US20120165503A1 - Oxyntomodulin analogs - Google Patents
Oxyntomodulin analogs Download PDFInfo
- Publication number
- US20120165503A1 US20120165503A1 US13/202,524 US200913202524A US2012165503A1 US 20120165503 A1 US20120165503 A1 US 20120165503A1 US 200913202524 A US200913202524 A US 200913202524A US 2012165503 A1 US2012165503 A1 US 2012165503A1
- Authority
- US
- United States
- Prior art keywords
- seq
- peptide
- residue
- amino
- peptide analog
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- PXZWGQLGAKCNKD-DPNMSELWSA-N molport-023-276-326 Chemical class C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 PXZWGQLGAKCNKD-DPNMSELWSA-N 0.000 title abstract description 162
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 437
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 claims abstract description 26
- 230000009977 dual effect Effects 0.000 claims abstract description 25
- 238000003776 cleavage reaction Methods 0.000 claims abstract description 17
- 230000007017 scission Effects 0.000 claims abstract description 17
- 230000002779 inactivation Effects 0.000 claims abstract description 10
- 102000016622 Dipeptidyl Peptidase 4 Human genes 0.000 claims abstract 3
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical group C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 claims description 196
- 235000001014 amino acid Nutrition 0.000 claims description 121
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 claims description 94
- 235000012000 cholesterol Nutrition 0.000 claims description 91
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 89
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 89
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 claims description 89
- 150000002632 lipids Chemical group 0.000 claims description 84
- 150000001413 amino acids Chemical group 0.000 claims description 77
- 229930195711 D-Serine Natural products 0.000 claims description 69
- 238000006467 substitution reaction Methods 0.000 claims description 63
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 claims description 62
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 claims description 59
- 125000006850 spacer group Chemical group 0.000 claims description 58
- 239000004220 glutamic acid Substances 0.000 claims description 55
- MTCFGRXMJLQNBG-UWTATZPHSA-N D-Serine Chemical compound OC[C@@H](N)C(O)=O MTCFGRXMJLQNBG-UWTATZPHSA-N 0.000 claims description 52
- 239000004472 Lysine Substances 0.000 claims description 52
- 150000003839 salts Chemical class 0.000 claims description 51
- 125000001312 palmitoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 claims description 47
- 125000006239 protecting group Chemical group 0.000 claims description 46
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 claims description 43
- 125000001301 ethoxy group Chemical group [H]C([H])([H])C([H])([H])O* 0.000 claims description 41
- KFHRMMHGGBCRIV-BYPYZUCNSA-N (2s)-2-azaniumyl-4-methoxybutanoate Chemical compound COCC[C@H](N)C(O)=O KFHRMMHGGBCRIV-BYPYZUCNSA-N 0.000 claims description 40
- 239000004475 Arginine Substances 0.000 claims description 38
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 38
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 claims description 37
- QWCKQJZIFLGMSD-GSVOUGTGSA-N D-alpha-aminobutyric acid Chemical compound CC[C@@H](N)C(O)=O QWCKQJZIFLGMSD-GSVOUGTGSA-N 0.000 claims description 36
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 claims description 35
- 210000004899 c-terminal region Anatomy 0.000 claims description 35
- 235000013922 glutamic acid Nutrition 0.000 claims description 35
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 claims description 32
- 125000003277 amino group Chemical group 0.000 claims description 30
- XGUXJMWPVJQIHI-YFKPBYRVSA-N (2s)-2-azaniumyl-3-cyclopropylpropanoate Chemical compound [O-]C(=O)[C@@H]([NH3+])CC1CC1 XGUXJMWPVJQIHI-YFKPBYRVSA-N 0.000 claims description 28
- RQVLGLPAZTUBKX-VKHMYHEASA-N L-vinylglycine Chemical compound C=C[C@H](N)C(O)=O RQVLGLPAZTUBKX-VKHMYHEASA-N 0.000 claims description 28
- QWCKQJZIFLGMSD-UHFFFAOYSA-N 2-Aminobutanoic acid Natural products CCC(N)C(O)=O QWCKQJZIFLGMSD-UHFFFAOYSA-N 0.000 claims description 25
- 229920000642 polymer Polymers 0.000 claims description 21
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 19
- 235000004279 alanine Nutrition 0.000 claims description 19
- 229930182817 methionine Natural products 0.000 claims description 19
- FVTVMQPGKVHSEY-UHFFFAOYSA-N 1-AMINOCYCLOBUTANE CARBOXYLIC ACID Chemical compound OC(=O)C1(N)CCC1 FVTVMQPGKVHSEY-UHFFFAOYSA-N 0.000 claims description 17
- 125000000734 D-serino group Chemical group [H]N([H])[C@@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 claims description 16
- 125000003396 thiol group Chemical group [H]S* 0.000 claims description 16
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 14
- WOXWUZCRWJWTRT-UHFFFAOYSA-N 1-amino-1-cyclohexanecarboxylic acid Chemical compound OC(=O)C1(N)CCCCC1 WOXWUZCRWJWTRT-UHFFFAOYSA-N 0.000 claims description 13
- NILQLFBWTXNUOE-UHFFFAOYSA-N 1-aminocyclopentanecarboxylic acid Chemical compound OC(=O)C1(N)CCCC1 NILQLFBWTXNUOE-UHFFFAOYSA-N 0.000 claims description 13
- PAJPWUMXBYXFCZ-UHFFFAOYSA-N 1-aminocyclopropanecarboxylic acid Chemical compound OC(=O)C1(N)CC1 PAJPWUMXBYXFCZ-UHFFFAOYSA-N 0.000 claims description 13
- TXHAHOVNFDVCCC-UHFFFAOYSA-N 2-(tert-butylazaniumyl)acetate Chemical compound CC(C)(C)NCC(O)=O TXHAHOVNFDVCCC-UHFFFAOYSA-N 0.000 claims description 13
- YXQOVXILWFIANY-UHFFFAOYSA-N 2-amino-2-cyclohexylpropanoic acid Chemical compound OC(=O)C(N)(C)C1CCCCC1 YXQOVXILWFIANY-UHFFFAOYSA-N 0.000 claims description 13
- SNDPXSYFESPGGJ-UHFFFAOYSA-N 2-aminopentanoic acid Chemical compound CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 claims description 13
- BXRLWGXPSRYJDZ-UHFFFAOYSA-N 3-cyanoalanine Chemical compound OC(=O)C(N)CC#N BXRLWGXPSRYJDZ-UHFFFAOYSA-N 0.000 claims description 13
- 229940123232 Glucagon receptor agonist Drugs 0.000 claims description 13
- 229940089838 Glucagon-like peptide 1 receptor agonist Drugs 0.000 claims description 13
- QEFRNWWLZKMPFJ-UHFFFAOYSA-N L-methionine sulphoxide Natural products CS(=O)CCC(N)C(O)=O QEFRNWWLZKMPFJ-UHFFFAOYSA-N 0.000 claims description 13
- DGYHPLMPMRKMPD-UHFFFAOYSA-N L-propargyl glycine Natural products OC(=O)C(N)CC#C DGYHPLMPMRKMPD-UHFFFAOYSA-N 0.000 claims description 13
- WNNNWFKQCKFSDK-UHFFFAOYSA-N allylglycine Chemical compound OC(=O)C(N)CC=C WNNNWFKQCKFSDK-UHFFFAOYSA-N 0.000 claims description 13
- RXQNHIDQIJXKTK-UHFFFAOYSA-N azane;pentanoic acid Chemical compound [NH4+].CCCCC([O-])=O RXQNHIDQIJXKTK-UHFFFAOYSA-N 0.000 claims description 13
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 claims description 13
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 claims description 12
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 claims description 11
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 claims description 11
- QEFRNWWLZKMPFJ-ZXPFJRLXSA-N L-methionine (R)-S-oxide Chemical compound C[S@@](=O)CC[C@H]([NH3+])C([O-])=O QEFRNWWLZKMPFJ-ZXPFJRLXSA-N 0.000 claims description 10
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 claims description 10
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 10
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 claims description 10
- 239000003877 glucagon like peptide 1 receptor agonist Substances 0.000 claims description 8
- 101800001388 Oxyntomodulin Proteins 0.000 abstract description 168
- 102400000319 Oxyntomodulin Human genes 0.000 abstract description 113
- 108010063919 Glucagon Receptors Proteins 0.000 abstract description 75
- 102100040890 Glucagon receptor Human genes 0.000 abstract description 73
- 208000008589 Obesity Diseases 0.000 abstract description 54
- 235000020824 obesity Nutrition 0.000 abstract description 54
- 108010086246 Glucagon-Like Peptide-1 Receptor Proteins 0.000 abstract description 50
- 238000001727 in vivo Methods 0.000 abstract description 49
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 abstract description 33
- 102100040918 Pro-glucagon Human genes 0.000 abstract description 33
- 238000011282 treatment Methods 0.000 abstract description 33
- 206010012601 diabetes mellitus Diseases 0.000 abstract description 20
- 208000030159 metabolic disease Diseases 0.000 abstract description 15
- DDYAPMZTJAYBOF-ZMYDTDHYSA-N (3S)-4-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S,3R)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-4-amino-1-[[(2S,3S)-1-[[(1S)-1-carboxyethyl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3R)-2-[[2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-amino-3-(1H-imidazol-4-yl)propanoyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]amino]-3-phenylpropanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxypropanoyl]amino]-3-carboxypropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-4-methylpentanoyl]amino]-3-carboxypropanoyl]amino]-3-hydroxypropanoyl]amino]-5-carbamimidamidopentanoyl]amino]-5-carbamimidamidopentanoyl]amino]propanoyl]amino]-5-oxopentanoyl]amino]-4-oxobutanoic acid Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O DDYAPMZTJAYBOF-ZMYDTDHYSA-N 0.000 abstract description 4
- 125000005647 linker group Chemical group 0.000 description 76
- 229940024606 amino acid Drugs 0.000 description 73
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 72
- 102000004196 processed proteins & peptides Human genes 0.000 description 72
- 125000003275 alpha amino acid group Chemical group 0.000 description 66
- -1 t-butyloxycarbonyl Chemical group 0.000 description 66
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 59
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 52
- 239000000556 agonist Substances 0.000 description 52
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 49
- 102000007446 Glucagon-Like Peptide-1 Receptor Human genes 0.000 description 48
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 48
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 46
- 241000699670 Mus sp. Species 0.000 description 45
- 230000037396 body weight Effects 0.000 description 45
- 235000012631 food intake Nutrition 0.000 description 44
- 239000008103 glucose Substances 0.000 description 44
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 42
- 230000037406 food intake Effects 0.000 description 42
- 239000003112 inhibitor Substances 0.000 description 42
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 35
- 229960003121 arginine Drugs 0.000 description 34
- 239000000203 mixture Substances 0.000 description 32
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 32
- 101800000224 Glucagon-like peptide 1 Proteins 0.000 description 31
- 239000000243 solution Substances 0.000 description 31
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 30
- 230000000694 effects Effects 0.000 description 29
- 229920001223 polyethylene glycol Polymers 0.000 description 29
- 239000002243 precursor Substances 0.000 description 29
- 150000001875 compounds Chemical class 0.000 description 25
- 239000003981 vehicle Substances 0.000 description 25
- 230000015572 biosynthetic process Effects 0.000 description 24
- 101800001442 Peptide pr Proteins 0.000 description 23
- 239000011347 resin Substances 0.000 description 23
- 229920005989 resin Polymers 0.000 description 23
- 238000003786 synthesis reaction Methods 0.000 description 23
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 22
