb, polypeptides and proteins of the invention can be prepared using synthetic or semi-synthetic techniques for preparing proteins, polypeptides or other amino acid sequences.
  • the sdAbs of the invention will generally bind to all naturally occurring or synthetic analogs, variants, mutants, alleles, parts and fragments of the target, or at least to those analogs, variants, mutants, alleles, parts and fragments of the target that contain one or more antigenic determinants or epitopes that are essentially the same as the antigenic determinant or epitope to which the sdAbs of the invention bind in the wild-type target.
  • the sdAbs of the invention may bind to such analogs, variants, mutants, alleles, parts and fragments with an affinity and/or specificity that is the same as, or that is higher than or lower than the affinity and specificity with which the sdAbs of the invention bind to the wild-type target. It is also contemplated within the scope of the invention that the sdAbs of the invention bind to some analogs, variants, mutants, alleles, parts and fragments of the target but not to others.
  • the sdAb of the invention may be humanized, and may be monovalent or multivalent, and/or multispecific.
  • the sdAbs of the invention can bind to the phosphorylated form of the target protein as well as the unphosphorylated form of the target protein. sdAbs can be linked to other molecules such as albumin or other macromolecules.
  • the sdAbs are multivalent, that is, the sdAb can have two or more proteins or polypeptides which are directed against two or more different of epitopes of the target.
  • the protein or polypeptide may be directed, for example, against the same epitopes, substantially equivalent epitopes, or different epitopes.
  • the different epitopes may be located on the same target, or it could be on two or more different targets.
  • sequence of one or more sdAbs of the invention may be connected or joined with one or more linker sequences.
  • the linker can be, for example, a protein sequence containing a combination of serines, glycines and alanines.
  • the sdAbs of the invention are mainly intended for therapeutic and/or diagnostic use, they are directed against mammalian, preferably human, targets.
  • targets from other species, for example with targets from one or more other species of primates or other animals (for example, mouse, rat, rabbit, pig or dog), and in particular in animal models for diseases and disorders associated with the disease associated with the targets.
  • the invention relates to a nucleic acid that encodes an sdAb of the invention.
  • a nucleic acid may be, for example, in the form of a genetic construct.
  • the invention relates to host or host cell that expresses or is capable of expressing an sdAb of the invention, and/or that contains a nucleic acid encoding a sdAb of the invention.
  • Sequences of the sdAbs can be used to insert into the genome of any organism to create a genetically modified organism (GMO). Examples include, but are not limited to, plants, bacteria, viruses, and animals.
  • the invention further relates to methods for preparing or generating the sdAbs, nucleic acids encoding the sdAbs, host cells expressing or capable of expressing such sdAbs, products and compositions containing the sdAbs of the invention.
  • the invention further relates to applications and uses of the sdAb, the nucleic acids encoding the sdAbs, host cells, products and compositions described herein.
  • a product or composition may, for example, be a pharmaceutical composition for treatment or prevention of a disease, or a product or composition for diagnostic use.
  • sdAbs can be used in a variety of assays, for example ELISA assays and mass spectrometry assays to measure the serum and tissue levels of the sdAbs.
  • nucleic acid encoding one or more sdAb of the invention can be inserted into the genome of an organism to treat or prevent diseases.
  • the present invention generally relates to sdAbs, as well as to proteins or polypeptides comprising or essentially consisting of one or more of such sdAbs, that can be used for prophylactic, therapeutic and/or diagnostic purposes.
  • compositions detailed in the present invention can be used to treat disease described herein, and can be used with any dosage and/or formulation described herein or otherwise known, as well as with any route of administration described herein or otherwise known to one of skill in the art.
  • the sdAbs of the invention can be used for treatment and prevention of malignant diseases including, but not limited to: multiple myeloma, leukemias (HTLV-1 dependent, erythroleukemia, acute myelogenous leukemia (AML), chronic myelogenous leukemia (CML), and large granular lymphocyte leukemia (LGL), lymphomas (EBV-related/Burkitt's, mycosis fungoides, cutaneous T-cell lymphoma, non-Hodgkins lymphoma (NHL), anaplastic large-cell lymphoma (ALCL), breast cancers, triple-negative breast cancers, head and neck cancers, melanoma, ovarian cancers, lung cancers, pancreatic cancers, prostate cancers, sarcomas, osteosarcoma, Kaposi's sarcom
  • malignant diseases including, but not limited to: multiple myeloma, leukemias (HTLV-1 dependent, erythroleukemia
  • the sdAb in particular the anti-STAT3 and the anti-TNF-alpha sdAbs of the present invention, can also be used for treatment and prevention of diseases such as, but not limited to: autoimmune diseases (e.g., rheumatoid arthritis, ulcerative colitis, Crohn's disease, bacterial induced colitis, asthma, scleroderma, lupus, encephalomyelitis, arteritis, vasculitis, glomerulonephritis, uveitis, uveoretinitis, multiple sclerosis), polycystic kidney disease, dermatologic diseases (e.g., psoriasis, alopecia areata, atopic dermatitis, keloids/hypertrophic scars, lipoma, Padget's disease, and actinic keratosis), Hidradenitis suppurativa, transplantation (e.g., solid organ, bone marrow, hand, face,
  • sdAbs can target orphan diseases.
  • rare orphan diseases include, but are not limited to, triple negative breast cancers, pancreatic cancers, AML (acute myeloid leukemia), head and neck cancers, multiple myeloma, and chemo-resistant cancers.
  • Viral infections can be treated by targeting intracellular viral proteins in infected cells.
  • Viral proteins such as HIV reverse transcriptase, can block viral life-cycle.
  • the sdAb of the invention can also target intracellular viral proteins such as Ebola VP24 and thus block Ebola's ability to shut down the host's anti-viral immune response.
  • the sdAbs of the invention can be used to target diseases when there is an overexpression of an intracellular molecule. Huntington's disease can be treated with sdAbs.
  • the sdAbs of the invention can be used with one or more compounds.
  • the sdAb of the invention can be used with JAK/STAT inhibitors such as, for example, Curcumin, Resveratrol, Cucurbitacin A, B, E, I, Q, Flavopiridol, Deoxytetrangomycin, Cyclopentenone derivatives, N-Acylhomoserine Lactone, Indirubin derivatives, Meisoindigo, Tyrphostins, Platinum-containing compounds (e.g., IS3-295), Peptidomimetics, antisense oligonucleotides, S3I-201, phosphotyrosin tripeptide derivatives, HIV protease inhibitors (e.g., nelfinavir, indinavir, saquinavir, & ritornavir), JSI-124, XpYL, Ac-pYLPQTV-NH2, ISS 610, CJ-1383, pyrimeth
  • the one or more compounds can increase the therapeutic response and augment the effectiveness of the sdAb of the invention.
  • the effectiveness of the sdAb can be increased by combining it with peptides, peptidomimetics, and other drugs, such as, for example, but not limited to, cimetidine, atorvastatin, celecoxib, metformin, and cimetidine.
  • anti-STAT3 sdAbs can convert radioresistant cancers to radiosensitive cancers with respect to radiation therapy.
  • one or more sdAbs of the invention can be combined, or the sdAbs of the invention can be combined with other sdAbs.
  • certain sdAbs of the invention can cross the cell membrane and enter the cell without the aid of additional targeting protein sequences on the sdAb, and without the aid of exogenous compounds that direct the sdAb to bind to the cell surface receptors and cross the cell membrane.
  • these sdAbs can target transmembrane or intracellular molecules or antigens.
  • These intracellular or transmembrane targets can be, for example, proteins, carbohydrates, lipids, nucleic acids, mutated proteins, viral proteins, and prions.
  • the sdAb targets may function as enzymes, structural proteins of the cell, intracellular portions of cell membrane molecules, molecules within the membranes of organelles, any type of RNA molecule, any regions of DNA or chromosome, methylated or unmethylated nucleic acids, partially assembled molecules within the synthesis mechanism of the cell, second messenger molecules, and molecules within cell signaling mechanisms.
  • Targets may include all molecules in the cytoplasm, nucleus, organelles, and cell membrane. Molecules destined for secretion or placement in the cell membrane can be targeted within the cytoplasm before leaving the cell.
  • the sdAb targets can be in humans, animals, plants, fungi, parasites, protists, bacteria, viruses, prions, prokaryotic cells, and eukaryotic cells.
  • Some examples of inter- and intracellular signaling molecules and protein groups that can be targeted by the sdAbs of the invention are: oncogene products, hormones, cytokines, growth factors, neurotransmitters, kinases (including tyrosine kinase, serine kinase, and threonine kinase), phosphatases, ubiquitin, cyclic nucleotides, cyclases (adenylyl and guanylyl), G proteins, phosphodiesterases, GTPase superfamily, immunoglobulins (antibodies, Fab fragments, binders, sdAbs), immunoglobulin superfamily, inositol phosphate lipids, steroid receptors, calmodulin, CD group (e
  • KRAS is a Kirsten ras oncogene homolog from the mammalian ras gene family.
  • KRAS encodes a protein that is a member of the small GTPase superfamily. The protein is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas, and colorectal carcinoma.
  • Ras family members influence cell growth and differentiation events in a subcellular membrane compartmentalization-based signaling system.
  • oncogenic Ras can deregulate processes that control both cell proliferation and apoptosis.
  • Anti-KRAS sdAbs were developed to target wild-type and mutated KRAS (G12D) in order to disrupt its role in malignant cells such as, for example, cells involved in colorectal cancer, pancreatic cancer, biliary tract cancer, lung cancer, leukemias, and other metastatic malignancies. Without being bound by a particular mechanism, it is thought that the anti-KRAS sdAb binds KRAS and blocks the downstream signaling of KRAS in malignant cells. Additionally, the anti-KRAS sdAb may successfully treat malignancies that are resistant to anti-EGFR biologics (e.g., cetuximab and panitumumab).
  • anti-EGFR biologics e.g., cetuximab and panitumumab
  • recombinant human mutant KRAS (G12D) protein was used to generate sdAbs that are directed against or can bind to an epitope of KRAS or mutant KRAS (G12D), or other KRAS mutants. Additionally, sdAbs can be generated to other KRAS mutants.