- 229960004666 glucagon Drugs 0.000 description 21
- 230000036515 potency Effects 0.000 description 21
- 102000051325 Glucagon Human genes 0.000 description 20
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 20
- 108060003199 Glucagon Proteins 0.000 description 19
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 19
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 19
- 150000003573 thiols Chemical class 0.000 description 19
- 101000684208 Homo sapiens Prolyl endopeptidase FAP Proteins 0.000 description 18
- 238000007920 subcutaneous administration Methods 0.000 description 17
- 230000001684 chronic effect Effects 0.000 description 16
- 235000018417 cysteine Nutrition 0.000 description 16
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 16
- 238000011534 incubation Methods 0.000 description 16
- 238000004007 reversed phase HPLC Methods 0.000 description 16
- 210000002966 serum Anatomy 0.000 description 16
- 239000003643 water by type Substances 0.000 description 16
- 101500028776 Homo sapiens Oxyntomodulin Proteins 0.000 description 15
- 230000001154 acute effect Effects 0.000 description 15
- 239000005557 antagonist Substances 0.000 description 15
- JFDZBHWFFUWGJE-UHFFFAOYSA-N benzonitrile Chemical compound N#CC1=CC=CC=C1 JFDZBHWFFUWGJE-UHFFFAOYSA-N 0.000 description 15
- 239000000562 conjugate Substances 0.000 description 15
- 208000035475 disorder Diseases 0.000 description 15
- 210000004185 liver Anatomy 0.000 description 15
- 230000002829 reductive effect Effects 0.000 description 15
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 14
- 230000001976 improved effect Effects 0.000 description 14
- RYMZZMVNJRMUDD-HGQWONQESA-N simvastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)C(C)(C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 RYMZZMVNJRMUDD-HGQWONQESA-N 0.000 description 14
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 14
- 229960000583 acetic acid Drugs 0.000 description 13
- 238000003556 assay Methods 0.000 description 13
- 238000000338 in vitro Methods 0.000 description 13
- 238000001802 infusion Methods 0.000 description 13
- 230000037323 metabolic rate Effects 0.000 description 13
- 238000000034 method Methods 0.000 description 13
- 102000005962 receptors Human genes 0.000 description 13
- 108020003175 receptors Proteins 0.000 description 13
- 125000000446 sulfanediyl group Chemical group *S* 0.000 description 13
- UUUHXMGGBIUAPW-UHFFFAOYSA-N 1-[1-[2-[[5-amino-2-[[1-[5-(diaminomethylideneamino)-2-[[1-[3-(1h-indol-3-yl)-2-[(5-oxopyrrolidine-2-carbonyl)amino]propanoyl]pyrrolidine-2-carbonyl]amino]pentanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-3-methylpentanoyl]pyrrolidine-2-carbon Chemical compound C1CCC(C(=O)N2C(CCC2)C(O)=O)N1C(=O)C(C(C)CC)NC(=O)C(CCC(N)=O)NC(=O)C1CCCN1C(=O)C(CCCN=C(N)N)NC(=O)C1CCCN1C(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C1CCC(=O)N1 UUUHXMGGBIUAPW-UHFFFAOYSA-N 0.000 description 12
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 12
- 102000004270 Peptidyl-Dipeptidase A Human genes 0.000 description 12
- 108090000882 Peptidyl-Dipeptidase A Proteins 0.000 description 12
- 210000004027 cell Anatomy 0.000 description 12
- 238000006243 chemical reaction Methods 0.000 description 12
- 239000003480 eluent Substances 0.000 description 12
- 230000004116 glycogenolysis Effects 0.000 description 12
- 230000009467 reduction Effects 0.000 description 12
- 241000282412 Homo Species 0.000 description 11
- 239000002202 Polyethylene glycol Substances 0.000 description 11
- 239000003814 drug Substances 0.000 description 11
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 11
- 239000002904 solvent Substances 0.000 description 11
- 208000016261 weight loss Diseases 0.000 description 11
- 108090001061 Insulin Proteins 0.000 description 10
- 102000004877 Insulin Human genes 0.000 description 10
- 241001465754 Metazoa Species 0.000 description 10
- 239000002253 acid Substances 0.000 description 10
- 239000003795 chemical substances by application Substances 0.000 description 10
- 230000021615 conjugation Effects 0.000 description 10
- 229940125396 insulin Drugs 0.000 description 10
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 10
- 241000024188 Andala Species 0.000 description 9
- 229920002527 Glycogen Polymers 0.000 description 9
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 9
- 210000004369 blood Anatomy 0.000 description 9
- 239000008280 blood Substances 0.000 description 9
- 229940096919 glycogen Drugs 0.000 description 9
- 201000001421 hyperglycemia Diseases 0.000 description 9
- 238000007912 intraperitoneal administration Methods 0.000 description 9
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 8
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 8
- 239000007995 HEPES buffer Substances 0.000 description 8
- 101001015516 Homo sapiens Glucagon-like peptide 1 receptor Proteins 0.000 description 8
- 239000004201 L-cysteine Substances 0.000 description 8
- 208000001145 Metabolic Syndrome Diseases 0.000 description 8
- 238000001212 derivatisation Methods 0.000 description 8
- 231100000673 dose–response relationship Toxicity 0.000 description 8
- 150000004665 fatty acids Chemical group 0.000 description 8
- 238000007446 glucose tolerance test Methods 0.000 description 8
- 239000012071 phase Substances 0.000 description 8
- 230000004044 response Effects 0.000 description 8
- FRJNIHLOMXIQKH-UHFFFAOYSA-N 1-amino-15-oxo-4,7,10-trioxa-14-azaoctadecan-18-oic acid Chemical compound NCCCOCCOCCOCCCNC(=O)CCC(O)=O FRJNIHLOMXIQKH-UHFFFAOYSA-N 0.000 description 7
- DDTQLPXXNHLBAB-UHFFFAOYSA-N 2-(4-chlorophenyl)-2-[3-(trifluoromethyl)phenoxy]acetic acid Chemical compound C=1C=C(Cl)C=CC=1C(C(=O)O)OC1=CC=CC(C(F)(F)F)=C1 DDTQLPXXNHLBAB-UHFFFAOYSA-N 0.000 description 7
- DLFVBJFMPXGRIB-UHFFFAOYSA-N Acetamide Chemical compound CC(N)=O DLFVBJFMPXGRIB-UHFFFAOYSA-N 0.000 description 7
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 7
- 108010011459 Exenatide Proteins 0.000 description 7
- 206010020772 Hypertension Diseases 0.000 description 7
- 125000002252 acyl group Chemical group 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 235000005911 diet Nutrition 0.000 description 7
- 230000037213 diet Effects 0.000 description 7
- 238000009472 formulation Methods 0.000 description 7
- 210000003630 histaminocyte Anatomy 0.000 description 7
- 230000001965 increasing effect Effects 0.000 description 7
- 238000002347 injection Methods 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- AHLBNYSZXLDEJQ-FWEHEUNISA-N orlistat Chemical compound CCCCCCCCCCC[C@H](OC(=O)[C@H](CC(C)C)NC=O)C[C@@H]1OC(=O)[C@H]1CCCCCC AHLBNYSZXLDEJQ-FWEHEUNISA-N 0.000 description 7
- 230000002265 prevention Effects 0.000 description 7
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 7
- JMTMSDXUXJISAY-UHFFFAOYSA-N 2H-benzotriazol-4-ol Chemical compound OC1=CC=CC2=C1N=NN2 JMTMSDXUXJISAY-UHFFFAOYSA-N 0.000 description 6
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 6
- 239000005695 Ammonium acetate Substances 0.000 description 6
- 208000031648 Body Weight Changes Diseases 0.000 description 6
- 208000032928 Dyslipidaemia Diseases 0.000 description 6
- NTYJJOPFIAHURM-UHFFFAOYSA-N Histamine Chemical compound NCCC1=CN=CN1 NTYJJOPFIAHURM-UHFFFAOYSA-N 0.000 description 6
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 6
- QEFRNWWLZKMPFJ-YGVKFDHGSA-N L-methionine (R)-S-oxide group Chemical group N[C@@H](CCS(=O)C)C(=O)O QEFRNWWLZKMPFJ-YGVKFDHGSA-N 0.000 description 6
- BZLVMXJERCGZMT-UHFFFAOYSA-N Methyl tert-butyl ether Chemical compound COC(C)(C)C BZLVMXJERCGZMT-UHFFFAOYSA-N 0.000 description 6
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 6
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 6
- 150000001408 amides Chemical class 0.000 description 6
- 229940043376 ammonium acetate Drugs 0.000 description 6
- 235000019257 ammonium acetate Nutrition 0.000 description 6
- 230000004579 body weight change Effects 0.000 description 6
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 6
- UHBYWPGGCSDKFX-VKHMYHEASA-N gamma-carboxy-L-glutamic acid Chemical group OC(=O)[C@@H](N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-VKHMYHEASA-N 0.000 description 6
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 6
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 6
- 239000008188 pellet Substances 0.000 description 6
- 239000008194 pharmaceutical composition Substances 0.000 description 6
- 239000008196 pharmacological composition Substances 0.000 description 6
- 125000003003 spiro group Chemical group 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 230000004580 weight loss Effects 0.000 description 6
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 description 5
- 208000024172 Cardiovascular disease Diseases 0.000 description 5
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical group OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 5
- 101001040075 Homo sapiens Glucagon receptor Proteins 0.000 description 5
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 5
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical group C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 5
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical group OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 5
- 208000030514 Leukocyte adhesion deficiency type II Diseases 0.000 description 5
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 5
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 5
- 201000000690 abdominal obesity-metabolic syndrome Diseases 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 239000004480 active ingredient Substances 0.000 description 5
- 238000005917 acylation reaction Methods 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 201000001883 cholelithiasis Diseases 0.000 description 5
- 230000001186 cumulative effect Effects 0.000 description 5
- 229960001519 exenatide Drugs 0.000 description 5
- 229940088597 hormone Drugs 0.000 description 5
- 239000005556 hormone Substances 0.000 description 5
- 230000003345 hyperglycaemic effect Effects 0.000 description 5
- 238000001990 intravenous administration Methods 0.000 description 5
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 238000005259 measurement Methods 0.000 description 5
- 125000001419 myristoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 5
- 229960001243 orlistat Drugs 0.000 description 5
- 229940044601 receptor agonist Drugs 0.000 description 5
- 239000000018 receptor agonist Substances 0.000 description 5
- JZCPYUJPEARBJL-UHFFFAOYSA-N rimonabant Chemical compound CC=1C(C(=O)NN2CCCCC2)=NN(C=2C(=CC(Cl)=CC=2)Cl)C=1C1=CC=C(Cl)C=C1 JZCPYUJPEARBJL-UHFFFAOYSA-N 0.000 description 5
- UNAANXDKBXWMLN-UHFFFAOYSA-N sibutramine Chemical compound C=1C=C(Cl)C=CC=1C1(C(N(C)C)CC(C)C)CCC1 UNAANXDKBXWMLN-UHFFFAOYSA-N 0.000 description 5
- 125000003696 stearoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- 239000013585 weight reducing agent Substances 0.000 description 5
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 4
- 108010018763 Biotin carboxylase Proteins 0.000 description 4
- 238000011814 C57BL/6N mouse Methods 0.000 description 4
- IVOMOUWHDPKRLL-KQYNXXCUSA-N Cyclic adenosine monophosphate Chemical compound C([C@H]1O2)OP(O)(=O)O[C@H]1[C@@H](O)[C@@H]2N1C(N=CN=C2N)=C2N=C1 IVOMOUWHDPKRLL-KQYNXXCUSA-N 0.000 description 4
- HTQBXNHDCUEHJF-XWLPCZSASA-N Exenatide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 HTQBXNHDCUEHJF-XWLPCZSASA-N 0.000 description 4
- 206010018429 Glucose tolerance impaired Diseases 0.000 description 4
- 108010041872 Islet Amyloid Polypeptide Proteins 0.000 description 4
- 102000036770 Islet Amyloid Polypeptide Human genes 0.000 description 4
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- 108010016731 PPAR gamma Proteins 0.000 description 4
- 102000000536 PPAR gamma Human genes 0.000 description 4
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 4
- IVOMOUWHDPKRLL-UHFFFAOYSA-N UNPD107823 Natural products O1C2COP(O)(=O)OC2C(O)C1N1C(N=CN=C2N)=C2N=C1 IVOMOUWHDPKRLL-UHFFFAOYSA-N 0.000 description 4
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid group Chemical group C(C1=CC=CC=C1)(=O)O WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 4
- 235000019577 caloric intake Nutrition 0.000 description 4
- 229940095074 cyclic amp Drugs 0.000 description 4
- 235000014113 dietary fatty acids Nutrition 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 150000002148 esters Chemical class 0.000 description 4
- 239000003925 fat Substances 0.000 description 4
- 229930195729 fatty acid Natural products 0.000 description 4
- 239000000194 fatty acid Substances 0.000 description 4
- 239000012362 glacial acetic acid Substances 0.000 description 4
- PJJJBBJSCAKJQF-UHFFFAOYSA-N guanidinium chloride Chemical compound [Cl-].NC(N)=[NH2+] PJJJBBJSCAKJQF-UHFFFAOYSA-N 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 230000002503 metabolic effect Effects 0.000 description 4
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 4
- 201000008482 osteoarthritis Diseases 0.000 description 4
- 230000002093 peripheral effect Effects 0.000 description 4
- VYMDGNCVAMGZFE-UHFFFAOYSA-N phenylbutazonum Chemical compound O=C1C(CCCC)C(=O)N(C=2C=CC=CC=2)N1C1=CC=CC=C1 VYMDGNCVAMGZFE-UHFFFAOYSA-N 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 230000006337 proteolytic cleavage Effects 0.000 description 4
- 229960003015 rimonabant Drugs 0.000 description 4
- QZAYGJVTTNCVMB-UHFFFAOYSA-N serotonin Chemical compound C1=C(O)C=C2C(CCN)=CNC2=C1 QZAYGJVTTNCVMB-UHFFFAOYSA-N 0.000 description 4
- 238000001542 size-exclusion chromatography Methods 0.000 description 4
- 239000007790 solid phase Substances 0.000 description 4
- 125000001424 substituent group Chemical group 0.000 description 4
- 238000001356 surgical procedure Methods 0.000 description 4
- 150000003568 thioethers Chemical class 0.000 description 4
- KFNNPQDSPLWLCX-UHFFFAOYSA-N 1-[1-(4-chlorophenyl)cyclobutyl]-n,n,3-trimethylbutan-1-amine;hydron;chloride;hydrate Chemical compound O.Cl.C=1C=C(Cl)C=CC=1C1(C(N(C)C)CC(C)C)CCC1 KFNNPQDSPLWLCX-UHFFFAOYSA-N 0.000 description 3
- QBQLYIISSRXYKL-UHFFFAOYSA-N 4-[[4-[2-(5-methyl-2-phenyl-1,3-oxazol-4-yl)ethoxy]phenyl]methyl]-1,2-oxazolidine-3,5-dione Chemical compound CC=1OC(C=2C=CC=CC=2)=NC=1CCOC(C=C1)=CC=C1CC1C(=O)NOC1=O QBQLYIISSRXYKL-UHFFFAOYSA-N 0.000 description 3
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 3
- 239000002083 C09CA01 - Losartan Substances 0.000 description 3
- 238000011740 C57BL/6 mouse Methods 0.000 description 3
- 241000282472 Canis lupus familiaris Species 0.000 description 3
- 108010078791 Carrier Proteins Proteins 0.000 description 3
- 229920001268 Cholestyramine Polymers 0.000 description 3
- 229920002905 Colesevelam Polymers 0.000 description 3
- 241000282326 Felis catus Species 0.000 description 3
- 208000002705 Glucose Intolerance Diseases 0.000 description 3
- 206010056997 Impaired fasting glucose Diseases 0.000 description 3
- 206010022489 Insulin Resistance Diseases 0.000 description 3
- 208000017170 Lipid metabolism disease Diseases 0.000 description 3
- 238000005481 NMR spectroscopy Methods 0.000 description 3
- 206010028813 Nausea Diseases 0.000 description 3
- 206010035004 Pickwickian syndrome Diseases 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- RYMZZMVNJRMUDD-UHFFFAOYSA-N SJ000286063 Natural products C12C(OC(=O)C(C)(C)CC)CC(C)C=C2C=CC(C)C1CCC1CC(O)CC(=O)O1 RYMZZMVNJRMUDD-UHFFFAOYSA-N 0.000 description 3
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 3
- KJADKKWYZYXHBB-XBWDGYHZSA-N Topiramic acid Chemical compound C1O[C@@]2(COS(N)(=O)=O)OC(C)(C)O[C@H]2[C@@H]2OC(C)(C)O[C@@H]21 KJADKKWYZYXHBB-XBWDGYHZSA-N 0.000 description 3
- 201000010390 abdominal obesity-metabolic syndrome 1 Diseases 0.000 description 3
- 239000012190 activator Substances 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 230000001539 anorectic effect Effects 0.000 description 3
- 230000003466 anti-cipated effect Effects 0.000 description 3
- 239000003613 bile acid Substances 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 238000013262 cAMP assay Methods 0.000 description 3
- 239000004202 carbamide Substances 0.000 description 3
- 210000003169 central nervous system Anatomy 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 238000013270 controlled release Methods 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 235000013305 food Nutrition 0.000 description 3
- 208000001130 gallstones Diseases 0.000 description 3
- 210000001035 gastrointestinal tract Anatomy 0.000 description 3
- GNKDKYIHGQKHHM-RJKLHVOGSA-N ghrelin Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)CN)COC(=O)CCCCCCC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C1=CC=CC=C1 GNKDKYIHGQKHHM-RJKLHVOGSA-N 0.000 description 3
- 230000004153 glucose metabolism Effects 0.000 description 3
- 125000002791 glucosyl group Chemical group C1([C@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 3
- 230000002641 glycemic effect Effects 0.000 description 3
- 235000009200 high fat diet Nutrition 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- 229960001340 histamine Drugs 0.000 description 3
- 102000056448 human GLP1R Human genes 0.000 description 3
- 230000002473 insulinotropic effect Effects 0.000 description 3
- 238000007914 intraventricular administration Methods 0.000 description 3
- 238000010829 isocratic elution Methods 0.000 description 3
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 229960004773 losartan Drugs 0.000 description 3
- KJJZZJSZUJXYEA-UHFFFAOYSA-N losartan Chemical compound CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C=2[N]N=NN=2)C=C1 KJJZZJSZUJXYEA-UHFFFAOYSA-N 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 229940045623 meridia Drugs 0.000 description 3
- 208000011661 metabolic syndrome X Diseases 0.000 description 3
- XZWYZXLIPXDOLR-UHFFFAOYSA-N metformin Chemical compound CN(C)C(=N)NC(N)=N XZWYZXLIPXDOLR-UHFFFAOYSA-N 0.000 description 3
- 229960003105 metformin Drugs 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- OELFLUMRDSZNSF-BRWVUGGUSA-N nateglinide Chemical compound C1C[C@@H](C(C)C)CC[C@@H]1C(=O)N[C@@H](C(O)=O)CC1=CC=CC=C1 OELFLUMRDSZNSF-BRWVUGGUSA-N 0.000 description 3
- 230000008693 nausea Effects 0.000 description 3
- PKWDZWYVIHVNKS-UHFFFAOYSA-N netoglitazone Chemical compound FC1=CC=CC=C1COC1=CC=C(C=C(CC2C(NC(=O)S2)=O)C=C2)C2=C1 PKWDZWYVIHVNKS-UHFFFAOYSA-N 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 235000015097 nutrients Nutrition 0.000 description 3
- 230000006320 pegylation Effects 0.000 description 3
- 230000000144 pharmacologic effect Effects 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 235000018102 proteins Nutrition 0.000 description 3
- 102000004169 proteins and genes Human genes 0.000 description 3
- 108090000623 proteins and genes Proteins 0.000 description 3
- 230000017854 proteolysis Effects 0.000 description 3
- 230000009257 reactivity Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 229960004425 sibutramine Drugs 0.000 description 3
- 229960002855 simvastatin Drugs 0.000 description 3
- MFFMDFFZMYYVKS-SECBINFHSA-N sitagliptin Chemical compound C([C@H](CC(=O)N1CC=2N(C(=NN=2)C(F)(F)F)CC1)N)C1=CC(F)=C(F)C=C1F MFFMDFFZMYYVKS-SECBINFHSA-N 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 230000004936 stimulating effect Effects 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 230000009885 systemic effect Effects 0.000 description 3
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 3
- 229960004394 topiramate Drugs 0.000 description 3
- 125000002221 trityl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])=C1C([*])(C1=C(C(=C(C(=C1[H])[H])[H])[H])[H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 3
- 235000019786 weight gain Nutrition 0.000 description 3
- XUFXOAAUWZOOIT-SXARVLRPSA-N (2R,3R,4R,5S,6R)-5-[[(2R,3R,4R,5S,6R)-5-[[(2R,3R,4S,5S,6R)-3,4-dihydroxy-6-methyl-5-[[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)-1-cyclohex-2-enyl]amino]-2-oxanyl]oxy]-3,4-dihydroxy-6-(hydroxymethyl)-2-oxanyl]oxy]-6-(hydroxymethyl)oxane-2,3,4-triol Chemical compound O([C@H]1O[C@H](CO)[C@H]([C@@H]([C@H]1O)O)O[C@H]1O[C@@H]([C@H]([C@H](O)[C@H]1O)N[C@@H]1[C@@H]([C@@H](O)[C@H](O)C(CO)=C1)O)C)[C@@H]1[C@@H](CO)O[C@@H](O)[C@H](O)[C@H]1O XUFXOAAUWZOOIT-SXARVLRPSA-N 0.000 description 2
- FOZFSEMFCIPOSZ-SPCKQMHLSA-N (2r,3r,4r,5s)-2-(hydroxymethyl)-1-[[(2r,3s,4s,5r,6s)-3,4,5-trihydroxy-6-methoxyoxan-2-yl]methyl]piperidine-3,4,5-triol;trihydrate Chemical compound O.O.O.O[C@H]1[C@H](O)[C@@H](O)[C@@H](OC)O[C@@H]1CN1[C@H](CO)[C@@H](O)[C@H](O)[C@@H](O)C1.O[C@H]1[C@H](O)[C@@H](O)[C@@H](OC)O[C@@H]1CN1[C@H](CO)[C@@H](O)[C@H](O)[C@@H](O)C1 FOZFSEMFCIPOSZ-SPCKQMHLSA-N 0.000 description 2
- HAQIRIMIVLFYIX-ZFWWWQNUSA-N (2s)-1-[(2s)-2-aminobutanoyl]-n-butyl-2,3-dihydroindole-2-carboxamide Chemical compound C1=CC=C2N(C(=O)[C@@H](N)CC)[C@H](C(=O)NCCCC)CC2=C1 HAQIRIMIVLFYIX-ZFWWWQNUSA-N 0.000 description 2
- OYXZPXVCRAAKCM-SANMLTNESA-N (2s)-2-[(2-methylpropan-2-yl)oxycarbonylamino]-3-(1-tritylimidazol-4-yl)propanoic acid Chemical compound C1=NC(C[C@H](NC(=O)OC(C)(C)C)C(O)=O)=CN1C(C=1C=CC=CC=1)(C=1C=CC=CC=1)C1=CC=CC=C1 OYXZPXVCRAAKCM-SANMLTNESA-N 0.000 description 2
- HSINOMROUCMIEA-FGVHQWLLSA-N (2s,4r)-4-[(3r,5s,6r,7r,8s,9s,10s,13r,14s,17r)-6-ethyl-3,7-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]-2-methylpentanoic acid Chemical compound C([C@@]12C)C[C@@H](O)C[C@H]1[C@@H](CC)[C@@H](O)[C@@H]1[C@@H]2CC[C@]2(C)[C@@H]([C@H](C)C[C@H](C)C(O)=O)CC[C@H]21 HSINOMROUCMIEA-FGVHQWLLSA-N 0.000 description 2
- AXJQVVLKUYCICH-OAQYLSRUSA-N (4s)-5-(4-chlorophenyl)-n-(4-chlorophenyl)sulfonyl-n'-methyl-4-phenyl-3,4-dihydropyrazole-2-carboximidamide Chemical compound C=1C=C(Cl)C=CC=1C([C@H](C1)C=2C=CC=CC=2)=NN1C(=NC)NS(=O)(=O)C1=CC=C(Cl)C=C1 AXJQVVLKUYCICH-OAQYLSRUSA-N 0.000 description 2
- RTHCYVBBDHJXIQ-MRXNPFEDSA-N (R)-fluoxetine Chemical compound O([C@H](CCNC)C=1C=CC=CC=1)C1=CC=C(C(F)(F)F)C=C1 RTHCYVBBDHJXIQ-MRXNPFEDSA-N 0.000 description 2
- FGTDNJHSEFINNG-UHFFFAOYSA-N 1,13-dihydroxy-2,2,12,12-tetramethyltridecan-7-one Chemical compound OCC(C)(C)CCCCC(=O)CCCCC(C)(C)CO FGTDNJHSEFINNG-UHFFFAOYSA-N 0.000 description 2
- 102000008645 11-beta-Hydroxysteroid Dehydrogenase Type 1 Human genes 0.000 description 2
- 108010088011 11-beta-Hydroxysteroid Dehydrogenase Type 1 Proteins 0.000 description 2
- VTAKZNRDSPNOAU-UHFFFAOYSA-M 2-(chloromethyl)oxirane;hydron;prop-2-en-1-amine;n-prop-2-enyldecan-1-amine;trimethyl-[6-(prop-2-enylamino)hexyl]azanium;dichloride Chemical compound Cl.[Cl-].NCC=C.ClCC1CO1.CCCCCCCCCCNCC=C.C[N+](C)(C)CCCCCCNCC=C VTAKZNRDSPNOAU-UHFFFAOYSA-M 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- DJQYYYCQOZMCRC-UHFFFAOYSA-N 2-aminopropane-1,3-dithiol Chemical compound SCC(N)CS DJQYYYCQOZMCRC-UHFFFAOYSA-N 0.000 description 2
- UZOOGOCMUARFDV-KEZCGYQASA-N 3-[[(2s)-2-(2-adamantyloxycarbonylamino)-3-(1h-indol-3-yl)-2-methylpropanoyl]amino]-4-(4-fluorophenyl)butanoic acid Chemical compound O=C([C@](CC=1C2=CC=CC=C2NC=1)(NC(=O)OC1C2CC3CC(C2)CC1C3)C)NC(CC(O)=O)CC1=CC=C(F)C=C1 UZOOGOCMUARFDV-KEZCGYQASA-N 0.000 description 2