  • recombinant full-length human KRAS (Gene ID: 3845) was expressed in Escherichia coli.
  • KRAS_13 SEQ ID NO:1
  • the present invention comprises one or more mouse monoclonal antibodies which are directed against one or more domains of the anti-KRAS sdAb of the invention.
  • the mouse monoclonal antibody can be generated by methods that are known by one of skill in the art, for example, the mouse monoclonal antibody can be produced by a mouse hybridoma.
  • the mouse monoclonal antibody can be used in diagnostic assays, for example, the antibody can be used in an immunoassay such as an ELISA or mass spectrometry assay in order to measure the amount of anti-KRAS sdAb present in a patient's serum.
  • the cytotoxicity of KRAS (G12D) sdAbs on PANC-1 human pancreatic cancer cells was tested, as described below.
  • STAT3 is a member of the signal transducers and activators of transcription (STAT) family of proteins that carry both signal transduction and activation of transcription functions. STAT3 is widely expressed and becomes activated through phosphorylation on tyrosine and/or serine as a DNA binding protein in response to a various cytokines and growth factors such as EGF, IL-6, PDGF, IL-2 and G-CSF.
  • the STAT3 phosphoprotein forms homodimers and heterodimers with other members of the STAT family and translocates to the nucleus in order to modulate the transcription of various genes, and as a result plays a key role in many cellular processes such as cell growth, apoptosis, angiogenesis, immune evasion, and survival.
  • An anti-STAT3 sdAb can be given to patients and other organisms to treat diseases caused by phosphorylated and non-phosphorylated STAT3, as well as to prevent the development of disease or recurrence of disease.
  • patients who have undergone organ transplant and bone marrow transplant are at higher risk for cutaneous SCCA and BCCA due to the immunosuppressive medications they take.
  • Administration of an anti-STAT3 sdAb can reduce or eliminate this risk. Patients treated for a malignancy who are at risk for recurrence will benefit from treatment with the anti-STAT3 sdAb.
  • the anti-STAT3 sdAb can also inhibit STAT1, STAT2, STAT4, STAT5a, STAT5b, and STAT6 due to the high degree of homology between these molecules.
  • Recombinant human STAT3 protein was used to produce anti-STAT sdAbs that were directed against or can bind to an epitope of STAT3.
  • recombinant full-length human STAT3 (Gene ID: 6774) was expressed by baculovirus in Sf9 insect cells.
  • the anti-STAT sdAbs were cloned into vectors that can be expressed in both bacterial and mammalian cells, as shown in FIGS. 1 and 2 .
  • the anti-STAT3 sdAb of the invention can be used to target STAT3 and all other STAT molecules inside the cell in order to inhibit cell growth, such as, for example, suppression of cancer cell growth.
  • the anti-STAT3 sdAb can inhibit cell growth in other proliferative diseases such as psoriasis and macular degeneration via VEGF.
  • anti-STAT3 sdAb can eliminate cancer induced immune suppression by decreasing STAT3 levels in antigen presenting cells such as, for example, host dendritic cells.
  • STAT3 inhibition promotes anti-cancer response by patient's innate and adaptive immune systems (i.e., dendritic cells, macrophages, neutrophils, T cells, NK cells, and B cells).
  • anti-STAT sdAbs were obtained and screened for the ability to suppress cancer cell growth and induce apoptosis in cancer cell lines, as described below.
  • the cytotoxicity and anti-proliferative activities of the anti-STAT3 sdAbs was tested.
  • the tolerance of anti-STAT3 sdAbs was tested in vitro and in vivo. The production of mouse monoclononal antibody directed against one or more domains of the anti-STAT sdAbs is described below.
  • VHH13 amino acid sequence of one anti-STAT3 sdAb, named VHH13 (SEQ ID NO. 3), is shown below:
  • VHH14 SEQ ID NO. 4
  • STAT3_10 (SEQ ID NO. 5): (1) DVQLVESGGGSVQAGGSLRLSCVASTYTGCMGWFRQAPGKEREGVAA (48) LSSRGFAGHYTDSVKGRFSISRDYVKNAVYLQMNTVKPEDAAMYYCAARE (98) GWECGETWLDRTAGGHTYWGQGTQVTVSS STAT3_34 (SEQ ID NO.
  • HVQLVESGGGSVQAGGSLRLSCAASGANGGRSCMGWFRQVPGKEREGVSG (51) ISTGGLITYYADSVKGRFTISQDNTKNTLYLQMNSLKPEDTAMYYCATSR (101) FDCYRGSWFNRYMYNSWGQGTQVTVSS STAT3_39
  • HVQLVESGGGSVQAGGSLRLSCAASGANGGRSCMGWFRQVPGKEREGVSG (51) ISTGGLITYYADSVKGRFTISQDNTKNTLYLQMNSLKPEDTAMYYCATSR (101) FDCYRGSWFNRYMYNSWGQGTQVTVSS STAT3_4 (SEQ ID NO.
  • HVQLVESGGGSVQAGGSLRLSCAASGANGGRSCMGWFRQVPGKEREGVSG (51) ISTGGLITYYADSVKGRFTISQDNTKNTLYLQMNSLKPEDTAMYYCATSR (101) FDCYRGSWFNRYMYNSWGQGTQVTVSS STAT3_29 (SEQ ID NO. 29): (1) HVQLVESGGGSVQAGGSLRLSCAASGANGGRSCMGWFRQVPGKEREGVSG (51) ISTGGLITYYADSVKGRFTISQDNTKNTLYLQMNSLKPEDTAMYYCATSR (101) FDCYRGSWFNRYMYNSWGOGTOVTVSS
  • Stat3_VHH-10 (SEQ ID NO. 30): 5′-gatgtgcagctggtggagtctgggggaggctcggtgcaggctggaggctctctg agactctcctgtgtagcctctacatacaccggctgcatgggctggttccgccaggctcctggaaggagcgcgagggagtcgcagctctta gtagccgtggtttgccgggcactataccgactccgtgaagggccgattctccatctccccgagactacgtcaagaatgcggtgtatctgcaa atgaacactgtgaaacctgaggacgctgccatgtactactgtgtatctgcaa atgaacactgtgaaacctgaggac
  • the present invention comprises one or more mouse monoclonal antibodies which are directed against one or more domains of the anti-STAT3 sdAb of the invention.
  • the mouse monoclonal antibody can be generated by methods that are known by one of skill in the art, for example, the mouse monoclonal antibody can be produced by a mouse hybridoma.
  • the mouse monoclonal antibody can be used in diagnostic assays, for example, the antibody can be used in an immunoassay such as an ELISA in order to measure the amount of anti-STAT3 sdAb present in a patient's serum. It should be appreciated that the method is not limited to anti-STAT3 sdAbs, and could be used to produce a mouse antibody directed towards any of the sdAbs of the present invention.
  • the TNF-alpha gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily.
  • TNF tumor necrosis factor
  • This cytokine is mainly secreted by macrophages.
  • the cytokine is involved in the regulation of a wide spectrum of biological processes including growth regulation, differentiation, inflammation, viral replication, tumorigenesis, and autoimmune diseases; and in viral, bacterial, fungal, and parasitic infections.
  • TNF was found to be involved in tumorigenesis, tumor metastasis, viral replication, septic shock, fever, inflammation, cachexia, and autoimmune diseases including Crohn's disease, and rheumatoid arthritis as well as graft-versus-host disease.
  • the present invention provides sdAbs, proteins, and polypeptides that are directed against TNF-alpha, in particular against human TNF-alpha inside the cell or cell membrane, so as to prevent the secretion of TNF-alpha by cells.
  • the anti-TNF-alpha sdAbs and polypeptides of the invention can be used for the prevention and/or treatment of diseases and disorders associated with and/or mediated by TNF-alpha, such as inflammation, rheumatoid arthritis, Crohn's disease, ulcerative colitis, inflammatory bowel syndrome, multiple sclerosis, Addison's disease, autoimmune hepatitis, autoimmune parotitis, diabetes type 1, epididymitis, glomerulonephritis, Graves' disease, Guillain-Barre syndrome, Hashimoto's disease, hemolytic anemia, systemic lupus erythematosus, male infertility, multiple sclerosis, myasthenia gravis, pemphigus, psoriasis, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, spondyloarthropathies, thyroid
  • TNF-alpha exists in different forms; there are monomeric and multimeric forms, including a trimeric form. It is within the scope of the invention that the sdAbs, proteins and polypeptides of the invention bind to TNF-alpha in its different form, i.e., monomeric form or multimeric forms. Thus, when sdAbs, proteins and polypeptides of the invention are directed to TNF-alpha, it should be understood that this also comprises sdAbs, proteins and polypeptides directed against TNF-alpha in its trimeric form.
  • TNF signal transduction by TNF involves crosslinking by TNF receptors by a trimer of TNF molecules, which contains three receptor binding sites (see, for example, Peppel et al., J. Exp. Med., 174 (1991), 1483-1489).
  • Recombinant human TNF-alpha protein was used to generate sdAbs that are directed against or can bind to an epitope of TNF-alpha.
  • recombinant full-length human TNF-alpha (Gene ID: 7124) was expressed in Escherichia coli and used as the target antigen.
  • TNF-alpha protein Thirty-five sdAbs against the TNF-alpha protein were obtained. These anti-TNF-alpha antibodies were divided into three groups based on sequence homology.
  • TNF-alpha VHH66 SEQ ID NO. 45
  • TNF-alpha VHH69 SEQ ID NO. 46
  • TNF-aphha VHH62 SEQ ID NO. 47
  • TNF_2 (SEQ ID NO. 48): QVQLVESGGGSVEAGRSLRLSCAASGFRYA AYCMG WFRQADGKERE GVA TIDIDGQTTHADSVKGRFT ISRDNAKNTLSLQMNDLKPEDTA MYYCAADRDRCGSIWTYAYKYRGQGTQVTVSS TNF_46 (SEQ ID NO. 49): QVQLVESGGGSVEAGGSLRLSCAASGFRYA AYCMG WFRQADGKERE GVA TIDIDGQTTHADSVKGRFT ISRDNVKNTLSLQMNDLKPEDTA MYYCAADRDRCGSIWTYAYKYRGQGTQVTVSS TNF_71 (SEQ ID NO.
  • HVQLVESGGGSVQAGGSLRLSCAASGFRYA AYCMG WFRQADGKVRE GVA TIDIDGQTTHADSVKGRFT ISRDNAKNTLSLQMNDLKPEDTA MYYCAA DRDRCGSIWTYAYKYR GQGTLVTVSS TNF_6 (SEQ ID NO. 59): QVQLVESGGGS VQAGGSLRLSCAASGFIDS FGVMA WFRQAPGKERE GVA AVYRRAGDTYYADSVKGRFT ISRDNAKNTVYLQMNSLKPEDSA MYYCAA RTYGSVSSWTGYKY WGQGTQVTVSS TNF_7 (SEQ ID NO.
  • HVQLVESGGGSVQAGETLRLSCTASGFTFA EADMG WYRQAPGHECE LVS TITTEGITSEASSYYADSVRGRFT ISRDNAKNMVYLQMNSLKPEDTA VYYCAP DPYAYSTYSDYCT WAQGTQGTQVTVSS TNF_58 (SEQ ID NO. 73): EVQLVESGGGSVQAGETLRLSCTASGFTFA EADMG WYRQAPGHECE LVS TITTEGITSEASSYYADSVRGRFT ISRDNAKNMVYLQMNSLKPEDTA VYYCAP DPYAYSTYSDYCT WAQGTQGALVTVSS TNF_27 (SEQ ID NO.
  • the present invention comprises one or more mouse monoclonal antibodies which are directed against one or more domains of the anti-TNF-alpha sdAb of the invention.
  • the mouse monoclonal antibody can be generated by methods that are known by one of skill in the art, as described above.
  • the mouse monoclonal antibody can be used in diagnostic assays, such as, for example, an immunoassay such as an ELISA in order to measure the amount of anti-TNF-alpha sdAb present in a patient's serum.
  • the RAF proteins are a family of serine/threonine-specific kinases that serve as a central intermediate in transmitting extracellular signals to the mitogen-activated protein kinase cascade, which controls cell growth, differentiation and survival.
  • BRAF is a member of the RAF family that is activated by members of the Ras family upon growth factor-induced stimulation. Active Ras can induce heterodimerization of cRaf and BRAF and this may explain the observed cooperativity of cRaf and BRaf in cells responding to growth factor signals.
  • Activating mutations in the BRAF gene are present in a large percentage of human malignant melanomas and in a proportion of colon cancers. The vast majority of these mutations result in a valine to glutamic acid change at residue 599 within the activation segment of BRAF.