- CABBMMXFOOZVMS-PMERELPUSA-N 3-[[(3s)-2,4-dioxo-1-[2-oxo-2-(n-propan-2-ylanilino)ethyl]-5-phenyl-1,5-benzodiazepin-3-yl]carbamoylamino]benzoic acid Chemical compound C=1C=CC=CC=1N(C(C)C)C(=O)CN(C([C@H](NC(=O)NC=1C=C(C=CC=1)C(O)=O)C1=O)=O)C2=CC=CC=C2N1C1=CC=CC=C1 CABBMMXFOOZVMS-PMERELPUSA-N 0.000 description 2
- 238000004679 31P NMR spectroscopy Methods 0.000 description 2
- PVFOHMXILQEIHX-UHFFFAOYSA-N 8-[(6-bromo-1,3-benzodioxol-5-yl)sulfanyl]-9-[2-(2-bromophenyl)ethyl]purin-6-amine Chemical compound C=1C=2OCOC=2C=C(Br)C=1SC1=NC=2C(N)=NC=NC=2N1CCC1=CC=CC=C1Br PVFOHMXILQEIHX-UHFFFAOYSA-N 0.000 description 2
- 102000000452 Acetyl-CoA carboxylase Human genes 0.000 description 2
- 108010016219 Acetyl-CoA carboxylase Proteins 0.000 description 2
- 102100021641 Acetyl-CoA carboxylase 2 Human genes 0.000 description 2
- 101710159293 Acyl-CoA desaturase 1 Proteins 0.000 description 2
- 102100027840 Acyl-CoA wax alcohol acyltransferase 1 Human genes 0.000 description 2
- 102100022089 Acyl-[acyl-carrier-protein] hydrolase Human genes 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 2
- 206010003210 Arteriosclerosis Diseases 0.000 description 2
- XUKUURHRXDUEBC-KAYWLYCHSA-N Atorvastatin Chemical compound C=1C=CC=CC=1C1=C(C=2C=CC(F)=CC=2)N(CC[C@@H](O)C[C@@H](O)CC(O)=O)C(C(C)C)=C1C(=O)NC1=CC=CC=C1 XUKUURHRXDUEBC-KAYWLYCHSA-N 0.000 description 2
- XUKUURHRXDUEBC-UHFFFAOYSA-N Atorvastatin Natural products C=1C=CC=CC=1C1=C(C=2C=CC(F)=CC=2)N(CCC(O)CC(O)CC(O)=O)C(C(C)C)=C1C(=O)NC1=CC=CC=C1 XUKUURHRXDUEBC-UHFFFAOYSA-N 0.000 description 2
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 2
- 102100028628 Bombesin receptor subtype-3 Human genes 0.000 description 2
- YNXLOPYTAAFMTN-SBUIBGKBSA-N C([C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)C1=CC=C(O)C=C1 Chemical compound C([C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)C1=CC=C(O)C=C1 YNXLOPYTAAFMTN-SBUIBGKBSA-N 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 241001227713 Chiron Species 0.000 description 2
- RKWGIWYCVPQPMF-UHFFFAOYSA-N Chloropropamide Chemical compound CCCNC(=O)NS(=O)(=O)C1=CC=C(Cl)C=C1 RKWGIWYCVPQPMF-UHFFFAOYSA-N 0.000 description 2
- JZUFKLXOESDKRF-UHFFFAOYSA-N Chlorothiazide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC2=C1NCNS2(=O)=O JZUFKLXOESDKRF-UHFFFAOYSA-N 0.000 description 2
- 229920002911 Colestipol Polymers 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 108010039731 Fatty Acid Synthases Proteins 0.000 description 2
- 102100026148 Free fatty acid receptor 1 Human genes 0.000 description 2
- 101710142060 Free fatty acid receptor 1 Proteins 0.000 description 2
- HEMJJKBWTPKOJG-UHFFFAOYSA-N Gemfibrozil Chemical compound CC1=CC=C(C)C(OCCCC(C)(C)C(O)=O)=C1 HEMJJKBWTPKOJG-UHFFFAOYSA-N 0.000 description 2
- 101800001586 Ghrelin Proteins 0.000 description 2
- 102000000393 Ghrelin Receptors Human genes 0.000 description 2
- 108010016122 Ghrelin Receptors Proteins 0.000 description 2
- 102400000442 Ghrelin-28 Human genes 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 201000005569 Gout Diseases 0.000 description 2
- RPTUSVTUFVMDQK-UHFFFAOYSA-N Hidralazin Chemical compound C1=CC=C2C(NN)=NN=CC2=C1 RPTUSVTUFVMDQK-UHFFFAOYSA-N 0.000 description 2
- 101000698136 Homo sapiens Acyl-CoA wax alcohol acyltransferase 1 Proteins 0.000 description 2
- 241001504226 Hoodia Species 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 2
- 208000035150 Hypercholesterolemia Diseases 0.000 description 2
- 208000031226 Hyperlipidaemia Diseases 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 108010065920 Insulin Lispro Proteins 0.000 description 2
- 208000031773 Insulin resistance syndrome Diseases 0.000 description 2
- 239000007760 Iscove's Modified Dulbecco's Medium Substances 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- 102000007330 LDL Lipoproteins Human genes 0.000 description 2
- 108010007622 LDL Lipoproteins Proteins 0.000 description 2
- 102000016267 Leptin Human genes 0.000 description 2
- 108010092277 Leptin Proteins 0.000 description 2
- 229940127470 Lipase Inhibitors Drugs 0.000 description 2
- 102100023113 Long-chain fatty acid transport protein 4 Human genes 0.000 description 2
- 101710109661 Long-chain fatty acid transport protein 4 Proteins 0.000 description 2
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 102400001132 Melanin-concentrating hormone Human genes 0.000 description 2
- 101800002739 Melanin-concentrating hormone Proteins 0.000 description 2
- 101710151321 Melanostatin Proteins 0.000 description 2
- 102000015494 Mitochondrial Uncoupling Proteins Human genes 0.000 description 2
- 108010050258 Mitochondrial Uncoupling Proteins Proteins 0.000 description 2
- YNAVUWVOSKDBBP-UHFFFAOYSA-N Morpholine Chemical compound C1COCCN1 YNAVUWVOSKDBBP-UHFFFAOYSA-N 0.000 description 2
- 101001015515 Mus musculus Glucagon-like peptide 1 receptor Proteins 0.000 description 2
- RXSVYGIGWRDVQC-UHFFFAOYSA-N N-[6-[[(cyclohexylideneamino)oxy-oxomethyl]amino]hexyl]carbamic acid (cyclohexylideneamino) ester Chemical compound C1CCCCC1=NOC(=O)NCCCCCCNC(=O)ON=C1CCCCC1 RXSVYGIGWRDVQC-UHFFFAOYSA-N 0.000 description 2
- AHLBNYSZXLDEJQ-UHFFFAOYSA-N N-formyl-L-leucylester Natural products CCCCCCCCCCCC(OC(=O)C(CC(C)C)NC=O)CC1OC(=O)C1CCCCCC AHLBNYSZXLDEJQ-UHFFFAOYSA-N 0.000 description 2
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 2
- WJBLNOPPDWQMCH-MBPVOVBZSA-N Nalmefene Chemical compound N1([C@@H]2CC3=CC=C(C=4O[C@@H]5[C@](C3=4)([C@]2(CCC5=C)O)CC1)O)CC1CC1 WJBLNOPPDWQMCH-MBPVOVBZSA-N 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 102400000064 Neuropeptide Y Human genes 0.000 description 2
- PVNIIMVLHYAWGP-UHFFFAOYSA-N Niacin Chemical compound OC(=O)C1=CC=CN=C1 PVNIIMVLHYAWGP-UHFFFAOYSA-N 0.000 description 2
- 241000208125 Nicotiana Species 0.000 description 2
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 2
- 108010015847 Non-Receptor Type 1 Protein Tyrosine Phosphatase Proteins 0.000 description 2
- 102000023984 PPAR alpha Human genes 0.000 description 2
- QGMRQYFBGABWDR-UHFFFAOYSA-M Pentobarbital sodium Chemical compound [Na+].CCCC(C)C1(CC)C(=O)NC(=O)[N-]C1=O QGMRQYFBGABWDR-UHFFFAOYSA-M 0.000 description 2
- 108010088847 Peptide YY Proteins 0.000 description 2
- 102100029909 Peptide YY Human genes 0.000 description 2
- 102000003728 Peroxisome Proliferator-Activated Receptors Human genes 0.000 description 2
- 108090000029 Peroxisome Proliferator-Activated Receptors Proteins 0.000 description 2
- 102000004861 Phosphoric Diester Hydrolases Human genes 0.000 description 2
- 108090001050 Phosphoric Diester Hydrolases Proteins 0.000 description 2
- GLUUGHFHXGJENI-UHFFFAOYSA-N Piperazine Chemical compound C1CNCCN1 GLUUGHFHXGJENI-UHFFFAOYSA-N 0.000 description 2
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 2
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 2
- 102000053067 Pyruvate Dehydrogenase Acetyl-Transferring Kinase Human genes 0.000 description 2
- YASAKCUCGLMORW-UHFFFAOYSA-N Rosiglitazone Chemical compound C=1C=CC=NC=1N(C)CCOC(C=C1)=CC=C1CC1SC(=O)NC1=O YASAKCUCGLMORW-UHFFFAOYSA-N 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- QLYKJCMUNUWAGO-GAJHUEQPSA-N Taranabant Chemical compound N([C@@H](C)[C@@H](CC=1C=CC(Cl)=CC=1)C=1C=C(C=CC=1)C#N)C(=O)C(C)(C)OC1=CC=C(C(F)(F)F)C=N1 QLYKJCMUNUWAGO-GAJHUEQPSA-N 0.000 description 2
- 102100033001 Tyrosine-protein phosphatase non-receptor type 1 Human genes 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical group CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 101710159466 [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial Proteins 0.000 description 2
- 230000009102 absorption Effects 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 229960002632 acarbose Drugs 0.000 description 2
- XUFXOAAUWZOOIT-UHFFFAOYSA-N acarviostatin I01 Natural products OC1C(O)C(NC2C(C(O)C(O)C(CO)=C2)O)C(C)OC1OC(C(C1O)O)C(CO)OC1OC1C(CO)OC(O)C(O)C1O XUFXOAAUWZOOIT-UHFFFAOYSA-N 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000001270 agonistic effect Effects 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 239000000883 anti-obesity agent Substances 0.000 description 2
- 229940125710 antiobesity agent Drugs 0.000 description 2
- 210000003295 arcuate nucleus Anatomy 0.000 description 2
- 208000011775 arteriosclerosis disease Diseases 0.000 description 2
- 229960005370 atorvastatin Drugs 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 239000002876 beta blocker Substances 0.000 description 2
- 102000007478 beta-N-Acetylhexosaminidases Human genes 0.000 description 2
- 108010085377 beta-N-Acetylhexosaminidases Proteins 0.000 description 2
- 230000027455 binding Effects 0.000 description 2
- 108010063504 bombesin receptor subtype 3 Proteins 0.000 description 2
- 210000004556 brain Anatomy 0.000 description 2
- KDPAWGWELVVRCH-UHFFFAOYSA-M bromoacetate Chemical compound [O-]C(=O)CBr KDPAWGWELVVRCH-UHFFFAOYSA-M 0.000 description 2
- GZUXJHMPEANEGY-UHFFFAOYSA-N bromomethane Chemical compound BrC GZUXJHMPEANEGY-UHFFFAOYSA-N 0.000 description 2
- SNPPWIUOZRMYNY-UHFFFAOYSA-N bupropion Chemical compound CC(C)(C)NC(C)C(=O)C1=CC=CC(Cl)=C1 SNPPWIUOZRMYNY-UHFFFAOYSA-N 0.000 description 2
- RYYVLZVUVIJVGH-UHFFFAOYSA-N caffeine Chemical compound CN1C(=O)N(C)C(=O)C2=C1N=CN2C RYYVLZVUVIJVGH-UHFFFAOYSA-N 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- QEVLNUAVAONTEW-UZYHXJQGSA-L calcium;(2s)-4-[(3as,7ar)-1,3,3a,4,5,6,7,7a-octahydroisoindol-2-yl]-2-benzyl-4-oxobutanoate;dihydrate Chemical compound O.O.[Ca+2].C([C@@H](CC(=O)N1C[C@@H]2CCCC[C@@H]2C1)C(=O)[O-])C1=CC=CC=C1.C([C@@H](CC(=O)N1C[C@@H]2CCCC[C@@H]2C1)C(=O)[O-])C1=CC=CC=C1 QEVLNUAVAONTEW-UZYHXJQGSA-L 0.000 description 2
- 238000005277 cation exchange chromatography Methods 0.000 description 2
- 238000000423 cell based assay Methods 0.000 description 2
- JUFFVKRROAPVBI-PVOYSMBESA-N chembl1210015 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@]3(O[C@@H](C[C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C3)C(O)=O)O2)O)[C@@H](CO)O1)NC(C)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 JUFFVKRROAPVBI-PVOYSMBESA-N 0.000 description 2
- KNHUKKLJHYUCFP-UHFFFAOYSA-N clofibrate Chemical compound CCOC(=O)C(C)(C)OC1=CC=C(Cl)C=C1 KNHUKKLJHYUCFP-UHFFFAOYSA-N 0.000 description 2
- 239000013256 coordination polymer Substances 0.000 description 2
- 208000029078 coronary artery disease Diseases 0.000 description 2
- 238000003100 counter screening assay Methods 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Substances CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 238000009207 exercise therapy Methods 0.000 description 2
- OLNTVTPDXPETLC-XPWALMASSA-N ezetimibe Chemical compound N1([C@@H]([C@H](C1=O)CC[C@H](O)C=1C=CC(F)=CC=1)C=1C=CC(O)=CC=1)C1=CC=C(F)C=C1 OLNTVTPDXPETLC-XPWALMASSA-N 0.000 description 2
- 229960000815 ezetimibe Drugs 0.000 description 2
- 230000002349 favourable effect Effects 0.000 description 2
- YMTINGFKWWXKFG-UHFFFAOYSA-N fenofibrate Chemical compound C1=CC(OC(C)(C)C(=O)OC(C)C)=CC=C1C(=O)C1=CC=C(Cl)C=C1 YMTINGFKWWXKFG-UHFFFAOYSA-N 0.000 description 2
- 229960002464 fluoxetine Drugs 0.000 description 2
- 230000030136 gastric emptying Effects 0.000 description 2
- 208000004104 gestational diabetes Diseases 0.000 description 2
- 229960004580 glibenclamide Drugs 0.000 description 2
- 230000001890 gluconeogenic effect Effects 0.000 description 2