  • Anti-BRAF sdAbs were developed to target wild-type and mutated BRAF in order to disrupt its role in malignant cells such as, for example, cells involved in colon cancer and other malignancies.
  • recombinant human BRAF protein was used to generate sdAbs that are directed against or can bind to an epitope of BRAF.
  • the present invention comprises one or more mouse monoclonal antibodies which are directed against one or more domains of the anti-BRAF sdAb of the invention.
  • the mouse monoclonal antibody can be generated by methods that are known by one of skill in the art.
  • the mouse monoclonal antibody can be used in diagnostic assays, for example, the antibody can be used in an immunoassay such as an ELISA in order to measure the amount of anti-BRAF sdAb present in a patient's serum.
  • the affinity of two VHH targets against STAT3 was measured using Octet based label-free binding assay.
  • Anti-STAT3 VHH13 (SEQ ID NO:3) sdAb, anti-KRAS (negative control) and GST-STAT3 (16 kDa monovalent antigen, Creative BioMart #STAT3-1476H) were used as antigen probes in this assay.
  • the GST-STAT3 protein was captured at 20 ⁇ g/ml in PBS using aminopropylsilane (APS) dip and read biosensors, specifically meant for hydrophobic protein.
  • APS aminopropylsilane
  • the probes were then dipped into wells with the GST-STAT3 protein, anti-STAT3 VHH13 (SEQ ID NO:3) sdAb or anti-KRAS at a concentration as indicated. The association rate (on rate) of the antigen was measured. The sensors were quenched with 1% BSA in water. The probes were dipped into assay buffer (PBS) and the dissociation rate (off rate) was measured.
  • PBS assay buffer
  • the affinity represented by the equilibrium constant for the dissociation of an antigen with an antigen-binding protein (KD) was determined from the obtained affinity constant (KA), and KD using 1:1 global fit analysis Fortebio software as shown below in Table 1. Affinity was determined by averaging KD values for curves with R2 values >0.95. The 250 nM anti-STAT3 VHH13 data point was omitted as it is an outlier. It was determined that the anti-STAT3 VHH13 (SEQ ID NO. 3) sdAb affinity was 1.16 ⁇ 10 ⁇ 7 . The affinity of anti-KRAS VHH was not determined.
  • the specificity of STAT3 sdAbs was assayed in human breast cancer cells.
  • MDA-MB-231 human breast cancer cells were grown to 50% to 70% confluence. The cells were then disrupted in freshly prepared ice-cold lysis buffer (20 mM HEPES, pH 7.9, 400 mM NaCl, 0.1% NP-40, 10% glycerol, 1 mM sodium vanadate, 1 mM sodium fluoride, 1 mM dithiothreitol, 1 mM phenylmethylsulfonyl fluoride, 10 ⁇ g/mL aprotinin, 10 ⁇ g/mL leupeptin) for 45 minutes on ice.
  • ice-cold lysis buffer (20 mM HEPES, pH 7.9, 400 mM NaCl, 0.1% NP-40, 10% glycerol, 1 mM sodium vanadate, 1 mM sodium fluoride, 1 mM dithiothreitol, 1
  • Lysates were then centrifuged, the supernatant collected, and protein concentration was determined using a modified Lowry method (Bio Rad, Hercules, Calif.). Total protein (1 mg) was incubated with 1.5 mg of Dynabeads (Invitrogen) with sdAbs against STAT3, a positive control (STAT3, cat#SC-482, Santa Cruz Biotechnology, Dallas, Tex.), or negative control (STAT-1, cat#9172, Cell Signaling, Danvers, Mass.) for 1 hr at 4° C. Beads were then washed. Following the final wash, 60 ⁇ l of lysis buffer was added, and the resulting supernatant was subject to Western blot analysis.
  • Dynabeads Invitrogen
  • M is the Marker lane containing the marker
  • lane 1 contained STAT3 VHH13 (SEQ ID NO:3) produced and isolated from mammalian cells
  • lane 2 contained STAT3 VHH14 (SEQ ID NO:4) produced and isolated from mammalian cells
  • lane 3 contained STAT3 VHH13 (SEQ ID NO:3) produced and isolated from bacterial cells
  • lane 4 contained STAT3 VHH14 (SEQ ID NO:4) produced and isolated from mammalian cells
  • lane 5 was the positive STAT3 antibody
  • the cells were grown to 50% to 70% confluence, then disrupted in freshly prepared ice-cold lysis buffer as described above for 45 minutes on ice. Lysates were then centrifuged, the supernatant collected, and protein concentration was determined as described above. Total protein (1 mg) was incubated with 1.5 mg of Dynabeads (Invitrogen) containing the bacterial anti-STAT3 VHH13 (SEQ ID NO:3) or negative control (KRAS, Creative Biolabs, Shirley, N.Y.) for 1 hour at 4° C. Beads were then washed. Following the final wash, 60 ⁇ l of lysis buffer was added, and the resulting supernatant was subject to Western Blot analysis as described in Example 2.
  • Dynabeads Invitrogen
  • KRAS Creative Biolabs, Shirley, N.Y.
  • endogenous STAT3 was immunoprecipitated by bacterial VHH13 STAT3 (SEQ ID NO:3) in the constitutively activated STAT3 cell lines: PANC-1 (lane 1), DU145 (lane 2), and 4T1 (lane 4). Furthermore, bacterial VHH13 STAT3 (SEQ ID NO:3) bound to the Phospho-STAT3 in HeLa lysate (lane 3). No bands were noted for either PANC-1 KRAS, lane 3, and PC-3 (negative control), lane 6.
  • the anti-proliferative effects of anti-STAT3 sdAbs were assayed using the human breast cancer cell line MDA-MB-231.
  • MDA-MB-231 cells were grown until they reached a confluency of 90%. At that time, cells were washed, trypsinized and counted using a Coulter Counter (Beckman, Brea, Calif.).
  • the proliferation studies were carried out using the 3-[4,5-dimethylthiaolyl]-2,5-diphenyltetrazolium bromide (MTT) assay. For this, cells were seeded in a 96-well plate at a density of 5 ⁇ 10 3 per well as indicated by the manufacturer (Roche Diagnostics Corporation, Indianapolis, Ind.).
  • sdAbs were added at the appropriate concentrations (i.e., 0, 0.5, 1.0, 10.0, or 100 ⁇ g/ml). Cells were counted on day 3. For the 5-day treated cells, fresh media containing the sdAbs was refreshed on day 3. At the time of termination, 10 ⁇ l of MTT reagent (0.5 mg/mL) was added to each well as indicated by the manufacturer. After a 4 hour incubation period, 100 ⁇ l of solubilization solution was added and the plate was placed in the incubator overnight. All the plates were read at 570 nm wavelength using the Biotek plate reader (Winooski, Vt.).
  • the bacterial VHH13 anti-STAT3 (SEQ ID NO. 3) sdAb was found to be effective in inhibiting cell growth at days 3 and 5 post-treatment, as shown in Tables 2-5 below.
  • the anti-proliferative effects of anti-STAT3 VHH13 (SEQ ID NO. 3) and the VHH14 (SEQ ID NO. 4) sdAbs were assayed using the human breast cancer cell line MDA-MB-231 and the human pancreatic cancer cell line PANC-1.
  • MDA-MB-231 and PANC-1 cells were grown until they were 90% confluent. At that time, cells were washed, trypsinized and counted using a Coulter Counter (Beckman, Brea, Calif.). The proliferation studies were carried out using the MTT assay described above. For the 5-day treated cells, fresh media containing the anti-STAT3 sdAbs was refreshed on day 3.
  • VHH13 SEQ ID NO. 3
  • VHH14 SEQ ID NO. 4
  • the anti-proliferative effects of the STAT3 VHH13 (SEQ ID NO. 3) sdAb were assayed in the human breast cancer cell line MDA-MB-231 and the human prostate cancer cell lines DU145.
  • cancer cells were grown until they reached 90% confluence. At that time, cells were washed, trypsinized, and counted using a Coulter Counter (Beckman, Brea, Calif.). The proliferation studies done using the MTT assay as described above.
  • anti-proliferative properties of anti-STAT3 bacterial VHH13 (SEQ ID NO. 3) sdAb on MDA-MB-231 cells were compared to its actions on DU145 cells.
  • MDA-MB-231 cells treated with the anti-STAT3 (SEQ ID NO:3) sdAbs showed an average growth inhibition of 29.6 and 91.2 at 50.0 and 100 ⁇ g/ml, respectively.
  • a similar growth inhibition (31.2 and 92.1% for 50.0 and 100 ⁇ g/ml, respectively) was seen as set forth in Table 15.
  • All human cancer cell lines were obtained from American Type Culture Collection (Manassas, Va.). Cell lines were maintained and cultured in RPMI 1640 media (MDA-MB-231, MDA-MB-468, MCF-7, BT474) or MEM-E (DU145) containing 10% fetal bovine serum, 2 mM L-glutamine and 1% antibiotic-antimycotic solution (10 units/mL penicillin, 10 ⁇ g/mL streptomycin and 25 ⁇ g/mL amphotericin B). Cells were kept at 37° C. in a humidified atmosphere of 5% CO 2 . Cell culture supplies were obtained from Life Technologies, Inc., (Grand Island, N.Y.). The MTT reagent was purchased from Sigma Aldrich (St. Louis, Mo.).
  • cancer cells were grown until they reached 90% confluency. At that time, cells were washed, trypsinized and counted using a Coulter Counter (Beckman, Brea, Calif.). The proliferation studies were carried out using the MTT assay as described above.
  • VHH13 SEQ ID NO:3
  • sdAbs sdAbs to achieve the IC 50 as compared to estrogen/progesterone positive cell lines (i.e., MCF-7) or HER2 amplified cell lines (i.e., BT474).
  • anti-STAT3 bacterial VHH13 SEQ ID NO:3 sdAb was also evaluated in the human prostate cancer cell line DU145, as shown in Table 18.
  • the anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb showed dose-dependent growth inhibition in all cancer cells tested.
  • mice were divided into three groups according to body weights.
  • mice received either vehicle (PBS) or anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb at 250 or 500 ⁇ g/kg body weight/day for five days.
  • mortality/morbidity was performed twice daily.
  • Body weights were recorded on days 1, 4, and 6 of the study as well as on the day of study termination (Day 13). Toxicity was assessed by body weight measurements and mouse behavior compared to vehicle control mice. Upon completion of treatment phase, animals were followed for an additional week to note any abnormalities in body weights and/or general health post treatment.
  • the human breast cancer cell lines (MDA-MB-231 and PANC-1) were obtained from American Type Culture Collection (ATCC) (Manassas, Va.).
  • the MDA-MB-231 cells were growth in MEM (Life Technologies, Grand Island, N.Y.) supplemented with 10% FBS (Atlanta Biologicals, Flowery Branch, Ga.) and Penicillin-Streptomycin-Glutamine (Life Technologies, Grand Island, N.Y.).
  • the PANC-1 cells were grown in RPMI 1640 media (Life Technologies, Grand Island, N.Y.) supplemented with 10% FBS and Penicillin-Streptomycin-Glutamine. All cells were grown in the presence of 5% CO 2 at 37° C. in an incubator.
  • Athymic nude-Foxn1 nu male mice aged 4 to 5 weeks were purchased from Harlan Laboratories (Indianapolis, Ind.). Animals were quarantined for one week and housed five mice per cage, with a 12-hr light-dark cycle, and a relative humidity of 50%. Drinking water and diet were supplied to the animals ad libitum. All animals were housed under pathogen-free conditions and experiments were performed in accordance with the IIT Research Institute Animal Use and Care Committee. For the MDA-MB-231 xenograft study, cells (4 ⁇ 10 6 ) in a 100- ⁇ L final volume of MEM media were injected subcutaneously into right flanks of mice.
  • the randomization Mean ( ⁇ SE) tumor size was: 103.01 ⁇ 11.89 and 102.61 ⁇ 9.60 for control and treatment groups respectively.
  • Mean body weights ( ⁇ SE) at randomization were: 32.08 ⁇ 0.76 and 30.27+0.75 for Group 1 and Group 2, respectively.
  • Table 21 shows the mean body weights ( ⁇ SE) for the entire study.
  • FIG. 5 illustrates the growth inhibition of anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb in the MDA-MB-231 xenograft model.
  • anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb has chemotherapeutic activity in the MDA-MB-231 human breast cancer model system.
  • the randomization Mean (+SE) tumor sizes were 107.01 ⁇ 4.54 in the control and 110.58 ⁇ 6.18 in the treatment groups.
  • Mean body weights ( ⁇ SE) at randomization were: 29.0 ⁇ 0.81 and 28.5 ⁇ 0.70 for Group 1 and Group 2, respectively.
  • Mean body weights ( ⁇ SE) at termination were: 31.2 ⁇ 0.99 and 30.1 ⁇ 0.75 for Group 1 and Group 2, respectively.
  • Table 23 summarizes the mean body weights ( ⁇ SE) for entire study. On day 14 of dosing, the mean tumor size ( ⁇ SE) for control was 287.30 ⁇ 33.94 versus 318.74+29.76 for treatment group.
  • Table 24 summarizes the tumor volumes ( ⁇ SE) for entire study.
  • the tumor doubling times were as follows: Group 1: 22.44 days; and Group 23.02 days.
  • Anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb showed no significant growth inhibition in the PANC-1 human pancreatic cancer model system.
  • the human breast cancer cell lines MDA-MB-231 and athymic nude-Foxn1 nu female mice were described above.
  • MDA-MB-231 cells at a density of 5 ⁇ 10 6 were injected subcutaneously into the right flank of the mice at a final volume of 100- ⁇ L in MEM media. Tumor measurements were initiated as soon as the tumors were palpable. Thereafter, tumors were measured twice weekly. Animals are randomized when tumors reach a range size of 55 to 150 mm 3 using the stratified random sampling algorithm. Treatment (anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb) or Vehicle (PBS) was initiated the day following randomization.
  • Treatment anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb
  • PBS Vehicle
  • the randomization Mean ( ⁇ SE) tumor size was: 92.08 ⁇ 13.24, 82.38 ⁇ 5.17, 77.47 ⁇ 7.17, and 104.71 ⁇ 14.64 for Groups 1, 2, 3, and 4 respectively.
  • mean body weights ( ⁇ SE) at randomization were: 23.65 ⁇ 0.72, 23.45 ⁇ 0.66, 23.10 ⁇ 0.20, and 22.45 ⁇ 1.25 for Groups 1, 2, 3, and 4, respectively.
  • the mean tumor size ( ⁇ SE) for control group was 221.51 ⁇ 57.32 versus 67.12 ⁇ 10.66, 58.27 ⁇ 22.54, and 131.44 ⁇ 22.86, for treatment group 2, 3, and 4, respectively.
  • mean tumor size ( ⁇ S.E.) was: 255.42 ⁇ 65.46, 55.98 ⁇ 6.94, 41.15 ⁇ 13.21, and 145.51 ⁇ 52.32, for groups 1, 2, 3, and 4, respectively.
  • Mean body weights ( ⁇ SE) at termination were: 24.80 ⁇ 0.49, 23.25 ⁇ 1.20, 24.00 ⁇ 0.32, and 23.2 ⁇ 1.46 for Groups 1, 2, 3, and 4, respectively.
  • the max mean % net weight loss (day) was: 0.7 (36), 1.5 (23), 1.8 (36), and 2.2 (29) for Groups 1, 2, 3, and 4, respectively.
  • the mean growth inhibition in the treatment groups was 78.3, 75.2, and 55.9, for Groups 2, 3, and 4, respectively.
  • the tumor doubling times were: Group 1: 20.56 days; Group 2: 34.54 days; Group 3: 30.07 days; and Group 4: 27.17 days.
  • the % treatment/control values for treatment groups were: Group 2: ⁇ 33.75 (tumor stasis); Group 3: ⁇ 54.4 (tumor regression); and Group 4: 10.28 (tumor inhibition).
  • FIG. 6 illustrates the growth inhibition of anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb in the MDA-MB-231 xenograft model.
  • mice Athymic Nude-Foxn1 nu mice, MDA-MB-231 breast cancer cells, PANC-1 pancreatic cancer and the DU145 prostate cancer cell lines were described above.
  • the body weight of the mice ranged from 17 to 19 g (34 females) and 21 to 23 g (16 males) on Day 1 of the study.
  • MDA-MB-231 (5 ⁇ 10 6 )
  • DU145 (5 ⁇ 10 6 )
  • PANC-1 1.5 ⁇ 10 6
  • Tumor measurements were initiated as soon as the tumors were palpable. Thereafter, tumors were measured twice weekly.
  • Animals were randomized using the stratified random sampling algorithm when tumors reach a range size of: 74-120 mm 3 (MDA-MB-231), 89-146 mm 3 (DU145), or 60-160 mm 3 (PANC-1).
  • Treatment containing anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb and referred to herein as SBT-100) or Vehicle (PBS) was initiated the day following randomization, referred to as day 1.
  • Anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb was supplied as a pre-formulated solution at a concentration of 0.651 mg/ml and was stored at ⁇ 20° C. until ready to use.
  • the stock solution was diluted in sterile PBS pH 7.6 to provide a 5 mg/kg in a dosing volume of 10 mL/kg.
  • the working solution was prepared every 7 days, aliquoted onto seven vials and stored at 4° C. On each day of treatment, only the needed vial was brought to room temperature. All leftover sdAb material was retained at 4° C. as need for the next dose. At day 8, any remaining sdAb material was discarded and a fresh batch prepared.
  • mice were randomized on day 23 post-inoculation with a mean ( ⁇ SE) tumor size of: 77.98 ⁇ 21.58 and 84.71 ⁇ 5.56 for Groups 1 and 2, respectively.
  • Mean body weights ( ⁇ SE) at randomization were: 20.04 ⁇ 0.62 and 23.7 ⁇ 1.84 for Groups 1 and 2, respectively.
  • Table 28 summarizes the mean body weights ( ⁇ SE) for entire study. At last day of dosing (Day 14), the mean tumor size ( ⁇ SE) for control group was 168.28 ⁇ 51.57 versus 83.81 ⁇ 22.65 for SBT-100 treated mice.
  • Table 29 summarizes the tumor volumes ( ⁇ SE) for entire study.
  • mean tumor size ( ⁇ S.E.) was: 270.49 ⁇ 112.35 and 91.72 ⁇ 33.17, for Groups 1 and 2, respectively.
  • Mean body weights ( ⁇ SE) at termination were: 25.36 ⁇ 1.07 and 24.25 ⁇ 1.68 for Groups 1 and 2, respectively.
  • FIG. 7 illustrates the mean tumor volume. The tumor doubling times were 25.78 days versus 111.6 days for Group 1 and Group 2, respectively. The % treatment/control for Group 2 was 13.35 (tumor inhibition).
  • mice were randomized on day 17 post-inoculation with a mean ( ⁇ SE) tumor size of: 111.87 ⁇ 20.53 and 111.23 ⁇ 25.16 for Groups 1 and 2, respectively.
  • Mean body weights ( ⁇ SE) at randomization were: 29.10 ⁇ 1.94 and 30.68 ⁇ 1.56 for Groups 1 and 2, respectively.
  • Table 30 summarizes the mean body weights ( ⁇ SE) for entire study.
  • the mean tumor size ( ⁇ SE) for control group was 621.81 ⁇ 276.25 versus 364.14 ⁇ 51.64 for SBT-100 treated mice.
  • Table 31 summarizes the tumor volumes ( ⁇ SE) for entire study.
  • mean tumor size ( ⁇ S.E.) was: 819.42 ⁇ 351.88 and 601.83 ⁇ 131.51, for Groups 1 and 2, respectively.
  • Mean body weights ( ⁇ SE) at termination were: 29.20 ⁇ 2.33 and 29.60 ⁇ 1.04 for Groups 1 and 2, respectively.
  • FIG. 8 illustrates the mean tumor volume. The tumor doubling times were 14.57 days versus 18.19 days for Group 1 and Group 2, respectively. The % treatment/control for Group 2 was 74.8.
  • mice were randomized on day 22 post-inoculation with a mean ( ⁇ SE) tumor size of: 78.74 ⁇ 40.21 and 93.84 ⁇ 36.31 for Groups 1 and 2, respectively.
  • Mean body weights ( ⁇ SE) at randomization were: 22.50 ⁇ 1.47 and 24.23 ⁇ 1.63 for Groups 1 and 2, respectively.
  • Table 32 summarizes the mean body weights ( ⁇ SE) for entire study. At last day of dosing (Day 14), the mean tumor size ( ⁇ SE) for control group was 204.95 ⁇ 178.90 versus 159.03 ⁇ 28.01 for SBT-100 treated mice.
  • Table 33 summarizes the tumor volumes ( ⁇ SE) for entire study.
  • mean tumor size ( ⁇ S.E.) was: 284.77 ⁇ 288.88 and 203.02 ⁇ 30.34, for groups 1 and 2, respectively.
  • Mean body weights ( ⁇ SE) at termination were: 27.38 ⁇ 1.07 and 26.23 ⁇ 1.19 for Groups 1 and 2, respectively.
  • FIG. 9 illustrates the mean tumor volume. The tumor doubling times were 18.51 days versus 35.70 days for Group 1 and Group 2, respectively. The % treatment/control for Group 2 was 52.79.
  • This Example demonstrates the efficacy of anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb in the MCF-7 human breast tumor xenograft model in nude mice.
  • mice Female athymic nude mice (Crl:NU(Ncr)-Foxn1 nu , Charles River) were twelve weeks old with a body weight (BW) range of 23.0 to 30.1 g on Day 1 of the study. The animals were fed and housed as described above.
  • MCF-7 human breast carcinoma cells were obtained and cultured as described above, and used for the mouse xenograph. Three days prior to tumor cell implantation, estrogen pellets (0.36 mg estradiol, 60-day release, Innovative Research of America, Sarasota, Fla.) were implanted subcutaneously between the scapulae of each test animal using a sterilized trocar.
  • the tumor cells used for implantation were harvested during log phase growth and resuspended in phosphate buffered saline (PBS) at a concentration of 1 ⁇ 10 8 cells/mL.
  • PBS phosphate buffered saline
  • each test mouse received 1 ⁇ 10 7 MCF-7 cells (0.1 mL cell suspension) implanted subcutaneously in the right flank and tumor growth was monitored as the average size approached the target range of 100-150 mm 3 .
  • Twenty-one days later, designated as Day 1 of the study the animals were sorted into two groups each consisting of four mice with individual tumor volumes ranging from 108 to 144 mm 3 and group mean tumor volumes from 117 to 123 mm 3 .
  • Anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb was provided as a pre-formulated ready to dose solution at a concentration 0.41867 mg/mL in 1 mL aliquots and were stored at ⁇ 20° C. until needed. The 0.41867 mg/mL solution provided 1 mg/kg dosage in a dosing volume of 23.88 mL/kg.
  • On each day of treatment only needed vials of anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb were thawed to room temperature. All leftover dosing suspensions were retained at 4° C. as needed for the next dose.
  • mice Two groups of athymic nude mice were dosed according to the protocol shown in Table 34. All vehicle (control) and anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb doses were administered intraperitoneally (i.p.) three times daily, six hours apart for fourteen days, with two doses delivered on Day 1 and one dose delivered on the morning of Day 15 (tid ⁇ 14, first day 2 doses).
  • the dosing volume for vehicle and anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb was 0.478 mL per 20 grams of body weight (23.88 mL/kg) and was scaled to the body weight of each individual animal. Group 1 received the vehicle and served as the benchmark group for tumor engraftment and progression, as well as the control. Group 2 was given anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb at 1 mg/kg.
  • Tumors were measured twice weekly, and each animal was euthanized when its neoplasm reached the predetermined endpoint volume (1000 mm 3 ) or at the end of the study, day 39, whichever came first.
  • TP tumor progression
  • TTE time to endpoint
  • TTE is expressed in days
  • endpoint volume is expressed in mm 3
  • b is the intercept
  • m is the slope of the line obtained by linear regression of a log-transformed tumor growth data set.
  • the data set consists of the first observation that exceeded the endpoint volume used in analysis and the three consecutive observations that immediately preceded the attainment of this endpoint volume.