- ZNNLBTZKUZBEKO-UHFFFAOYSA-N glyburide Chemical compound COC1=CC=C(Cl)C=C1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)NC2CCCCC2)C=C1 ZNNLBTZKUZBEKO-UHFFFAOYSA-N 0.000 description 2
- KWIUHFFTVRNATP-UHFFFAOYSA-N glycine betaine Chemical compound C[N+](C)(C)CC([O-])=O KWIUHFFTVRNATP-UHFFFAOYSA-N 0.000 description 2
- 230000035876 healing Effects 0.000 description 2
- 230000002440 hepatic effect Effects 0.000 description 2
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- XGIHQYAWBCFNPY-AZOCGYLKSA-N hydrabamine Chemical compound C([C@@H]12)CC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC[C@@]1(C)CNCCNC[C@@]1(C)[C@@H]2CCC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC1 XGIHQYAWBCFNPY-AZOCGYLKSA-N 0.000 description 2
- 229960002003 hydrochlorothiazide Drugs 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 208000006575 hypertriglyceridemia Diseases 0.000 description 2
- 230000001771 impaired effect Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 208000000509 infertility Diseases 0.000 description 2
- 230000036512 infertility Effects 0.000 description 2
- 231100000535 infertility Toxicity 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 150000007529 inorganic bases Chemical class 0.000 description 2
- 229910052816 inorganic phosphate Inorganic materials 0.000 description 2
- 230000003914 insulin secretion Effects 0.000 description 2
- 210000004153 islets of langerhan Anatomy 0.000 description 2
- 238000011813 knockout mouse model Methods 0.000 description 2
- 229940039781 leptin Drugs 0.000 description 2
- 239000011777 magnesium Substances 0.000 description 2
- 229910052749 magnesium Inorganic materials 0.000 description 2
- ORRDHOMWDPJSNL-UHFFFAOYSA-N melanin concentrating hormone Chemical compound N1C(=O)C(C(C)C)NC(=O)C(CCCNC(N)=N)NC(=O)CNC(=O)C(C(C)C)NC(=O)C(CCSC)NC(=O)C(NC(=O)C(CCCNC(N)=N)NC(=O)C(NC(=O)C(NC(=O)C(N)CC(O)=O)C(C)O)CCSC)CSSCC(C(=O)NC(CC=2C3=CC=CC=C3NC=2)C(=O)NC(CCC(O)=O)C(=O)NC(C(C)C)C(O)=O)NC(=O)C2CCCN2C(=O)C(CCCNC(N)=N)NC(=O)C1CC1=CC=C(O)C=C1 ORRDHOMWDPJSNL-UHFFFAOYSA-N 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 208000010125 myocardial infarction Diseases 0.000 description 2
- DQCKKXVULJGBQN-XFWGSAIBSA-N naltrexone Chemical compound N1([C@@H]2CC3=CC=C(C=4O[C@@H]5[C@](C3=4)([C@]2(CCC5=O)O)CC1)O)CC1CC1 DQCKKXVULJGBQN-XFWGSAIBSA-N 0.000 description 2
- 229960003086 naltrexone Drugs 0.000 description 2
- 229960000698 nateglinide Drugs 0.000 description 2
- 229940105631 nembutal Drugs 0.000 description 2
- 229960003512 nicotinic acid Drugs 0.000 description 2
- 235000001968 nicotinic acid Nutrition 0.000 description 2
- 239000011664 nicotinic acid Substances 0.000 description 2
- 230000000966 norepinephrine reuptake Effects 0.000 description 2
- URPYMXQQVHTUDU-OFGSCBOVSA-N nucleopeptide y Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 URPYMXQQVHTUDU-OFGSCBOVSA-N 0.000 description 2
- 235000016709 nutrition Nutrition 0.000 description 2
- 108091008725 peroxisome proliferator-activated receptors alpha Proteins 0.000 description 2
- 230000003285 pharmacodynamic effect Effects 0.000 description 2
- 238000001050 pharmacotherapy Methods 0.000 description 2
- DHHVAGZRUROJKS-UHFFFAOYSA-N phentermine Chemical compound CC(C)(N)CC1=CC=CC=C1 DHHVAGZRUROJKS-UHFFFAOYSA-N 0.000 description 2
- 229960002797 pitavastatin Drugs 0.000 description 2
- VGYFMXBACGZSIL-MCBHFWOFSA-N pitavastatin Chemical compound OC(=O)C[C@H](O)C[C@H](O)\C=C\C1=C(C2CC2)N=C2C=CC=CC2=C1C1=CC=C(F)C=C1 VGYFMXBACGZSIL-MCBHFWOFSA-N 0.000 description 2
- 201000010065 polycystic ovary syndrome Diseases 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 210000003240 portal vein Anatomy 0.000 description 2
- 239000011591 potassium Substances 0.000 description 2
- 229910052700 potassium Inorganic materials 0.000 description 2
- 108010029667 pramlintide Proteins 0.000 description 2
- NRKVKVQDUCJPIZ-MKAGXXMWSA-N pramlintide acetate Chemical compound C([C@@H](C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 NRKVKVQDUCJPIZ-MKAGXXMWSA-N 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- LCTONWCANYUPML-VQEHIDDOSA-N pyruvic -2-13c acid Chemical compound C[13C](=O)C(O)=O LCTONWCANYUPML-VQEHIDDOSA-N 0.000 description 2
- 229940044551 receptor antagonist Drugs 0.000 description 2
- 239000002464 receptor antagonist Substances 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000000284 resting effect Effects 0.000 description 2
- 229960000672 rosuvastatin Drugs 0.000 description 2
- BPRHUIZQVSMCRT-VEUZHWNKSA-N rosuvastatin Chemical compound CC(C)C1=NC(N(C)S(C)(=O)=O)=NC(C=2C=CC(F)=CC=2)=C1\C=C\[C@@H](O)C[C@@H](O)CC(O)=O BPRHUIZQVSMCRT-VEUZHWNKSA-N 0.000 description 2
- 229940076279 serotonin Drugs 0.000 description 2
- BNRNXUUZRGQAQC-UHFFFAOYSA-N sildenafil Chemical compound CCCC1=NN(C)C(C(N2)=O)=C1N=C2C(C(=CC=1)OCC)=CC=1S(=O)(=O)N1CCN(C)CC1 BNRNXUUZRGQAQC-UHFFFAOYSA-N 0.000 description 2
- 229960004034 sitagliptin Drugs 0.000 description 2
- 201000002859 sleep apnea Diseases 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 230000000946 synaptic effect Effects 0.000 description 2
- RMMXLENWKUUMAY-UHFFFAOYSA-N telmisartan Chemical compound CCCC1=NC2=C(C)C=C(C=3N(C4=CC=CC=C4N=3)C)C=C2N1CC(C=C1)=CC=C1C1=CC=CC=C1C(O)=O RMMXLENWKUUMAY-UHFFFAOYSA-N 0.000 description 2
- CXGTZJYQWSUFET-IBGZPJMESA-N tesaglitazar Chemical compound C1=CC(C[C@H](OCC)C(O)=O)=CC=C1OCCC1=CC=C(OS(C)(=O)=O)C=C1 CXGTZJYQWSUFET-IBGZPJMESA-N 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- YAPQBXQYLJRXSA-UHFFFAOYSA-N theobromine Chemical compound CN1C(=O)NC(=O)C2=C1N=CN2C YAPQBXQYLJRXSA-UHFFFAOYSA-N 0.000 description 2
- ZFXYFBGIUFBOJW-UHFFFAOYSA-N theophylline Chemical compound O=C1N(C)C(=O)N(C)C2=C1NC=N2 ZFXYFBGIUFBOJW-UHFFFAOYSA-N 0.000 description 2
- HNKJADCVZUBCPG-UHFFFAOYSA-N thioanisole Chemical compound CSC1=CC=CC=C1 HNKJADCVZUBCPG-UHFFFAOYSA-N 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- UFTFJSFQGQCHQW-UHFFFAOYSA-N triformin Chemical compound O=COCC(OC=O)COC=O UFTFJSFQGQCHQW-UHFFFAOYSA-N 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- XUARCIYIVXVTAE-ZAPOICBTSA-N uvaol Chemical compound C1C[C@H](O)C(C)(C)[C@@H]2CC[C@@]3(C)[C@]4(C)CC[C@@]5(CO)CC[C@@H](C)[C@H](C)[C@H]5C4=CC[C@@H]3[C@]21C XUARCIYIVXVTAE-ZAPOICBTSA-N 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- SYOKIDBDQMKNDQ-XWTIBIIYSA-N vildagliptin Chemical compound C1C(O)(C2)CC(C3)CC1CC32NCC(=O)N1CCC[C@H]1C#N SYOKIDBDQMKNDQ-XWTIBIIYSA-N 0.000 description 2
- 230000004584 weight gain Effects 0.000 description 2
- 229940002552 xenical Drugs 0.000 description 2
- UBQNRHZMVUUOMG-UHFFFAOYSA-N zonisamide Chemical compound C1=CC=C2C(CS(=O)(=O)N)=NOC2=C1 UBQNRHZMVUUOMG-UHFFFAOYSA-N 0.000 description 2
- AHOUBRCZNHFOSL-YOEHRIQHSA-N (+)-Casbol Chemical compound C1=CC(F)=CC=C1[C@H]1[C@H](COC=2C=C3OCOC3=CC=2)CNCC1 AHOUBRCZNHFOSL-YOEHRIQHSA-N 0.000 description 1
- DBGIVFWFUFKIQN-VIFPVBQESA-N (+)-Fenfluramine Chemical compound CCN[C@@H](C)CC1=CC=CC(C(F)(F)F)=C1 DBGIVFWFUFKIQN-VIFPVBQESA-N 0.000 description 1
- DBGIVFWFUFKIQN-UHFFFAOYSA-N (+-)-Fenfluramine Chemical compound CCNC(C)CC1=CC=CC(C(F)(F)F)=C1 DBGIVFWFUFKIQN-UHFFFAOYSA-N 0.000 description 1
- HMJIYCCIJYRONP-UHFFFAOYSA-N (+-)-Isradipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OC(C)C)C1C1=CC=CC2=NON=C12 HMJIYCCIJYRONP-UHFFFAOYSA-N 0.000 description 1
- SFLSHLFXELFNJZ-QMMMGPOBSA-N (-)-norepinephrine Chemical compound NC[C@H](O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-QMMMGPOBSA-N 0.000 description 1
- BHVGOYREXHCFOE-DCFHFQCYSA-N (1r,2s)-2-[2-(5,6-dihydrodibenzo[1,2-a:1',2'-e][7]annulen-11-ylidene)ethyl-methylamino]-1-phenylpropan-1-ol Chemical compound C1([C@@H](O)[C@H](C)N(C)CC=C2C3=CC=CC=C3CCC3=CC=CC=C32)=CC=CC=C1 BHVGOYREXHCFOE-DCFHFQCYSA-N 0.000 description 1
- DZLOHEOHWICNIL-QGZVFWFLSA-N (2R)-2-[6-(4-chlorophenoxy)hexyl]-2-oxiranecarboxylic acid ethyl ester Chemical compound C=1C=C(Cl)C=CC=1OCCCCCC[C@]1(C(=O)OCC)CO1 DZLOHEOHWICNIL-QGZVFWFLSA-N 0.000 description 1
- XSOXUIXLUNBLJA-RNRVQEDPSA-N (2r)-6-[(2r)-2-[[(2r)-2-(3-chlorophenyl)-2-hydroxyethyl]amino]propyl]-2,3-dihydro-1,4-benzodioxine-2-carboxylic acid Chemical compound C1([C@@H](O)CN[C@@H](CC=2C=C3OC[C@@H](OC3=CC=2)C(O)=O)C)=CC=CC(Cl)=C1 XSOXUIXLUNBLJA-RNRVQEDPSA-N 0.000 description 1
- GKKPXBHNFVDHAQ-USNYZCROSA-N (2r)-n-[(2r)-3-[4-[n'-[[4-[(dimethylamino)methyl]cyclohexyl]methyl]carbamimidoyl]phenyl]-1-oxo-1-pyrrolidin-1-ylpropan-2-yl]-2-(naphthalen-2-ylsulfonylamino)-3-phenylpropanamide Chemical compound C1CC(CN(C)C)CCC1CN=C(N)C(C=C1)=CC=C1C[C@H](C(=O)N1CCCC1)NC(=O)[C@H](NS(=O)(=O)C=1C=C2C=CC=CC2=CC=1)CC1=CC=CC=C1 GKKPXBHNFVDHAQ-USNYZCROSA-N 0.000 description 1
- VCIPQQCYKMORDY-KBYFLBCBSA-N (2r,3r,4s,5s,6r)-2-(hydroxymethyl)-6-[[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]piperidine-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)N[C@@H]1CO[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 VCIPQQCYKMORDY-KBYFLBCBSA-N 0.000 description 1
- QLOOWOVVZLBYHU-VIFPVBQESA-N (2s)-1-(7-ethylfuro[2,3-g]indazol-1-yl)propan-2-amine Chemical compound O1C(CC)=CC2=C1C=CC1=C2N(C[C@H](C)N)N=C1 QLOOWOVVZLBYHU-VIFPVBQESA-N 0.000 description 1
- VRHOBXXCNBZJRX-IBGZPJMESA-N (2s)-2-[[3-[[4-(4-fluorophenoxy)phenyl]methylcarbamoyl]-4-methoxyphenyl]methyl]butanoic acid Chemical compound CC[C@H](C(O)=O)CC1=CC=C(OC)C(C(=O)NCC=2C=CC(OC=3C=CC(F)=CC=3)=CC=2)=C1 VRHOBXXCNBZJRX-IBGZPJMESA-N 0.000 description 1
- LPUDGHQMOAHMMF-JBACZVJFSA-N (2s)-2-[[[(2s)-6-amino-2-(methanesulfonamido)hexanoyl]amino]methyl]-3-[1-[[(1s)-1-carboxy-2-(4-hydroxyphenyl)ethyl]carbamoyl]cyclopentyl]propanoic acid Chemical compound N([C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C(=O)C1(C[C@@H](CNC(=O)[C@H](CCCCN)NS(=O)(=O)C)C(O)=O)CCCC1 LPUDGHQMOAHMMF-JBACZVJFSA-N 0.000 description 1
- AMNXBQPRODZJQR-DITALETJSA-N (2s)-2-cyclopentyl-2-[3-[(2,4-dimethylpyrido[2,3-b]indol-9-yl)methyl]phenyl]-n-[(1r)-2-hydroxy-1-phenylethyl]acetamide Chemical compound C1([C@@H](C=2C=CC=C(C=2)CN2C3=CC=CC=C3C3=C(C)C=C(N=C32)C)C(=O)N[C@@H](CO)C=2C=CC=CC=2)CCCC1 AMNXBQPRODZJQR-DITALETJSA-N 0.000 description 1
- ZXEIEKDGPVTZLD-NDEPHWFRSA-N (2s)-2-dodecylsulfanyl-n-(4-hydroxy-2,3,5-trimethylphenyl)-2-phenylacetamide Chemical compound O=C([C@@H](SCCCCCCCCCCCC)C=1C=CC=CC=1)NC1=CC(C)=C(O)C(C)=C1C ZXEIEKDGPVTZLD-NDEPHWFRSA-N 0.000 description 1
- QNLWMPLUWMWDMQ-YTTGMZPUSA-N (2s)-3-[4-(2-carbazol-9-ylethoxy)phenyl]-2-[2-(4-fluorobenzoyl)anilino]propanoic acid Chemical compound N([C@@H](CC=1C=CC(OCCN2C3=CC=CC=C3C3=CC=CC=C32)=CC=1)C(=O)O)C1=CC=CC=C1C(=O)C1=CC=C(F)C=C1 QNLWMPLUWMWDMQ-YTTGMZPUSA-N 0.000 description 1
- IRAAJHYKQDFNFO-SFHVURJKSA-N (2s)-3-[4-[2-[1,3-benzoxazol-2-yl(methyl)amino]ethoxy]phenyl]-2-(2,2,2-trifluoroethoxy)propanoic acid Chemical compound N=1C2=CC=CC=C2OC=1N(C)CCOC1=CC=C(C[C@H](OCC(F)(F)F)C(O)=O)C=C1 IRAAJHYKQDFNFO-SFHVURJKSA-N 0.000 description 1
- RVWNMGKSNGWLOL-GIIHNPQRSA-N (2s)-6-amino-2-[[(2r)-2-[[(2s)-2-[[(2s)-2-[[(2r)-2-[[(2s)-2-amino-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(2-methyl-1h-indol-3-yl)propanoyl]amino]propanoyl]amino]-3-(1h-indol-3-yl)propanoyl]amino]-3-phenylpropanoyl]amino]hexanamide Chemical compound C([C@H](N)C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CN=CN1 RVWNMGKSNGWLOL-GIIHNPQRSA-N 0.000 description 1
- ORXTVTDGPVINDN-BTJVGWIPSA-N (2s,3s)-2-(3-chlorophenyl)-3,5,5-trimethylmorpholin-2-ol;hydrochloride Chemical compound Cl.C[C@@H]1NC(C)(C)CO[C@@]1(O)C1=CC=CC(Cl)=C1 ORXTVTDGPVINDN-BTJVGWIPSA-N 0.000 description 1
- ZSOPWZQRZHWYFY-NUXPJIRBSA-N (2s,3s)-2-amino-3-methyl-1-(1,3-thiazolidin-3-yl)pentan-1-one;(e)-but-2-enedioic acid Chemical compound OC(=O)\C=C\C(O)=O.CC[C@H](C)[C@H](N)C(=O)N1CCSC1 ZSOPWZQRZHWYFY-NUXPJIRBSA-N 0.000 description 1
- BIDNLKIUORFRQP-XYGFDPSESA-N (2s,4s)-4-cyclohexyl-1-[2-[[(1s)-2-methyl-1-propanoyloxypropoxy]-(4-phenylbutyl)phosphoryl]acetyl]pyrrolidine-2-carboxylic acid Chemical compound C([P@@](=O)(O[C@H](OC(=O)CC)C(C)C)CC(=O)N1[C@@H](C[C@H](C1)C1CCCCC1)C(O)=O)CCCC1=CC=CC=C1 BIDNLKIUORFRQP-XYGFDPSESA-N 0.000 description 1
- JSYGLDMGERSRPC-FQUUOJAGSA-N (2s,4s)-4-fluoro-1-[2-[[(1r,3s)-3-(1,2,4-triazol-1-ylmethyl)cyclopentyl]amino]acetyl]pyrrolidine-2-carbonitrile Chemical compound C1[C@@H](F)C[C@@H](C#N)N1C(=O)CN[C@H]1C[C@@H](CN2N=CN=C2)CC1 JSYGLDMGERSRPC-FQUUOJAGSA-N 0.000 description 1
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- LDQKDRLEMKIYMC-XMMPIXPASA-N (3R)-1'-(9-anthrylcarbonyl)-3-(morpholin-4-ylcarbonyl)-1,4'-bipiperidine Chemical compound O=C([C@H]1CN(CCC1)C1CCN(CC1)C(=O)C=1C2=CC=CC=C2C=C2C=CC=CC2=1)N1CCOCC1 LDQKDRLEMKIYMC-XMMPIXPASA-N 0.000 description 1
- RLCKHJSFHOZMDR-UHFFFAOYSA-N (3R, 7R, 11R)-1-Phytanoid acid Natural products CC(C)CCCC(C)CCCC(C)CCCC(C)CC(O)=O RLCKHJSFHOZMDR-UHFFFAOYSA-N 0.000 description 1
- ZGGHKIMDNBDHJB-NRFPMOEYSA-M (3R,5S)-fluvastatin sodium Chemical compound [Na+].C12=CC=CC=C2N(C(C)C)C(\C=C\[C@@H](O)C[C@@H](O)CC([O-])=O)=C1C1=CC=C(F)C=C1 ZGGHKIMDNBDHJB-NRFPMOEYSA-M 0.000 description 1
- WGEHWCGDFFFRKA-UTLNTRLCSA-N (3S,8S,9S,10R,13S,14S,17R)-16-bromo-10,13-dimethyl-17-[(2R)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-3-ol Chemical group C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC(Br)[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 WGEHWCGDFFFRKA-UTLNTRLCSA-N 0.000 description 1
- WCGUUGGRBIKTOS-GPOJBZKASA-N (3beta)-3-hydroxyurs-12-en-28-oic acid Chemical compound C1C[C@H](O)C(C)(C)[C@@H]2CC[C@@]3(C)[C@]4(C)CC[C@@]5(C(O)=O)CC[C@@H](C)[C@H](C)[C@H]5C4=CC[C@@H]3[C@]21C WCGUUGGRBIKTOS-GPOJBZKASA-N 0.000 description 1
- YSSPGXCFFITNCE-OAQYLSRUSA-N (3s)-3-(2-chlorophenyl)-1-[2-(diethylamino)ethyl]-3-hydroxy-2-oxo-4-(trifluoromethyl)indole-6-carboxamide Chemical compound C1([C@]2(O)C(=O)N(C3=C2C(=CC(=C3)C(N)=O)C(F)(F)F)CCN(CC)CC)=CC=CC=C1Cl YSSPGXCFFITNCE-OAQYLSRUSA-N 0.000 description 1
- DLOJBPLQFCFYKX-QQYYTUMTSA-N (3s)-4-[[(2r)-1-[2-[[(2s)-2-[[1h-indol-3-ylmethyl-[2-[[(2s)-2-[3-(4-sulfooxyphenyl)propanoylamino]hexanoyl]amino]acetyl]carbamoyl]amino]hexanoyl]carbamoyl]phenyl]propan-2-yl]amino]-3-(methylamino)-4-oxobutanoic acid Chemical compound N([C@@H](CCCC)C(=O)NCC(=O)N(CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCC)C(=O)NC(=O)C=1C(=CC=CC=1)C[C@@H](C)NC(=O)[C@H](CC(O)=O)NC)C(=O)CCC1=CC=C(OS(O)(=O)=O)C=C1 DLOJBPLQFCFYKX-QQYYTUMTSA-N 0.000 description 1
- VMDKRSNUUUUARH-MQDBWYGVSA-N (3s)-4-[[(2s)-1-[[(2s)-2-[[(2s)-3-(1h-indol-3-yl)-2-[[2-[[(2s)-2-[[2-(4-sulfooxyphenyl)acetyl]amino]hexanoyl]amino]acetyl]amino]propanoyl]amino]hexanoyl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(methylamino)-4-oxobutanoic acid Chemical compound N([C@@H](CCCC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCC)C(=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(O)=O)NC)C(=O)CC1=CC=C(OS(O)(=O)=O)C=C1 VMDKRSNUUUUARH-MQDBWYGVSA-N 0.000 description 1
- KNHCBYMGWWTGSO-ZYADHFCISA-N (3s)-4-[[(2s)-1-amino-1-oxo-3-phenylpropan-2-yl]-methylamino]-3-[[(2s)-2-[[(2s)-3-(1h-indol-3-yl)-2-[(2-methylpropan-2-yl)oxycarbonylamino]propanoyl]amino]-6-[(2-methylphenyl)carbamoylamino]hexanoyl]amino]-4-oxobutanoic acid Chemical compound C([C@H](N(C)C(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCNC(=O)NC=1C(=CC=CC=1)C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)OC(C)(C)C)C(N)=O)C1=CC=CC=C1 KNHCBYMGWWTGSO-ZYADHFCISA-N 0.000 description 1
- PFMXXIJBGKRAJY-ITMZJIMRSA-N (3s)-4-[[(2s)-3-carboxy-1-oxo-1-(2-phenylethoxy)propan-2-yl]amino]-3-[6-[[(2s)-3-(1h-indol-3-yl)-2-[[2-[6-[[(2s)-2-[(2-methylpropan-2-yl)oxycarbonylamino]-3-(4-sulfooxyphenyl)propanoyl]amino]hexanoylamino]acetyl]amino]propanoyl]amino]hexanoylamino]-4-oxob Chemical compound C([C@H](NC(=O)OC(C)(C)C)C(=O)NCCCCCC(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)NCCCCCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)OCCC=1C=CC=CC=1)C1=CC=C(OS(O)(=O)=O)C=C1 PFMXXIJBGKRAJY-ITMZJIMRSA-N 0.000 description 1
- QRGQONAZHIKMGC-UHFFFAOYSA-N (4-phenoxyphenyl) 4-methylpiperidine-1-carboxylate Chemical compound C1CC(C)CCN1C(=O)OC(C=C1)=CC=C1OC1=CC=CC=C1 QRGQONAZHIKMGC-UHFFFAOYSA-N 0.000 description 1
- ULVDFHLHKNJICZ-QCWLDUFUSA-N (4e)-4-[[4-[(5-methyl-2-phenyl-1,3-oxazol-4-yl)methoxy]phenyl]methoxyimino]-4-phenylbutanoic acid Chemical compound CC=1OC(C=2C=CC=CC=2)=NC=1COC(C=C1)=CC=C1CO\N=C(/CCC(O)=O)C1=CC=CC=C1 ULVDFHLHKNJICZ-QCWLDUFUSA-N 0.000 description 1
- FXKFFTMLFPWYFH-RDGPPVDQSA-N (4s,7s,12br)-7-[[(2s)-2-acetylsulfanyl-3-methylbutanoyl]amino]-6-oxo-2,3,4,7,8,12b-hexahydro-1h-pyrido[2,1-a][2]benzazepine-4-carboxylic acid Chemical compound O=C1[C@@H](NC(=O)[C@@H](SC(C)=O)C(C)C)CC2=CC=CC=C2[C@H]2CCC[C@@H](C(O)=O)N21 FXKFFTMLFPWYFH-RDGPPVDQSA-N 0.000 description 1
- QJLPWVUZFKETMK-LLVKDONJSA-N (5r)-1,5,7,9,11,14-hexahydroxy-3-methyl-8,13-dioxo-5,6-dihydrobenzo[a]tetracene-2-carboxylic acid Chemical compound O=C1C2=C(O)C=C(O)C=C2C(=O)C2=C1C(O)=C1C[C@@H](O)C(C=C(C(=C3O)C(O)=O)C)=C3C1=C2O QJLPWVUZFKETMK-LLVKDONJSA-N 0.000 description 1
- GHOKWGTUZJEAQD-ZETCQYMHSA-N (D)-(+)-Pantothenic acid Chemical compound OCC(C)(C)[C@@H](O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-ZETCQYMHSA-N 0.000 description 1
- METKIMKYRPQLGS-GFCCVEGCSA-N (R)-atenolol Chemical compound CC(C)NC[C@@H](O)COC1=CC=C(CC(N)=O)C=C1 METKIMKYRPQLGS-GFCCVEGCSA-N 0.000 description 1
- PVHUJELLJLJGLN-INIZCTEOSA-N (S)-nitrendipine Chemical compound CCOC(=O)C1=C(C)NC(C)=C(C(=O)OC)[C@@H]1C1=CC=CC([N+]([O-])=O)=C1 PVHUJELLJLJGLN-INIZCTEOSA-N 0.000 description 1
- TWBNMYSKRDRHAT-RCWTXCDDSA-N (S)-timolol hemihydrate Chemical compound O.CC(C)(C)NC[C@H](O)COC1=NSN=C1N1CCOCC1.CC(C)(C)NC[C@H](O)COC1=NSN=C1N1CCOCC1 TWBNMYSKRDRHAT-RCWTXCDDSA-N 0.000 description 1
- KOHIRBRYDXPAMZ-YHBROIRLSA-N (S,R,R,R)-nebivolol Chemical compound C1CC2=CC(F)=CC=C2O[C@H]1[C@H](O)CNC[C@@H](O)[C@H]1OC2=CC=C(F)C=C2CC1 KOHIRBRYDXPAMZ-YHBROIRLSA-N 0.000 description 1
- OPPLDIXFHYTSSR-GLECISQGSA-N (ne)-n-(1-methylpyrrolidin-2-ylidene)-n'-phenylmorpholine-4-carboximidamide Chemical compound CN1CCC\C1=N/C(N1CCOCC1)=NC1=CC=CC=C1 OPPLDIXFHYTSSR-GLECISQGSA-N 0.000 description 1
- GHADIQOLHLUYIM-GZTJUZNOSA-N (ne)-n-[1-[4-[3-(1h-imidazol-5-yl)propoxy]phenyl]ethylidene]hydroxylamine Chemical compound C1=CC(C(=N/O)/C)=CC=C1OCCCC1=CNC=N1 GHADIQOLHLUYIM-GZTJUZNOSA-N 0.000 description 1
- CEIVEAWRPWQLQJ-UHFFFAOYSA-N 1'-(4,8-dimethoxyquinoline-2-carbonyl)-6-(2h-tetrazol-5-yl)spiro[3h-chromene-2,4'-piperidine]-4-one Chemical compound N1=C2C(OC)=CC=CC2=C(OC)C=C1C(=O)N(CC1)CCC1(OC1=CC=2)CC(=O)C1=CC=2C1=NN=NN1 CEIVEAWRPWQLQJ-UHFFFAOYSA-N 0.000 description 1
- BXUSVMYTVRKSAA-UHFFFAOYSA-N 1'-(4-ethoxy-8-ethylquinoline-2-carbonyl)-6-(2h-tetrazol-5-yl)spiro[3h-chromene-2,4'-piperidine]-4-one Chemical compound N=1C2=C(CC)C=CC=C2C(OCC)=CC=1C(=O)N(CC1)CCC1(OC1=CC=2)CC(=O)C1=CC=2C1=NN=NN1 BXUSVMYTVRKSAA-UHFFFAOYSA-N 0.000 description 1
- QIWRRTHLKHTEGV-UHFFFAOYSA-N 1'-(8-methoxy-4-morpholin-4-ylnaphthalene-2-carbonyl)-6-(2h-tetrazol-5-yl)spiro[3h-chromene-2,4'-piperidine]-4-one Chemical compound C1=C2C(OC)=CC=CC2=C(N2CCOCC2)C=C1C(=O)N(CC1)CCC1(OC1=CC=2)CC(=O)C1=CC=2C1=NN=NN1 QIWRRTHLKHTEGV-UHFFFAOYSA-N 0.000 description 1
- PPVUWDCETZMPLT-UHFFFAOYSA-N 1,3-dihydropyrazole-2-carboxamide Chemical compound NC(=O)N1CC=CN1 PPVUWDCETZMPLT-UHFFFAOYSA-N 0.000 description 1
- AKMNUCBQGHFICM-UHFFFAOYSA-N 1-(2-methyl-1,3-benzoxazol-6-yl)-3-(1,5-naphthyridin-4-yl)urea Chemical compound C1=CN=C2C(NC(=O)NC3=CC=C4N=C(OC4=C3)C)=CC=NC2=C1 AKMNUCBQGHFICM-UHFFFAOYSA-N 0.000 description 1
- UUOJIACWOAYWEZ-UHFFFAOYSA-N 1-(tert-butylamino)-3-[(2-methyl-1H-indol-4-yl)oxy]propan-2-yl benzoate Chemical compound C1=CC=C2NC(C)=CC2=C1OCC(CNC(C)(C)C)OC(=O)C1=CC=CC=C1 UUOJIACWOAYWEZ-UHFFFAOYSA-N 0.000 description 1
- 102000016752 1-Alkyl-2-acetylglycerophosphocholine Esterase Human genes 0.000 description 1
- BOVGTQGAOIONJV-BETUJISGSA-N 1-[(3ar,6as)-3,3a,4,5,6,6a-hexahydro-1h-cyclopenta[c]pyrrol-2-yl]-3-(4-methylphenyl)sulfonylurea Chemical compound C1=CC(C)=CC=C1S(=O)(=O)NC(=O)NN1C[C@H]2CCC[C@H]2C1 BOVGTQGAOIONJV-BETUJISGSA-N 0.000 description 1
- NKFYPGJRGHKNCW-UHFFFAOYSA-N 1-[1-[1-(4-chlorophenyl)pentyl]azetidin-3-yl]-1-(3,5-difluorophenyl)-2-methylpropan-2-ol Chemical compound C=1C=C(Cl)C=CC=1C(CCCC)N(C1)CC1C(C(C)(C)O)C1=CC(F)=CC(F)=C1 NKFYPGJRGHKNCW-UHFFFAOYSA-N 0.000 description 1
- XHHLNSWTGQCLAS-MHZLTWQESA-N 1-[2-[(4-chlorophenoxy)methyl]-1-[3-[(3s)-piperidin-3-yl]propyl]indol-3-yl]-2-(4-piperidin-1-ylpiperidin-1-yl)ethanone Chemical compound C1=CC(Cl)=CC=C1OCC(N(C1=CC=CC=C11)CCC[C@H]2CNCCC2)=C1C(=O)CN1CCC(N2CCCCC2)CC1 XHHLNSWTGQCLAS-MHZLTWQESA-N 0.000 description 1
- FAFVVBJEQCPDIA-UHFFFAOYSA-N 1-[4-amino-2,6-di(propan-2-yl)phenyl]-3-[1-butyl-4-[3-(3-hydroxypropoxy)phenyl]-2-oxo-1,8-naphthyridin-3-yl]urea;hydrochloride Chemical compound Cl.CC(C)C=1C=C(N)C=C(C(C)C)C=1NC(=O)NC=1C(=O)N(CCCC)C2=NC=CC=C2C=1C1=CC=CC(OCCCO)=C1 FAFVVBJEQCPDIA-UHFFFAOYSA-N 0.000 description 1
- LLJFMFZYVVLQKT-UHFFFAOYSA-N 1-cyclohexyl-3-[4-[2-(7-methoxy-4,4-dimethyl-1,3-dioxo-2-isoquinolinyl)ethyl]phenyl]sulfonylurea Chemical compound C=1C(OC)=CC=C(C(C2=O)(C)C)C=1C(=O)N2CCC(C=C1)=CC=C1S(=O)(=O)NC(=O)NC1CCCCC1 LLJFMFZYVVLQKT-UHFFFAOYSA-N 0.000 description 1
- RJRBRCCJETZJLT-GSICZYLSSA-N 1229u91 Chemical compound C([C@H](NC(=O)C1CNC(=O)CC[C@@H](C(=O)N2CCC[C@H]2C(=O)NC(CNC(=O)CC[C@@H](C(N2CCC[C@H]2C(=O)N1)=O)NC(=O)[C@@H](N)[C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)NC(=O)[C@@H](N)[C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)C1=CC=C(O)C=C1 RJRBRCCJETZJLT-GSICZYLSSA-N 0.000 description 1
- 238000001644 13C nuclear magnetic resonance spectroscopy Methods 0.000 description 1
- GVEZIHKRYBHEFX-MNOVXSKESA-N 13C-Cerulenin Natural products CC=CCC=CCCC(=O)[C@H]1O[C@@H]1C(N)=O GVEZIHKRYBHEFX-MNOVXSKESA-N 0.000 description 1
- ABEXEQSGABRUHS-UHFFFAOYSA-N 16-methylheptadecyl 16-methylheptadecanoate Chemical compound CC(C)CCCCCCCCCCCCCCCOC(=O)CCCCCCCCCCCCCCC(C)C ABEXEQSGABRUHS-UHFFFAOYSA-N 0.000 description 1
- GUSVHVVOABZHAH-OPZWKQDFSA-N 1aw8p77hkj Chemical compound O([C@@H]1[C@@H](CO)O[C@H]([C@@H]([C@H]1O)O)O[C@@H]1C[C@@H]2CC[C@H]3[C@@H]4C[C@H]5[C@@H]([C@]4(CC[C@@H]3[C@@]2(C)CC1)C)[C@@H]([C@]1(OC[C@H](C)CC1)O5)C)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O GUSVHVVOABZHAH-OPZWKQDFSA-N 0.000 description 1
- XKEBMWRWBWRQAO-UHFFFAOYSA-N 1h-pyrido[2,3-d]pyrimidin-4-one Chemical compound C1=CC=C2C(=O)N=CNC2=N1 XKEBMWRWBWRQAO-UHFFFAOYSA-N 0.000 description 1
- RADMRAMXLLLVGG-UHFFFAOYSA-N 1h-pyrido[4,3-d]pyrimidin-4-one Chemical compound C1=NC=C2C(=O)N=CNC2=C1 RADMRAMXLLLVGG-UHFFFAOYSA-N 0.000 description 1
- OFUFETJGPBSGND-UHFFFAOYSA-N 2,5-dimethyl-3-[4-(3-pyrrolidin-1-ylpropoxy)phenyl]quinazolin-4-one Chemical compound O=C1C=2C(C)=CC=CC=2N=C(C)N1C(C=C1)=CC=C1OCCCN1CCCC1 OFUFETJGPBSGND-UHFFFAOYSA-N 0.000 description 1
- SGTNSNPWRIOYBX-UHFFFAOYSA-N 2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile Chemical compound C1=C(OC)C(OC)=CC=C1CCN(C)CCCC(C#N)(C(C)C)C1=CC=C(OC)C(OC)=C1 SGTNSNPWRIOYBX-UHFFFAOYSA-N 0.000 description 1
- CUADMYMMZWFUCY-FQEVSTJZSA-N 2-[(4-methoxyphenoxy)carbonyl-[(1s)-1-[4-[2-(5-methyl-2-phenyl-1,3-oxazol-4-yl)ethoxy]phenyl]ethyl]amino]acetic acid Chemical compound C1=CC(OC)=CC=C1OC(=O)N(CC(O)=O)[C@@H](C)C(C=C1)=CC=C1OCCC1=C(C)OC(C=2C=CC=CC=2)=N1 CUADMYMMZWFUCY-FQEVSTJZSA-N 0.000 description 1