  • the calculated TTE is usually less than the TP date, the day on which the animal was euthanized for tumor size. Animals that did not reach the endpoint volume were assigned a TTE value equal to the last day of the study (D39). Any animal classified as having died from treatment-related (TR) causes was to be assigned a TTE value equal to the day of death. Any animal classified as having died from non-treatment-related (NTR) causes was to be excluded from TTE calculations.
  • Treatment efficacy was determined from tumor growth delay (TGD), which is defined as the increase in the median TTE, in days, for a treatment group compared to the control group:
  • TTD tumor growth delay
  • T median TTE for a treatment group
  • Treatment efficacy in each group may be indicated by the median tumor volume, MTV(n), which was defined as the median tumor volume on the last day of the study (D39) in the number of animals remaining (n) whose tumors had not attained the endpoint volume.
  • Treatment efficacy may also be determined from the incidence and magnitude of regression responses observed during the study.
  • Treatment may cause partial regression (PR) or complete regression (CR) of the tumor in an animal.
  • PR partial regression
  • CR complete regression
  • the tumor volume was 50% or less of its D1 volume for three consecutive measurements during the course of the study, and equal to or greater than 13.5 mm 3 for one or more of these three measurements.
  • the tumor volume was less than 13.5 mm 3 for three consecutive measurements during the course of the study.
  • TSS tumor-free survivor
  • mice were weighed daily for the first five days, then twice weekly for the remainder of the study. The mice were observed frequently for health and overt signs of any adverse treatment related TR side effects, and noteworthy clinical observations were recorded. Individual body weight loss was monitored per protocol, and any animal with weight loss exceeding 30% for one measurement, or exceeding 25% for three measurements, was to be euthanized for health as a TR death. If group mean body weight recovered, dosing may resume in that group, but at a lower dose or less frequent dosing schedule. Acceptable toxicity was defined as a group mean BW loss of less than 20% during the study and not more than one TR death among ten treated animals, or 10%. Any dosing regimen resulting in greater toxicity is considered above the maximum tolerated dose (MTD).
  • MTD maximum tolerated dose
  • a death was to be classified as TR if it was attributable to treatment side effects as evidenced by clinical signs and/or necropsy, or may also be classified as TR if due to unknown causes during the dosing period or within 14 days of the last dose.
  • a death was classified as NTR if there was evidence that the death was related to the tumor model, rather than treatment-related. NTR deaths are further categorized as NTRa (due to accident or human error), NTRm (due to necropsy-confirmed tumor dissemination by invasion or metastasis), and NTRu (due to unknown causes).
  • a scatter plot was constructed to show TTE values for individual mice, by group; this plot shows NTR deaths, which were excluded from all other figures.
  • Individual animal, group median and mean tumor volumes were plotted as functions of time. When an animal exited the study because of tumor size or TR death, its final recorded tumor volume was included with the data used to calculate the median volume at subsequent time points.
  • a Kaplan-Meier plot was constructed to show the percentage of animals in each group remaining on study versus time. Tumor growth curves were truncated after two TR deaths occurred in the same group. Group mean BW changes over the course of the study were graphed as percent change, ⁇ SEM, from Day 1. Tumor growth and BW change curves were truncated after more than half the assessable mice in a group exited the study.
  • FIG. 10 illustrates the mean tumor volume in the study.
  • Table 35 provides the mean BW losses, TR and NTR deaths for the mice. Clinical signs were recorded when observed, as shown in Tables 36-38. No TR deaths occurred during the study. Bodyweight losses were variable, severe for one animal in each group, and resulted from estrogen effects. Clinical observations including weight loss, enlarged uterine horns, and bladder crystals were present in both groups and were also attributable to estrogen effects. Estrogen toxicity resulted in two non-treatment related deaths in each group. The treatment evaluated in the study was acceptably tolerated.
  • Tumor Volume Tumor Volume Group 1 vehicle (ip, tid ⁇ 14 first Day 2 doses) Date Jul. 27, 2015 14 Aug. 3, 2015 Aug. 6, 2015 Aug. 10, 2015 Aug. 13, 2015 Aug. 17, 205 Day of Study Jul. 30, 2015 8 11 15 18 22 A# TV (mm 3 ) TV (mm 3 ) TV (mm 3 ) TV (mm 3 ) TV (mm 3 ) TV (mm 3 ) 1 196 NTRa on Aug. 1, 2015 2 108 221 384 527 650 650 1080 3 113 245 405 600 726 726 787 4 126 270 NTRu on Aug.
  • the dosing volume for vehicle and anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb was 0.478 mL per 20 grams of body weight (23.88 mL/kg) and was scaled to the body weight of each individual animal.
  • Group 1 received the vehicle and served as the benchmark group for tumor engraftment and progression, as well as the control.
  • Group 2 was given anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb at 1 mg/kg.
  • the treatment group received anti-STAT3 B VHH13 and the control group only received the vehicle.
  • Table 40 shows that during this time, the treatment group maintained and gained weight throughout the study while the control group had lower weights throughout the study. This suggests that the treatment group did not experience toxicity from anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb with respect to weight loss.
  • Both groups mean tumor volume and median tumor volume were similar, and exactly the same on day 15 of the study. On day 59 of the study, both groups reached a tumor volume of 700 cubic mm 3 . This suggests that the anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb did not reduce the growth of BT474 tumors in vivo when compared to the control group.
  • FIG. 11 illustrates the group mean tumor volume.
  • mice monoclonal antibodies were generated towards the sdAb of the invention.
  • the animals used were BALB/c female mice, 8-10 week.
  • a water-soluble adjuvant was used (CBL).
  • the HAT and the HT used were from Sigma-Aldrich.
  • Anti-STAT3 bacterial VHH13 SEQ ID NO:3 sdAb was used to immunize three mice and make hybridoma cell lines.
  • the mice were immunized three times each with water-soluble adjuvant. In one mouse, the serum titer reached 1/51200.
  • the mouse was sacrificed and hybridoma cell lines were made by fusing spleen cells with myeloma cell line Sp2/0.
  • the fused cells were seeded into 96 well plates by limited dilution.
  • the fused cells were cultured in the presence of HAT, and 651 single clones were tested. Of the 651 single clones, 27 positive clones were identified that specifically bound to anti-STAT3 bacterial VHH13 (SEQ ID NO:3) sdAb antigen.
  • This Example demonstrates the anti-proliferative effects of the anti-KRAS (G12D) (SEQ ID NO:2) sdAb using the human pancreatic cancer cell line PANC-1.
  • the PANC-1 cells were grown until they reached a confluency of 90%. At that time, proliferation studies were carried out using the MTT assay as described above.
  • anti-proliferative properties of anti-KRAS (G12D) (SEQ ID NO:2) sdAb on PANC-1 cells three days post treatment are shown in Table 41.
  • PANC-1 cells treated with the anti-KRAS (G12D) (SEQ ID NO:2) sdAb showed an average growth inhibition of 19.9 and 37.7 at 50.0 and 100 ⁇ g/ml, respectively.
  • the anti-KRAS (G12D) (SEQ ID NO:2) sdAb showed dose-dependent growth inhibition in the PANC-1 human pancreatic cancer cells.
  • This Example demonstrates the method development to determine TNF-alpha concentration and evaluation of the inhibition of TNF-alpha function.
  • concentration of TNF-alpha required to show measurable modulation of activity in the U937 human lung lymphoblast cell line was evaluated by quantitation of the ATP present, which signals the presence of metabolically active cells using Promega's Cell Titer-GJo® Luminescent Cell Viability assay.
  • the U937 cells were seeded in a clear polystyrene 96-well microculture plate (Corning® Costar® 96-well flat bottom plate, Cat. #3997) in a total volume of 90 ⁇ L/well. After 24 hours of incubation in a humidified incubator at 37° C. with 5% CO 2 and 95% air, 5 ⁇ L of 20 ⁇ , serially diluted TNF-alpha in growth medium was added to each well in duplicate (10 pt dose response, highest concentration 20 ng/mL). Additionally, 5 ⁇ L of 20 ⁇ , diluted staurosporine in growth medium was added to each well in duplicate (concentration 1 nM).
  • the EC 50 value for the test agents was estimated using Prism 6.05 by curve-fitting the data using the following four parameter-logistic equation:
  • Top is the maximal % of control absorbance
  • Bottom is the minimal % of control absorbance at the highest agent concentration
  • Y is the % of control absorbance
  • X is the agent concentration
  • IC 50 is the concentration of agent that inhibits cell growth by 50% compared to the control cells
  • n is the slope of the curve.
  • FIGS. 12 and 13 demonstrate that TNF-alpha is cytotoxic to the U937 cells.
  • the IC 50 for TNF-alpha against U937 is 95.10 pg/ml.
  • the TNF-alpha curve shows a dose titration killing effect.
  • FIG. 14 demonstrates that TNF-alpha cytotoxicity against U937 is inhibited by the three different anti-TNF-alpha VHHs.
  • anti-TNF-alpha VHH62 SEQ ID NO:47
  • anti-TNF-alpha VHH 66 SEQ ID NO:45
  • anti-TNF-alpha VHH69 SEQ ID NO:46
  • the IC 50 of anti-TNF-alpha VHH62 (SEQ ID NO:47) sdAb was approximately 713.6 ug/ml.
  • the IC 50 of anti-TNF-alpha VHH69 (SEQ ID NO:46) sdAb was greater than 208.055 ug/ml.
  • the IC 50 of anti-TNF-alpha VHH66 (SEQ ID NO:45) sdAb could not be determined because it completely inhibited the cytotoxicity of TNF-alpha from concentrations of about 1 ⁇ 10 2 ug/ml to 1 ⁇ 10 2 ug/ml of anti-TNF-alpha VHH66 (SEQ ID NO:45) sdAb. In this concentration range of anti-TNF-alpha VHH66 (SEQ ID NO:45) sdAb, there is an increase in U937 cell growth, and thus complete inhibition of TNF-alpha activity.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Food Science & Technology (AREA)
  • General Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Analytical Chemistry (AREA)
  • Epidemiology (AREA)
  • Oncology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Mycology (AREA)
  • Endocrinology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pregnancy & Childbirth (AREA)
  • Gynecology & Obstetrics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Reproductive Health (AREA)
US14/922,081 2014-10-23 2015-10-23 Single domain antibodies directed against intracellular antigens Abandoned US20160115247A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US14/922,081 US20160115247A1 (en) 2014-10-23 2015-10-23 Single domain antibodies directed against intracellular antigens

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US201462067908P 2014-10-23 2014-10-23
US201562148656P 2015-04-16 2015-04-16
US201562188353P 2015-07-02 2015-07-02
US201562210795P 2015-08-27 2015-08-27
US14/922,081 US20160115247A1 (en) 2014-10-23 2015-10-23 Single domain antibodies directed against intracellular antigens

Publications (1)

Publication Number Publication Date
US20160115247A1 true US20160115247A1 (en) 2016-04-28

Family

ID=55761757

Family Applications (4)

Application Number Title Priority Date Filing Date
US14/922,081 Abandoned US20160115247A1 (en) 2014-10-23 2015-10-23 Single domain antibodies directed against intracellular antigens
US14/922,098 Active US9663570B2 (en) 2014-10-23 2015-10-23 Single domain antibodies directed against KRAS
US14/922,093 Active US9695234B2 (en) 2014-10-23 2015-10-23 Single domain antibodies directed against STAT3
US14/922,100 Active US9546211B2 (en) 2014-10-23 2015-10-23 Single domain antibodies directed against TNF-alpha

Family Applications After (3)

Application Number Title Priority Date Filing Date
US14/922,098 Active US9663570B2 (en) 2014-10-23 2015-10-23 Single domain antibodies directed against KRAS
US14/922,093 Active US9695234B2 (en) 2014-10-23 2015-10-23 Single domain antibodies directed against STAT3
US14/922,100 Active US9546211B2 (en) 2014-10-23 2015-10-23 Single domain antibodies directed against TNF-alpha

Country Status (24)