- VTNDKSKVRZQHBN-FOCHENRBSA-N 2-[1'-[(3s,4r)-1-tert-butyl-4-(2,4-difluorophenyl)pyrrolidine-3-carbonyl]-3-chloro-2-methylspiro[5h-furo[3,4-b]pyridine-7,4'-piperidine]-5-yl]-2-methylpropanenitrile Chemical compound C1([C@@H]2CN(C[C@H]2C(=O)N2CCC3(CC2)OC(C2=C3N=C(C(=C2)Cl)C)C(C)(C)C#N)C(C)(C)C)=CC=C(F)C=C1F VTNDKSKVRZQHBN-FOCHENRBSA-N 0.000 description 1
- TYZQFNOLWJGHRZ-UHFFFAOYSA-N 2-[2-(4,5-dihydro-1h-imidazol-2-yl)-1-phenylethyl]pyridine Chemical compound N=1CCNC=1CC(C=1N=CC=CC=1)C1=CC=CC=C1 TYZQFNOLWJGHRZ-UHFFFAOYSA-N 0.000 description 1
- CIHMPKKTGUOBBS-UHFFFAOYSA-N 2-[2-(4-methylphenyl)ethylsulfanyl]-3-[4-[2-(4-methylsulfonyloxyphenoxy)ethyl]phenyl]propanoic acid Chemical compound C1=CC(C)=CC=C1CCSC(C(O)=O)CC(C=C1)=CC=C1CCOC1=CC=C(OS(C)(=O)=O)C=C1 CIHMPKKTGUOBBS-UHFFFAOYSA-N 0.000 description 1
- DSJVYEAOYVHUJW-CVDCTZTESA-N 2-[3-[(4s)-1-[(2s)-1-(benzylamino)propan-2-yl]-3-[2-(3-fluorophenyl)ethyl]-2-sulfanylideneimidazolidin-4-yl]propyl]guanidine Chemical compound C([C@H](C)N1C(N(CCC=2C=C(F)C=CC=2)[C@@H](CCCNC(N)=N)C1)=S)NCC1=CC=CC=C1 DSJVYEAOYVHUJW-CVDCTZTESA-N 0.000 description 1
- GYGXTPSWIDGSQY-MXMWHYQXSA-N 2-[3-chloro-1'-[(1r,2r)-2-(2,4-difluorophenyl)-4-[methyl(oxan-4-yl)amino]cyclopentanecarbonyl]-2-methylspiro[5h-furo[3,4-b]pyridine-7,4'-piperidine]-5-yl]-2-methylpropanenitrile Chemical compound C1([C@H]2[C@@H](CC(C2)N(C)C2CCOCC2)C(=O)N2CCC3(CC2)C2=NC(C)=C(Cl)C=C2C(O3)C(C)(C)C#N)=CC=C(F)C=C1F GYGXTPSWIDGSQY-MXMWHYQXSA-N 0.000 description 1
- VUCNQOPCYRJCGQ-UHFFFAOYSA-N 2-[4-(hydroxymethyl)phenoxy]acetic acid Chemical compound OCC1=CC=C(OCC(O)=O)C=C1 VUCNQOPCYRJCGQ-UHFFFAOYSA-N 0.000 description 1
- UPMGJEMWPQOACJ-UHFFFAOYSA-N 2-[4-[(2,4-dimethoxyphenyl)-(9h-fluoren-9-ylmethoxycarbonylamino)methyl]phenoxy]acetic acid Chemical compound COC1=CC(OC)=CC=C1C(C=1C=CC(OCC(O)=O)=CC=1)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C21 UPMGJEMWPQOACJ-UHFFFAOYSA-N 0.000 description 1
- ZGGNJJJYUVRADP-ACJLOTCBSA-N 2-[4-[(2R)-2-[[(2R)-2-(3-chlorophenyl)-2-hydroxyethyl]amino]propyl]phenoxy]acetic acid Chemical compound C([C@@H](C)NC[C@H](O)C=1C=C(Cl)C=CC=1)C1=CC=C(OCC(O)=O)C=C1 ZGGNJJJYUVRADP-ACJLOTCBSA-N 0.000 description 1
- YMWJDWJXIXITMD-UHFFFAOYSA-N 2-[4-[3-[2-(2-chloro-6-fluorophenyl)ethyl-[(2,3-dichlorophenyl)carbamoyl]amino]propyl]phenoxy]-2-methylpropanoic acid Chemical compound C1=CC(OC(C)(C)C(O)=O)=CC=C1CCCN(C(=O)NC=1C(=C(Cl)C=CC=1)Cl)CCC1=C(F)C=CC=C1Cl YMWJDWJXIXITMD-UHFFFAOYSA-N 0.000 description 1
- ACZKTJZXXSHIGF-UHFFFAOYSA-N 2-[5-(4-chlorophenyl)pentyl]oxirane-2-carboxylic acid Chemical compound C=1C=C(Cl)C=CC=1CCCCCC1(C(=O)O)CO1 ACZKTJZXXSHIGF-UHFFFAOYSA-N 0.000 description 1
- TXIIZHHIOHVWJD-UHFFFAOYSA-N 2-[7-(2,2-dimethylpropanoylamino)-4,6-dimethyl-1-octyl-2,3-dihydroindol-5-yl]acetic acid Chemical compound CC(C)(C)C(=O)NC1=C(C)C(CC(O)=O)=C(C)C2=C1N(CCCCCCCC)CC2 TXIIZHHIOHVWJD-UHFFFAOYSA-N 0.000 description 1
- FMKGJQHNYMWDFJ-CVEARBPZSA-N 2-[[4-(2,2-difluoropropoxy)pyrimidin-5-yl]methylamino]-4-[[(1R,4S)-4-hydroxy-3,3-dimethylcyclohexyl]amino]pyrimidine-5-carbonitrile Chemical compound FC(COC1=NC=NC=C1CNC1=NC=C(C(=N1)N[C@H]1CC([C@H](CC1)O)(C)C)C#N)(C)F FMKGJQHNYMWDFJ-CVEARBPZSA-N 0.000 description 1
- NSVFSAJIGAJDMR-UHFFFAOYSA-N 2-[benzyl(phenyl)amino]ethyl 5-(5,5-dimethyl-2-oxido-1,3,2-dioxaphosphinan-2-yl)-2,6-dimethyl-4-(3-nitrophenyl)-1,4-dihydropyridine-3-carboxylate Chemical compound CC=1NC(C)=C(C(=O)OCCN(CC=2C=CC=CC=2)C=2C=CC=CC=2)C(C=2C=C(C=CC=2)[N+]([O-])=O)C=1P1(=O)OCC(C)(C)CO1 NSVFSAJIGAJDMR-UHFFFAOYSA-N 0.000 description 1
- MSWZFWKMSRAUBD-IVMDWMLBSA-N 2-amino-2-deoxy-D-glucopyranose Chemical compound N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-IVMDWMLBSA-N 0.000 description 1
- DUGMCDWNXXFHDE-VZYDHVRKSA-N 2-amino-2-methyl-n-[(2r)-1-(1-methylsulfonylspiro[2h-indole-3,4'-piperidine]-1'-yl)-1-oxo-3-phenylmethoxypropan-2-yl]propanamide;methanesulfonic acid Chemical compound CS(O)(=O)=O.C([C@@H](NC(=O)C(C)(N)C)C(=O)N1CCC2(C3=CC=CC=C3N(C2)S(C)(=O)=O)CC1)OCC1=CC=CC=C1 DUGMCDWNXXFHDE-VZYDHVRKSA-N 0.000 description 1
- BKQCTMOROFZQNH-HSZRJFAPSA-N 2-amino-2-methyl-n-[(2r)-1-(1-methylsulfonylspiro[2h-indole-3,4'-piperidine]-1'-yl)-1-oxo-5-phenylpentan-2-yl]propanamide Chemical compound C([C@@H](NC(=O)C(C)(N)C)C(=O)N1CCC2(C3=CC=CC=C3N(C2)S(C)(=O)=O)CC1)CCC1=CC=CC=C1 BKQCTMOROFZQNH-HSZRJFAPSA-N 0.000 description 1
- IHBAVXVTGLANPI-QMMMGPOBSA-N 2-amino-3-methyl-1-pyrrolidin-1-yl-butan-1-one Chemical compound CC(C)[C@H](N)C(=O)N1CCCC1 IHBAVXVTGLANPI-QMMMGPOBSA-N 0.000 description 1
- KFHRMMHGGBCRIV-UHFFFAOYSA-N 2-azaniumyl-4-methoxybutanoate Chemical compound COCCC(N)C(O)=O KFHRMMHGGBCRIV-UHFFFAOYSA-N 0.000 description 1
- JIVPVXMEBJLZRO-CQSZACIVSA-N 2-chloro-5-[(1r)-1-hydroxy-3-oxo-2h-isoindol-1-yl]benzenesulfonamide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC([C@@]2(O)C3=CC=CC=C3C(=O)N2)=C1 JIVPVXMEBJLZRO-CQSZACIVSA-N 0.000 description 1
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 1
- 229940013085 2-diethylaminoethanol Drugs 0.000 description 1
- ILPUOPPYSQEBNJ-UHFFFAOYSA-N 2-methyl-2-phenoxypropanoic acid Chemical class OC(=O)C(C)(C)OC1=CC=CC=C1 ILPUOPPYSQEBNJ-UHFFFAOYSA-N 0.000 description 1
- DDDZBLNULGDPGA-UHFFFAOYSA-N 2-methyl-3-[4-(3-pyrrolidin-1-ylpropoxy)phenyl]-5-(trifluoromethyl)quinazolin-4-one Chemical compound CC1=NC2=CC=CC(C(F)(F)F)=C2C(=O)N1C(C=C1)=CC=C1OCCCN1CCCC1 DDDZBLNULGDPGA-UHFFFAOYSA-N 0.000 description 1
- NAQFVSYHAPPSIA-MRXNPFEDSA-N 2-methyl-3-[4-[3-[(2r)-2-methylpyrrolidin-1-yl]propoxy]phenyl]pyrido[4,3-d]pyrimidin-4-one Chemical compound C[C@@H]1CCCN1CCCOC1=CC=C(N2C(C3=CN=CC=C3N=C2C)=O)C=C1 NAQFVSYHAPPSIA-MRXNPFEDSA-N 0.000 description 1
- CSKRHKRIODQRPM-KRWDZBQOSA-N 2-methyl-3-[4-[3-[(3s)-3-methylpiperidin-1-yl]propoxy]phenyl]pyrido[2,3-d]pyrimidin-4-one Chemical compound C1[C@@H](C)CCCN1CCCOC1=CC=C(N2C(C3=CC=CN=C3N=C2C)=O)C=C1 CSKRHKRIODQRPM-KRWDZBQOSA-N 0.000 description 1
- YZQLWPMZQVHJED-UHFFFAOYSA-N 2-methylpropanethioic acid S-[2-[[[1-(2-ethylbutyl)cyclohexyl]-oxomethyl]amino]phenyl] ester Chemical compound C=1C=CC=C(SC(=O)C(C)C)C=1NC(=O)C1(CC(CC)CC)CCCCC1 YZQLWPMZQVHJED-UHFFFAOYSA-N 0.000 description 1
- UWFMZXLJKUNCLI-UHFFFAOYSA-N 2-naphthalen-1-yl-3-phenylpropane-1,2-diamine Chemical compound C=1C=CC2=CC=CC=C2C=1C(N)(CN)CC1=CC=CC=C1 UWFMZXLJKUNCLI-UHFFFAOYSA-N 0.000 description 1
- GVIYUKXRXPXMQM-BPXGDYAESA-N 221231-10-3 Chemical compound C([C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]1C(N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CSSC1)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C(C)C)=O)C1=CC=C(O)C=C1 GVIYUKXRXPXMQM-BPXGDYAESA-N 0.000 description 1
- RLCKHJSFHOZMDR-PWCSWUJKSA-N 3,7R,11R,15-tetramethyl-hexadecanoic acid Chemical compound CC(C)CCC[C@@H](C)CCC[C@@H](C)CCCC(C)CC(O)=O RLCKHJSFHOZMDR-PWCSWUJKSA-N 0.000 description 1
- RWHAHXGJTMJKLA-UHFFFAOYSA-N 3-(1-adamantyl)-4-ethyl-5-ethylsulfanyl-1,2,4-triazole Chemical compound CCN1C(SCC)=NN=C1C1(C2)CC(C3)CC2CC3C1 RWHAHXGJTMJKLA-UHFFFAOYSA-N 0.000 description 1
- KLUDWLXORMPCCF-UHFFFAOYSA-N 3-(1-adamantyl)-4-methyl-5-(3,4,5-trimethoxyphenyl)-1,2,4-triazole Chemical compound COC1=C(OC)C(OC)=CC(C=2N(C(=NN=2)C23CC4CC(CC(C4)C2)C3)C)=C1 KLUDWLXORMPCCF-UHFFFAOYSA-N 0.000 description 1
- UBHYDQAARZKHEZ-RFLHHMENSA-N 3-(1h-imidazol-5-yl)propyl n'-[2-(4-iodanylphenyl)ethyl]carbamimidothioate Chemical compound C=1C=C([125I])C=CC=1CC/N=C(/N)SCCCC1=CN=CN1 UBHYDQAARZKHEZ-RFLHHMENSA-N 0.000 description 1
- ULVWQSSQQHJQPK-UHFFFAOYSA-N 3-(1h-imidazol-5-yl)propyl n-pent-4-enylcarbamate Chemical compound C=CCCCNC(=O)OCCCC1=CNC=N1 ULVWQSSQQHJQPK-UHFFFAOYSA-N 0.000 description 1
- JXZZEXZZKAWDSP-UHFFFAOYSA-N 3-(2-(4-Benzamidopiperid-1-yl)ethyl)indole Chemical compound C1CN(CCC=2C3=CC=CC=C3NC=2)CCC1NC(=O)C1=CC=CC=C1 JXZZEXZZKAWDSP-UHFFFAOYSA-N 0.000 description 1
- FKHYYOUFMJBLAF-UHFFFAOYSA-N 3-(3,3-dimethyl-1-phenyl-2-benzothiophen-1-yl)-n-methylpropan-1-amine Chemical compound S1C(C)(C)C2=CC=CC=C2C1(CCCNC)C1=CC=CC=C1 FKHYYOUFMJBLAF-UHFFFAOYSA-N 0.000 description 1
- QGJZLNKBHJESQX-UHFFFAOYSA-N 3-Epi-Betulin-Saeure Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C)CCC5(C(O)=O)CCC(C(=C)C)C5C4CCC3C21C QGJZLNKBHJESQX-UHFFFAOYSA-N 0.000 description 1
- LYSLISZPAZFYMF-IZLXSDGUSA-N 3-[(1s)-1-[1-[(s)-(3-cyanophenyl)-(4-cyanophenyl)methyl]azetidin-3-yl]-2-fluoro-2-methylpropyl]-5-fluorobenzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(C=C(F)C=2)C#N)C=2C=C(C=CC=2)C#N)=CC=C(C#N)C=C1 LYSLISZPAZFYMF-IZLXSDGUSA-N 0.000 description 1
- POPUHFIKYFJKNI-SXOMAYOGSA-N 3-[(1s)-1-[1-[(s)-(4-chlorophenyl)-[3-(1,3,4-oxadiazol-2-yl)phenyl]methyl]azetidin-3-yl]-2-fluoro-2-methylpropyl]-5-fluorobenzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(C=C(F)C=2)C#N)C=2C=C(C=CC=2)C=2OC=NN=2)=CC=C(Cl)C=C1 POPUHFIKYFJKNI-SXOMAYOGSA-N 0.000 description 1
- WFYMIOTUYKCVRZ-FTJBHMTQSA-N 3-[(1s)-1-[1-[(s)-(4-chlorophenyl)-[3-(2-oxo-3h-1,3,4-oxadiazol-5-yl)phenyl]methyl]azetidin-3-yl]-2-fluoro-2-methylpropyl]-5-fluorobenzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(C=C(F)C=2)C#N)C=2C=C(C=CC=2)C=2OC(=O)NN=2)=CC=C(Cl)C=C1 WFYMIOTUYKCVRZ-FTJBHMTQSA-N 0.000 description 1
- KTFLZRCXNHRQIT-IZLXSDGUSA-N 3-[(1s)-1-[1-[(s)-(4-cyanophenyl)-[3-(1,2,4-oxadiazol-3-yl)phenyl]methyl]azetidin-3-yl]-2-fluoro-2-methylpropyl]-5-fluorobenzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(C=C(F)C=2)C#N)C=2C=C(C=CC=2)C2=NOC=N2)=CC=C(C#N)C=C1 KTFLZRCXNHRQIT-IZLXSDGUSA-N 0.000 description 1
- DAAWNVVJIHRLGX-IZLXSDGUSA-N 3-[(1s)-1-[1-[(s)-(4-cyanophenyl)-[3-(1,3,4-oxadiazol-2-yl)phenyl]methyl]azetidin-3-yl]-2-fluoro-2-methylpropyl]-5-fluorobenzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(C=C(F)C=2)C#N)C=2C=C(C=CC=2)C=2OC=NN=2)=CC=C(C#N)C=C1 DAAWNVVJIHRLGX-IZLXSDGUSA-N 0.000 description 1
- AKSVEYGFHNXCSL-SXOMAYOGSA-N 3-[(1s)-1-[1-[(s)-[3-(5-amino-1,3,4-oxadiazol-2-yl)phenyl]-(4-cyanophenyl)methyl]azetidin-3-yl]-2-fluoro-2-methylpropyl]-5-fluorobenzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(C=C(F)C=2)C#N)C=2C=C(C=CC=2)C=2OC(N)=NN=2)=CC=C(C#N)C=C1 AKSVEYGFHNXCSL-SXOMAYOGSA-N 0.000 description 1
- XWTDLGLHFYWLAV-UHFFFAOYSA-N 3-[(4-chlorophenyl)-[3-[1-(3,5-difluorophenyl)-2,2-dimethylpropyl]azetidin-1-yl]methyl]benzonitrile Chemical compound C=1C(F)=CC(F)=CC=1C(C(C)(C)C)C(C1)CN1C(C=1C=C(C=CC=1)C#N)C1=CC=C(Cl)C=C1 XWTDLGLHFYWLAV-UHFFFAOYSA-N 0.000 description 1
- LIPPTSMRZWRMNH-UHFFFAOYSA-N 3-[(4-chlorophenyl)-[3-[2-fluoro-1-[3-fluoro-5-(1-methyltetrazol-5-yl)phenyl]-2-methylpropyl]azetidin-1-yl]methyl]benzonitrile Chemical compound CN1N=NN=C1C1=CC(F)=CC(C(C2CN(C2)C(C=2C=CC(Cl)=CC=2)C=2C=C(C=CC=2)C#N)C(C)(C)F)=C1 LIPPTSMRZWRMNH-UHFFFAOYSA-N 0.000 description 1
- XTCXSBHGOIWMCH-UHFFFAOYSA-N 3-[(4-chlorophenyl)-[3-[2-fluoro-1-[3-fluoro-5-(2-methyltetrazol-5-yl)phenyl]-2-methylpropyl]azetidin-1-yl]methyl]benzonitrile Chemical compound CN1N=NC(C=2C=C(C=C(F)C=2)C(C2CN(C2)C(C=2C=CC(Cl)=CC=2)C=2C=C(C=CC=2)C#N)C(C)(C)F)=N1 XTCXSBHGOIWMCH-UHFFFAOYSA-N 0.000 description 1
- FDWCJCYOVCJDLK-UHFFFAOYSA-N 3-[(4-cyanophenyl)-[3-[2-fluoro-1-[3-fluoro-5-(2-methyltetrazol-5-yl)phenyl]-2-methylpropyl]azetidin-1-yl]methyl]benzonitrile Chemical compound CN1N=NC(C=2C=C(C=C(F)C=2)C(C2CN(C2)C(C=2C=CC(=CC=2)C#N)C=2C=C(C=CC=2)C#N)C(C)(C)F)=N1 FDWCJCYOVCJDLK-UHFFFAOYSA-N 0.000 description 1
- SIGYZOKUSLPHLI-FTJBHMTQSA-N 3-[(s)-(4-chlorophenyl)-[3-[(1s)-1-(3,5-difluorophenyl)-2-fluoro-2-methylpropyl]azetidin-1-yl]methyl]benzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(F)C=C(F)C=2)C=2C=C(C=CC=2)C#N)=CC=C(Cl)C=C1 SIGYZOKUSLPHLI-FTJBHMTQSA-N 0.000 description 1