Country Link
US (4) US20160115247A1 (https=)
EP (3) EP3209685B1 (https=)
JP (5) JP2017538671A (https=)
KR (4) KR102207381B1 (https=)
CN (2) CN111848793B (https=)
AU (4) AU2015335600B2 (https=)
BR (4) BR122020006914B8 (https=)
CA (3) CA2962275C (https=)
CY (2) CY1122035T1 (https=)
DK (2) DK3209685T3 (https=)
ES (2) ES2731876T3 (https=)
HR (2) HRP20191056T1 (https=)
HU (2) HUE047601T2 (https=)
IL (2) IL289769B2 (https=)
LT (2) LT3590962T (https=)
MX (2) MX379450B (https=)
PL (2) PL3590962T3 (https=)
PT (2) PT3590962T (https=)
RS (2) RS62694B1 (https=)
RU (1) RU2017116710A (https=)
SI (2) SI3209685T1 (https=)
SM (2) SMT201900413T1 (https=)
TW (1) TWI664289B (https=)
WO (1) WO2016065323A2 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9546211B2 (en) 2014-10-23 2017-01-17 Singh Molecular Medicine, Llc Single domain antibodies directed against TNF-alpha
US9850321B2 (en) 2014-10-23 2017-12-26 Singh Molecular Medicine, Llc Single domain antibodies directed against intracellular antigens
US10195277B2 (en) 2015-11-02 2019-02-05 Singh Biotechnology, Llc Single domain antibodies directed against human immunodeficiency virus
WO2023283381A1 (en) * 2021-07-07 2023-01-12 Singh Biotechnology, Llc Suppression of uveitis by single domain antibody
WO2023028589A3 (en) * 2021-08-27 2023-04-27 Singh Biotechnology, Llc Therapeutic single domain antibody

Families Citing this family (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180072815A1 (en) 2014-10-23 2018-03-15 Singh Biotechnology, Llc Single Domain Antibodies Directed Against Intracellular Antigens
CA3255406A1 (en) 2015-03-31 2025-07-03 Sorriso Pharmaceuticals, Inc. Tnf-alpha binding polypeptides
WO2016156468A1 (en) 2015-03-31 2016-10-06 Vhsquared Limited Polypeptides
SG11201706840WA (en) 2015-03-31 2017-09-28 Vhsquared Ltd Peptide construct having a protease-cleavable linker
PE20181295A1 (es) 2015-09-01 2018-08-07 First Wave Bio Inc Metodos y composiciones para tratar afecciones asociadas a una respuesta inflamatoria anomala
CN108603037B (zh) * 2015-12-10 2020-11-17 希望之城 细胞穿透花青偶联抗体
EP3519438A1 (en) 2016-09-30 2019-08-07 VHsquared Limited Compositions
EP3596108A4 (en) 2017-03-15 2020-12-23 Pandion Operations, Inc. TARGETED IMMUNOTOLERANCE
US10676516B2 (en) 2017-05-24 2020-06-09 Pandion Therapeutics, Inc. Targeted immunotolerance
TW201922780A (zh) 2017-09-25 2019-06-16 美商健生生物科技公司 以抗il12/il23抗體治療狼瘡之安全且有效之方法
US10946068B2 (en) 2017-12-06 2021-03-16 Pandion Operations, Inc. IL-2 muteins and uses thereof
US10174092B1 (en) 2017-12-06 2019-01-08 Pandion Therapeutics, Inc. IL-2 muteins
USRE50550E1 (en) 2017-12-06 2025-08-26 Pandion Operations, Inc. IL-2 muteins and uses thereof
KR20190076354A (ko) * 2017-12-22 2019-07-02 주식회사 로피바이오 세포 내 침투능을 갖는 항 stat3 이중특이 항체를 포함하는, 염증성 질환 치료용 약학적 조성물
EP3730150A4 (en) 2017-12-22 2021-10-06 Rophibio, Inc. ANTI-STAT3 BISPECIFIC ANTIBODY WITH CELL-PENETRATING ABILITY AND THIS PHARMACEUTICAL COMPOSITION
US20210123061A1 (en) * 2018-05-04 2021-04-29 The Brigham And Women's Hospital, Inc. Methods and compositions for treating inflammatory disease or disorder
CN113518783A (zh) 2018-07-20 2021-10-19 动量制药公司 FcRn抗体组合物
KR102101561B1 (ko) * 2018-07-25 2020-04-20 가톨릭대학교 산학협력단 신생혈관 표적용 조영제 조성물 및 이의 제조방법
BR112021023345A2 (pt) 2019-05-20 2022-02-01 Pandion Operations Inc Imunotolerância com alvo em madcam
US12559552B2 (en) 2019-06-21 2026-02-24 Sorriso Pharmaceuticals, Inc. IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides
CA3144567A1 (en) 2019-06-21 2020-12-24 Scott Crowe Polypeptides
KR20220063148A (ko) 2019-06-21 2022-05-17 소리소 파마슈티컬스 인크. 조성물
CN110357965A (zh) * 2019-06-24 2019-10-22 浙江大学 一种突变型kras特异性抗体及其制备方法
EP4107187A4 (en) 2020-02-21 2024-07-03 Pandion Operations, Inc. TISSUE-TARGETED IMMUNOTOLERANCE WITH A CD39 EFFECTOR
IL295810B2 (en) 2020-03-11 2026-01-01 Univ Pennsylvania Methods and compositions for gene delivery using a modified viral particle
US10980756B1 (en) 2020-03-16 2021-04-20 First Wave Bio, Inc. Methods of treatment
CN115215939B (zh) * 2021-04-14 2025-09-23 中山大学 一种融合蛋白及其制备方法与应用
IL313473A (en) 2021-12-15 2024-08-01 Interius Biotherapeutics Inc Pseudotyped viral particles, compositions comprising the same, and uses thereof
WO2024003873A1 (en) * 2022-06-30 2024-01-04 Intrexon Actobiotics Nv D/B/A Precigen Actobio Single variable domain antibodies against tumor necrosis factor-alpha
KR20250057777A (ko) 2022-07-25 2025-04-29 인테리우스 바이오테라퓨틱스, 인코포레이티드 돌연변이된 폴리펩티드, 이를 포함하는 조성물, 및 그 용도(mutated polypeptides, compositions comprising the same, and uses thereof)
WO2024163894A1 (en) 2023-02-04 2024-08-08 Momenta Pharmaceuticals, Inc. Compositions and methods for treating hemolytic disease of the fetus and newborn
WO2025004683A1 (ja) * 2023-06-30 2025-01-02 国立大学法人大阪大学 がん検査方法及びがん治療剤
AR133412A1 (es) 2023-07-30 2025-09-24 Janssen Biotech Inc Moléculas que se unen a la calreticulina mutante y usos de estas
TW202527982A (zh) 2023-09-11 2025-07-16 美商默門塔醫藥公司 Fcrn抗體之醫藥組成物
WO2025099576A1 (en) 2023-11-06 2025-05-15 Momenta Pharmaceuticals, Inc. Compositions and methods for treating rheumatoid arthritis
TW202540161A (zh) 2023-11-21 2025-10-16 美商健生生物科技公司 治療骨髓增生性腫瘤之方法
WO2025163617A1 (en) 2024-02-04 2025-08-07 Momenta Pharmaceuticals, Inc. Compositions and methods for treating sjögren's disease
WO2025186787A1 (en) 2024-03-08 2025-09-12 Momenta Pharmaceuticals, Inc. Compositions and methods for treating fetal and neonatal alloimmune thrombocytopenia
WO2025257810A1 (en) * 2024-06-14 2025-12-18 Singh Biotechnology, Llc Suppression of neurodegenerative diseases by single domain antibody
WO2026083290A1 (en) 2024-10-16 2026-04-23 Momenta Pharmaceuticals, Inc. Compositions and methods for treating sjögren's disease

Family Cites Families (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5004697A (en) 1987-08-17 1991-04-02 Univ. Of Ca Cationized antibodies for delivery through the blood-brain barrier
AU687010B2 (en) * 1992-07-17 1998-02-19 Dana-Farber Cancer Institute Method of intracellular binding of target molecules
FR2706486B1 (fr) * 1993-06-16 1995-09-01 Rhone Poulenc Rorer Sa Séquences nucléiques, vecteurs les contenant, compositions pharmaceutiques et utilisations thérapeutiques.
EP1204674A4 (en) 1999-07-27 2005-06-01 Abgenix Inc METHODS AND COMPOUNDS FOR PREVENTING POLYPEPTIDE COLLECTIONS ASSOCIATED WITH NEUROLOGICAL DISORDERS
US6277974B1 (en) * 1999-12-14 2001-08-21 Cogent Neuroscience, Inc. Compositions and methods for diagnosing and treating conditions, disorders, or diseases involving cell death
DE10019157A1 (de) 2000-04-18 2001-11-15 Stefan Duebel Verfahren zum Einbringen von Liganden in lebende Zellen
CA2441903C (en) 2000-05-26 2012-07-31 National Research Council Of Canada Single-domain brain-targeting antibody fragments derived from llama antibodies
US20040052762A1 (en) 2001-09-10 2004-03-18 Hua Yu Stat3 agonists and antagonists and therapeutic uses thereof
AU2002246737B2 (en) * 2000-12-29 2007-03-01 Savient Pharmaceuticals, Inc. Specific human antibodies for selective cancer therapy
WO2003077945A1 (en) * 2002-03-14 2003-09-25 Medical Research Council Intracellular antibodies
GB0226727D0 (en) * 2002-11-15 2002-12-24 Medical Res Council Intrabodies
ZA200503075B (en) * 2002-11-07 2006-09-27 Immunogen Inc Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same
US20060034845A1 (en) 2002-11-08 2006-02-16 Karen Silence Single domain antibodies directed against tumor necrosis factor alpha and uses therefor
WO2004041863A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Single domain antibodies directed against interferon- gamma and uses therefor
EP1558645B1 (en) * 2002-11-08 2011-07-27 Ablynx N.V. Stabilized single domain antibodies in pharmaceutical composition adapted for inhalation
EP1900753B1 (en) 2002-11-08 2017-08-09 Ablynx N.V. Method of administering therapeutic polypeptides, and polypeptides therefor
GB0226729D0 (en) 2002-11-15 2002-12-24 Medical Res Council Intracellular antibodies
US7638122B2 (en) 2003-03-07 2009-12-29 University Of South Florida Stat3 antagonists and their use as vaccines against cancer
US20050226863A1 (en) 2003-11-20 2005-10-13 Massachusetts Institute Of Technology Single-domain antibodies and uses thereof
US8188223B2 (en) 2005-05-18 2012-05-29 Ablynx N.V. Serum albumin binding proteins
DE102005023617A1 (de) 2005-05-21 2006-11-23 Aspre Ag Verfahren zum Mischen von Farben in einem Display
EP2077863A4 (en) 2006-10-31 2010-10-06 Domantis Ltd intrabodies
CA2588106A1 (en) * 2007-05-18 2008-11-18 Nrc - Institute For Biological Sciences Single-domain antibodies and heavy chain antibody against egfr and uses thereof
EP2008666A1 (en) 2007-06-29 2008-12-31 Institut Pasteur Use of VHH antibodies for the preparation of peptide vectors for delivering a substance of interest and their applications
US20110195509A1 (en) * 2007-09-06 2011-08-11 Drew Pardoll Treatment of th17-mediated autoimmune disease via inhibition of stat 3
BRPI0910198A2 (pt) * 2008-06-30 2016-01-12 Silenseed Ltd composição para administração a partir de um sítio local de um agente baseado em nucleotídeos e método para tratar um sujeito sofrendo de uma doença requerendo tratamento local com um agente baseado em nucleotídeo.
EP2143735A1 (en) * 2008-07-10 2010-01-13 Institut Pasteur Variable domains of camelid heavy-chain antibodies directed against glial fibrillary acidic proteins
WO2010033913A1 (en) * 2008-09-22 2010-03-25 Icb International, Inc. Antibodies, analogs and uses thereof
WO2011051327A2 (en) 2009-10-30 2011-05-05 Novartis Ag Small antibody-like single chain proteins
US20130177979A1 (en) 2010-06-22 2013-07-11 University Of Central Florida Research Foundation, Inc. Methods and compositions for cell permeable stat3 inhibitor
US9879093B2 (en) * 2011-12-20 2018-01-30 Adaerata, Limited Partnershp Single domain antibodies as inhibitors of PCSK9
HRP20190303T1 (hr) * 2012-10-31 2019-05-17 Ionis Pharmaceuticals, Inc. Liječenje raka
AU2014227824B2 (en) * 2013-03-15 2018-09-27 Dana-Farber Cancer Institute, Inc. Stabilized SOS1 peptides
JP6570512B2 (ja) * 2013-03-22 2019-09-04 ユニバーシティ・オブ・ハワイUniversity Of Hawaii 新規なStat3阻害剤
CN103368197B (zh) 2013-07-15 2015-11-25 国家电网公司 模块化多电平换流器的阀基控制设备和方法
CN105658230B (zh) 2013-08-29 2020-04-21 希望之城 细胞穿透缀合物及其使用方法
EP2873680A1 (en) 2013-11-13 2015-05-20 F.Hoffmann-La Roche Ag Oligopeptide and methods for producing conjugates thereof
EP2899208A1 (en) 2014-01-28 2015-07-29 F.Hoffmann-La Roche Ag Camelid single-domain antibody directed against phosphorylated tau proteins and methods for producing conjugates thereof
US20160115247A1 (en) 2014-10-23 2016-04-28 Singh Biotechnology, Llc Single domain antibodies directed against intracellular antigens

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9546211B2 (en) 2014-10-23 2017-01-17 Singh Molecular Medicine, Llc Single domain antibodies directed against TNF-alpha
US9663570B2 (en) 2014-10-23 2017-05-30 Singh Molecular Medicine, Llc Single domain antibodies directed against KRAS
US9695234B2 (en) 2014-10-23 2017-07-04 Singh Molecular Medicine, Llc Single domain antibodies directed against STAT3
US9850321B2 (en) 2014-10-23 2017-12-26 Singh Molecular Medicine, Llc Single domain antibodies directed against intracellular antigens
US10195277B2 (en) 2015-11-02 2019-02-05 Singh Biotechnology, Llc Single domain antibodies directed against human immunodeficiency virus
US10369223B2 (en) 2015-11-02 2019-08-06 Singh Biotechnology, Llc Single domain antibodies directed against ebola virus VP24
WO2023283381A1 (en) * 2021-07-07 2023-01-12 Singh Biotechnology, Llc Suppression of uveitis by single domain antibody
WO2023028589A3 (en) * 2021-08-27 2023-04-27 Singh Biotechnology, Llc Therapeutic single domain antibody

Also Published As

Publication number Publication date
SMT201900413T1 (it) 2019-09-09
AU2019204614A1 (en) 2019-07-18
CA2962275A1 (en) 2016-04-28
JP6670963B2 (ja) 2020-03-25
JP6986180B2 (ja) 2021-12-22
KR102207382B1 (ko) 2021-01-27
US20160115244A1 (en) 2016-04-28
AU2021200416B2 (en) 2022-06-09
BR112017008165B1 (pt) 2020-04-22
JP6928773B2 (ja) 2021-09-01
US20160115248A1 (en) 2016-04-28
CA3052777C (en) 2021-06-01
EP4006052A1 (en) 2022-06-01
KR20180021205A (ko) 2018-02-28
HRP20191056T1 (hr) 2019-09-20
KR20190108646A (ko) 2019-09-24
IL289769B1 (en) 2024-01-01
BR122020006918B1 (pt) 2022-03-15
KR102023289B1 (ko) 2019-09-19
US9695234B2 (en) 2017-07-04
HUE047601T2 (hu) 2020-05-28
AU2015335600A1 (en) 2017-03-16
BR122020006914B1 (pt) 2022-03-22
IL289769B2 (en) 2024-05-01
CA3114318A1 (en) 2016-04-28
LT3209685T (lt) 2019-08-26
PT3209685T (pt) 2019-06-27
DK3209685T3 (da) 2019-07-29
MX2017003268A (es) 2017-08-02
ES2731876T3 (es) 2019-11-19
JP7195400B2 (ja) 2022-12-23
BR122020006907B8 (pt) 2023-01-31
CN106852148A (zh) 2017-06-13
BR122020006907B1 (pt) 2022-03-22
MX379450B (es) 2025-03-11
EP3209685A2 (en) 2017-08-30
JP2017538671A (ja) 2017-12-28
RS59063B1 (sr) 2019-08-30
CY1124867T1 (el) 2022-11-25
JP2021165278A (ja) 2021-10-14
IL250961B (en) 2022-02-01
RU2017116710A (ru) 2018-11-23
US20160115226A1 (en) 2016-04-28
KR101831123B1 (ko) 2018-02-22
SI3590962T1 (sl) 2022-02-28
CN111848793A (zh) 2020-10-30
IL289769A (en) 2022-03-01
EP3590962B1 (en) 2021-09-29
IL250961A0 (en) 2017-04-30
DK3590962T3 (da) 2021-12-13
JP2020015732A (ja) 2020-01-30
KR20170070002A (ko) 2017-06-21
KR20190107199A (ko) 2019-09-18
BR122020006918B8 (pt) 2023-01-31
AU2022204167A1 (en) 2022-06-30
CY1122035T1 (el) 2020-10-14
SMT202100695T1 (it) 2022-01-10
HUE057605T2 (hu) 2022-06-28
PL3590962T3 (pl) 2022-01-31
CN106852148B (zh) 2020-07-31
CN111848793B (zh) 2023-08-18
TWI664289B (zh) 2019-07-01
US9663570B2 (en) 2017-05-30
HRP20211889T1 (hr) 2022-03-04
EP3590962A1 (en) 2020-01-08
RS62694B1 (sr) 2022-01-31
KR102207381B1 (ko) 2021-01-27
CA2962275C (en) 2019-11-05
PT3590962T (pt) 2021-12-15
BR112017008165B8 (pt) 2023-01-31
AU2015335600B2 (en) 2019-04-04
EP3209685B1 (en) 2019-04-24
SI3209685T1 (sl) 2019-10-30
EP3209685A4 (en) 2018-01-24
BR112017008165A2 (pt) 2018-03-06
LT3590962T (lt) 2021-12-27
WO2016065323A2 (en) 2016-04-28
WO2016065323A3 (en) 2016-06-16
TW201615834A (zh) 2016-05-01
BR122020006914B8 (pt) 2023-01-31
AU2019204614B2 (en) 2020-10-22
ES2900253T3 (es) 2022-03-16
JP2019142885A (ja) 2019-08-29
MX2021001098A (es) 2021-03-31
CA3052777A1 (en) 2016-04-28
US9546211B2 (en) 2017-01-17
PL3209685T3 (pl) 2020-01-31
AU2021200416A1 (en) 2021-02-25
JP2022037002A (ja) 2022-03-08

Similar Documents

Publication Publication Date Title
US9695234B2 (en) Single domain antibodies directed against STAT3
US11370847B2 (en) Single domain antibodies directed against intracellular antigens
US9850321B2 (en) Single domain antibodies directed against intracellular antigens
RU2810002C2 (ru) Однодоменные антитела, направленные против внутриклеточных антигенов

Legal Events

Date Code Title Description
AS Assignment

Owner name: SINGH BIOTECHNOLOGY, LLC, FLORIDA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SINGH, SUNANDA, DR.;REEL/FRAME:037134/0351

Effective date: 20151123

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION

AS Assignment

Owner name: SINGH BIOTECHNOLOGY, LLC, FLORIDA

Free format text: NOTICE OF ASSIGNEE'S CHANGE OF ADDRESS;ASSIGNOR:SINGH BIOTECHNOLOGY, LLC;REEL/FRAME:058348/0146

Effective date: 20211207