- NTAXGDGMWOECQL-FTJBHMTQSA-N 3-[(s)-(4-chlorophenyl)-[3-[(1s)-1-(3,5-difluorophenyl)-2-hydroxy-2-methylpropyl]azetidin-1-yl]methyl]benzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(O)C)C=2C=C(F)C=C(F)C=2)C=2C=C(C=CC=2)C#N)=CC=C(Cl)C=C1 NTAXGDGMWOECQL-FTJBHMTQSA-N 0.000 description 1
- CFSBYHISKWJSMI-IZLXSDGUSA-N 3-[(s)-(4-chlorophenyl)-[3-[(1s)-2-fluoro-1-[3-fluoro-5-(1,2,4-triazol-4-yl)phenyl]-2-methylpropyl]azetidin-1-yl]methyl]benzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(C=C(F)C=2)N2C=NN=C2)C=2C=C(C=CC=2)C#N)=CC=C(Cl)C=C1 CFSBYHISKWJSMI-IZLXSDGUSA-N 0.000 description 1
- YIWXLKUUFYYKRL-SXOMAYOGSA-N 3-[(s)-(4-chlorophenyl)-[3-[(1s)-2-fluoro-1-[3-fluoro-5-(1,3,4-oxadiazol-2-yl)phenyl]-2-methylpropyl]azetidin-1-yl]methyl]benzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(C=C(F)C=2)C=2OC=NN=2)C=2C=C(C=CC=2)C#N)=CC=C(Cl)C=C1 YIWXLKUUFYYKRL-SXOMAYOGSA-N 0.000 description 1
- OCTHAEDOHIOXTC-FTJBHMTQSA-N 3-[(s)-[3-[(1s)-1-[3-(5-amino-1,3,4-oxadiazol-2-yl)-5-fluorophenyl]-2-fluoro-2-methylpropyl]azetidin-1-yl]-(4-chlorophenyl)methyl]benzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(C=C(F)C=2)C=2OC(N)=NN=2)C=2C=C(C=CC=2)C#N)=CC=C(Cl)C=C1 OCTHAEDOHIOXTC-FTJBHMTQSA-N 0.000 description 1
- CDROWZIFKRLAOE-SXOMAYOGSA-N 3-[(s)-[3-[(1s)-1-[3-(5-amino-1,3,4-oxadiazol-2-yl)-5-fluorophenyl]-2-fluoro-2-methylpropyl]azetidin-1-yl]-(4-cyanophenyl)methyl]benzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(C=C(F)C=2)C=2OC(N)=NN=2)C=2C=C(C=CC=2)C#N)=CC=C(C#N)C=C1 CDROWZIFKRLAOE-SXOMAYOGSA-N 0.000 description 1
- HJVCJGUTCZTKBU-UHFFFAOYSA-N 3-[1-[bis(4-chlorophenyl)methyl]azetidin-3-ylidene]-3-(3,5-difluorophenyl)-2,2-dimethylpropanenitrile Chemical compound C=1C(F)=CC(F)=CC=1C(C(C)(C#N)C)=C(C1)CN1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 HJVCJGUTCZTKBU-UHFFFAOYSA-N 0.000 description 1
- PMXCGBVBIRYFPR-FTBISJDPSA-N 3-[3-[2-[[(2r)-2-(3-chlorophenyl)-2-hydroxyethyl]amino]ethylamino]phenyl]benzoic acid;hydrochloride Chemical compound Cl.C([C@H](O)C=1C=C(Cl)C=CC=1)NCCNC(C=1)=CC=CC=1C1=CC=CC(C(O)=O)=C1 PMXCGBVBIRYFPR-FTBISJDPSA-N 0.000 description 1
- SRFCAWATPLCLMG-UHFFFAOYSA-N 3-[3-ethoxy-1-[[4-[(2-phenyl-1,3-thiazol-4-yl)methoxy]phenyl]methyl]pyrazol-4-yl]propanoic acid Chemical compound C1=C(CCC(O)=O)C(OCC)=NN1CC(C=C1)=CC=C1OCC1=CSC(C=2C=CC=CC=2)=N1 SRFCAWATPLCLMG-UHFFFAOYSA-N 0.000 description 1
- LCORHUWUZKGEHY-UHFFFAOYSA-N 3-[4-(1-cyclobutylpiperidin-4-yl)oxyphenyl]-2,5-dimethylquinazolin-4-one Chemical compound O=C1C=2C(C)=CC=CC=2N=C(C)N1C(C=C1)=CC=C1OC(CC1)CCN1C1CCC1 LCORHUWUZKGEHY-UHFFFAOYSA-N 0.000 description 1
- JDTUERBJQJZXNV-UHFFFAOYSA-N 3-[4-(1-cyclobutylpiperidin-4-yl)oxyphenyl]-2-ethylpyrido[4,3-d]pyrimidin-4-one Chemical compound CCC1=NC2=CC=NC=C2C(=O)N1C(C=C1)=CC=C1OC(CC1)CCN1C1CCC1 JDTUERBJQJZXNV-UHFFFAOYSA-N 0.000 description 1
- UEABDGOZLNPBSU-UHFFFAOYSA-N 3-[4-(1-cyclobutylpiperidin-4-yl)oxyphenyl]-2-methylpyrido[4,3-d]pyrimidin-4-one Chemical compound CC1=NC2=CC=NC=C2C(=O)N1C(C=C1)=CC=C1OC(CC1)CCN1C1CCC1 UEABDGOZLNPBSU-UHFFFAOYSA-N 0.000 description 1
- MQCHIKVWSTVDAI-UHFFFAOYSA-N 3-[4-(1-cyclobutylpiperidin-4-yl)oxyphenyl]-5-methoxy-2-methylquinazolin-4-one Chemical compound O=C1C=2C(OC)=CC=CC=2N=C(C)N1C(C=C1)=CC=C1OC(CC1)CCN1C1CCC1 MQCHIKVWSTVDAI-UHFFFAOYSA-N 0.000 description 1
- QYIMINCTFPGMSB-UHFFFAOYSA-N 3-[4-(1-cyclobutylpiperidin-4-yl)oxyphenyl]-6-fluoro-2-methylpyrido[3,4-d]pyrimidin-4-one Chemical compound CC1=NC2=CN=C(F)C=C2C(=O)N1C(C=C1)=CC=C1OC(CC1)CCN1C1CCC1 QYIMINCTFPGMSB-UHFFFAOYSA-N 0.000 description 1
- FJHJJGSPYONJET-UHFFFAOYSA-N 3-[4-(1-cyclopentylpiperidin-4-yl)oxyphenyl]-2-methylpyrido[4,3-d]pyrimidin-4-one Chemical compound CC1=NC2=CC=NC=C2C(=O)N1C(C=C1)=CC=C1OC(CC1)CCN1C1CCCC1 FJHJJGSPYONJET-UHFFFAOYSA-N 0.000 description 1
- MVJXOVUJJUHESX-UHFFFAOYSA-N 3-[4-[1-(2,3-dihydro-1,4-benzodioxin-6-yl)-2-(4-fluorophenyl)imidazole-4-carbonyl]piperazin-1-yl]naphthalene-1-carboxylic acid Chemical compound C=1C2=CC=CC=C2C(C(=O)O)=CC=1N(CC1)CCN1C(=O)C(N=1)=CN(C=2C=C3OCCOC3=CC=2)C=1C1=CC=C(F)C=C1 MVJXOVUJJUHESX-UHFFFAOYSA-N 0.000 description 1
- AACZCKZTUMTPKO-UHFFFAOYSA-N 3-[4-[1-(3-ethoxyphenyl)-2-(2-fluoro-4-methylphenyl)imidazole-4-carbonyl]piperazin-1-yl]naphthalene-1-carboxylic acid Chemical compound CCOC1=CC=CC(N2C(=NC(=C2)C(=O)N2CCN(CC2)C=2C=C3C=CC=CC3=C(C(O)=O)C=2)C=2C(=CC(C)=CC=2)F)=C1 AACZCKZTUMTPKO-UHFFFAOYSA-N 0.000 description 1
- RLTYKXXMMIJIHK-UHFFFAOYSA-N 3-[4-[1-(3-ethoxyphenyl)-2-(4-fluorophenyl)imidazole-4-carbonyl]piperazin-1-yl]naphthalene-1-carboxylic acid Chemical compound CCOC1=CC=CC(N2C(=NC(=C2)C(=O)N2CCN(CC2)C=2C=C3C=CC=CC3=C(C(O)=O)C=2)C=2C=CC(F)=CC=2)=C1 RLTYKXXMMIJIHK-UHFFFAOYSA-N 0.000 description 1
- HMGSYODAZJHCRL-UHFFFAOYSA-N 3-[4-[1-(3-ethoxyphenyl)-2-(4-methylphenyl)imidazole-4-carbonyl]piperazin-1-yl]naphthalene-1-carboxylic acid Chemical compound CCOC1=CC=CC(N2C(=NC(=C2)C(=O)N2CCN(CC2)C=2C=C3C=CC=CC3=C(C(O)=O)C=2)C=2C=CC(C)=CC=2)=C1 HMGSYODAZJHCRL-UHFFFAOYSA-N 0.000 description 1
- ZGSKQTIQDRWKLV-UHFFFAOYSA-N 3-[4-[2-(2,4-difluorophenyl)-1-(3-ethoxyphenyl)imidazole-4-carbonyl]piperazin-1-yl]naphthalene-1-carboxylic acid Chemical compound CCOC1=CC=CC(N2C(=NC(=C2)C(=O)N2CCN(CC2)C=2C=C3C=CC=CC3=C(C(O)=O)C=2)C=2C(=CC(F)=CC=2)F)=C1 ZGSKQTIQDRWKLV-UHFFFAOYSA-N 0.000 description 1
- SBJLJOFPWOYATP-XMMPIXPASA-N 3-amino-3-methyl-n-[(3r)-2-oxo-1-[[4-[2-(2h-tetrazol-5-yl)phenyl]phenyl]methyl]-4,5-dihydro-3h-1-benzazepin-3-yl]butanamide Chemical compound C([C@H](C1=O)NC(=O)CC(C)(N)C)CC2=CC=CC=C2N1CC(C=C1)=CC=C1C1=CC=CC=C1C=1N=NNN=1 SBJLJOFPWOYATP-XMMPIXPASA-N 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-M 3-carboxy-2,3-dihydroxypropanoate Chemical compound OC(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-M 0.000 description 1
- ALKYHXVLJMQRLQ-UHFFFAOYSA-M 3-carboxynaphthalen-2-olate Chemical compound C1=CC=C2C=C(C([O-])=O)C(O)=CC2=C1 ALKYHXVLJMQRLQ-UHFFFAOYSA-M 0.000 description 1
- 125000004080 3-carboxypropanoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C(O[H])=O 0.000 description 1
- WZFZJEPHYDDFCT-UHFFFAOYSA-N 3-chloro-2-methyl-n-[4-[2-(3-oxomorpholin-4-yl)ethyl]-1,3-thiazol-2-yl]benzenesulfonamide Chemical compound CC1=C(Cl)C=CC=C1S(=O)(=O)NC1=NC(CCN2C(COCC2)=O)=CS1 WZFZJEPHYDDFCT-UHFFFAOYSA-N 0.000 description 1
- YDPRNGAPPNPYQQ-UHFFFAOYSA-N 3-chloro-2-methyl-n-[4-[2-(4-methylpiperazin-1-yl)-2-oxoethyl]-1,3-thiazol-2-yl]benzenesulfonamide Chemical compound C1CN(C)CCN1C(=O)CC1=CSC(NS(=O)(=O)C=2C(=C(Cl)C=CC=2)C)=N1 YDPRNGAPPNPYQQ-UHFFFAOYSA-N 0.000 description 1
- XTFPDGZNWTZCMF-DHZHZOJOSA-N 3-o-methyl 5-o-[(e)-3-phenylprop-2-enyl] 2,6-dimethyl-4-(3-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OC\C=C\C=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 XTFPDGZNWTZCMF-DHZHZOJOSA-N 0.000 description 1
- MKVJQAZEXGSAIT-UHFFFAOYSA-N 3-oxo-n-(5-phenylpyrazin-2-yl)spiro[2-benzofuran-1,4'-piperidine]-1'-carboxamide Chemical compound C1CC2(C3=CC=CC=C3C(=O)O2)CCN1C(=O)NC(N=C1)=CN=C1C1=CC=CC=C1 MKVJQAZEXGSAIT-UHFFFAOYSA-N 0.000 description 1
- MVQVNTPHUGQQHK-UHFFFAOYSA-N 3-pyridinemethanol Chemical compound OCC1=CC=CN=C1 MVQVNTPHUGQQHK-UHFFFAOYSA-N 0.000 description 1
- CLOUCVRNYSHRCF-UHFFFAOYSA-N 3beta-Hydroxy-20(29)-Lupen-3,27-oic acid Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C(O)=O)CCC5(C)CCC(C(=C)C)C5C4CCC3C21C CLOUCVRNYSHRCF-UHFFFAOYSA-N 0.000 description 1
- KNNGZTISXFFKBN-FTJBHMTQSA-N 4-[(s)-[3-[(1s)-1-(3,5-difluorophenyl)-2-fluoro-2-methylpropyl]azetidin-1-yl]-[3-(2-oxo-3h-1,3,4-oxadiazol-5-yl)phenyl]methyl]benzonitrile Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(F)C=C(F)C=2)C=2C=C(C=CC=2)C=2OC(=O)NN=2)=CC=C(C#N)C=C1 KNNGZTISXFFKBN-FTJBHMTQSA-N 0.000 description 1
- SWLAMJPTOQZTAE-UHFFFAOYSA-N 4-[2-[(5-chloro-2-methoxybenzoyl)amino]ethyl]benzoic acid Chemical class COC1=CC=C(Cl)C=C1C(=O)NCCC1=CC=C(C(O)=O)C=C1 SWLAMJPTOQZTAE-UHFFFAOYSA-N 0.000 description 1
- FXIPXWLVYIHFEP-OAQYLSRUSA-N 4-[4-[3-[(3r)-3-(dimethylamino)pyrrolidin-1-yl]propoxy]phenyl]benzonitrile Chemical compound C1[C@H](N(C)C)CCN1CCCOC1=CC=C(C=2C=CC(=CC=2)C#N)C=C1 FXIPXWLVYIHFEP-OAQYLSRUSA-N 0.000 description 1
- AKMODYVRUFPHHE-UHFFFAOYSA-N 4-amino-4-oxobutanoic acid;3-[2-[2-(3-aminopropoxy)ethoxy]ethoxy]propan-1-amine Chemical compound NC(=O)CCC(O)=O.NCCCOCCOCCOCCCN AKMODYVRUFPHHE-UHFFFAOYSA-N 0.000 description 1
- 125000004801 4-cyanophenyl group Chemical group [H]C1=C([H])C(C#N)=C([H])C([H])=C1* 0.000 description 1
- HVCNXQOWACZAFN-UHFFFAOYSA-N 4-ethylmorpholine Chemical compound CCN1CCOCC1 HVCNXQOWACZAFN-UHFFFAOYSA-N 0.000 description 1
- 125000004176 4-fluorobenzyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1F)C([H])([H])* 0.000 description 1
- WNWALBVQAAIULR-UHFFFAOYSA-N 5-(3-phenylmethoxypropyl)-1H-imidazole Chemical class C=1N=CNC=1CCCOCC1=CC=CC=C1 WNWALBVQAAIULR-UHFFFAOYSA-N 0.000 description 1
- 229940124801 5-HT6 antagonist Drugs 0.000 description 1
- NFFXEUUOMTXWCX-UHFFFAOYSA-N 5-[(2,4-dioxo-1,3-thiazolidin-5-yl)methyl]-2-methoxy-n-[[4-(trifluoromethyl)phenyl]methyl]benzamide Chemical compound C1=C(C(=O)NCC=2C=CC(=CC=2)C(F)(F)F)C(OC)=CC=C1CC1SC(=O)NC1=O NFFXEUUOMTXWCX-UHFFFAOYSA-N 0.000 description 1
- MGUZSGTUEPWHIX-MIHMCVIASA-N 5-[(4-chlorophenyl)-[3-[(1s)-1-(3,5-difluorophenyl)-2-fluoro-2-methylpropyl]azetidin-1-yl]methyl]thiophene-3-carbonitrile Chemical compound C1C([C@H](C(C)(F)C)C=2C=C(F)C=C(F)C=2)CN1C(C=1C=CC(Cl)=CC=1)C1=CC(C#N)=CS1 MGUZSGTUEPWHIX-MIHMCVIASA-N 0.000 description 1
- CEPIEAXNTIIBKK-UHFFFAOYSA-N 5-[1'-(8-cyclopropyl-4-methoxyquinoline-2-carbonyl)-4-oxospiro[3h-chromene-2,4'-piperidine]-6-yl]pyridine-3-carboxylic acid Chemical compound C1=CC=C2C(OC)=CC(C(=O)N3CCC4(CC3)OC3=CC=C(C=C3C(=O)C4)C=3C=C(C=NC=3)C(O)=O)=NC2=C1C1CC1 CEPIEAXNTIIBKK-UHFFFAOYSA-N 0.000 description 1
- VDBUAGWMINWTSC-RPBOFIJWSA-N 5-[3-[(s)-[3-[(1s)-1-(3-bromo-5-fluorophenyl)-2-fluoro-2-methylpropyl]azetidin-1-yl]-(4-chlorophenyl)methyl]phenyl]-3h-1,3,4-oxadiazol-2-one Chemical compound C1([C@H](N2CC(C2)[C@H](C(C)(F)C)C=2C=C(Br)C=C(F)C=2)C=2C=C(C=CC=2)C=2OC(=O)NN=2)=CC=C(Cl)C=C1 VDBUAGWMINWTSC-RPBOFIJWSA-N 0.000 description 1
- YSRAJQKNFQRCKU-UHFFFAOYSA-N 5-[3-[1-(1-benzhydrylazetidin-3-yl)-2-fluoro-2-methylpropyl]-5-fluorophenyl]-1-methyltetrazole Chemical compound CN1N=NN=C1C1=CC(F)=CC(C(C2CN(C2)C(C=2C=CC=CC=2)C=2C=CC=CC=2)C(C)(C)F)=C1 YSRAJQKNFQRCKU-UHFFFAOYSA-N 0.000 description 1
- PTWVFPNRKIALTJ-UHFFFAOYSA-N 5-[3-[1-(1-benzhydrylazetidin-3-yl)-2-fluoro-2-methylpropyl]-5-fluorophenyl]-2-methyltetrazole Chemical compound CN1N=NC(C=2C=C(C=C(F)C=2)C(C2CN(C2)C(C=2C=CC=CC=2)C=2C=CC=CC=2)C(C)(C)F)=N1 PTWVFPNRKIALTJ-UHFFFAOYSA-N 0.000 description 1
- BNCAAJCCZTYYRA-UHFFFAOYSA-N 5-[3-[1-(1-benzhydrylazetidin-3-yl)-2-fluoro-2-methylpropyl]-5-fluorophenyl]-2h-tetrazole Chemical compound C=1C(F)=CC(C=2NN=NN=2)=CC=1C(C(C)(F)C)C(C1)CN1C(C=1C=CC=CC=1)C1=CC=CC=C1 BNCAAJCCZTYYRA-UHFFFAOYSA-N 0.000 description 1
- MVDXXGIBARMXSA-PYUWXLGESA-N 5-[[(2r)-2-benzyl-3,4-dihydro-2h-chromen-6-yl]methyl]-1,3-thiazolidine-2,4-dione Chemical compound S1C(=O)NC(=O)C1CC1=CC=C(O[C@@H](CC=2C=CC=CC=2)CC2)C2=C1 MVDXXGIBARMXSA-PYUWXLGESA-N 0.000 description 1
- JLLYLQLDYORLBB-UHFFFAOYSA-N 5-bromo-n-methylthiophene-2-sulfonamide Chemical group CNS(=O)(=O)C1=CC=C(Br)S1 JLLYLQLDYORLBB-UHFFFAOYSA-N 0.000 description 1
- LOCQRDBFWSXQQI-UHFFFAOYSA-N 5-chloro-n-(4-methoxy-3-piperazin-1-ylphenyl)-3-methyl-1-benzothiophene-2-sulfonamide Chemical compound COC1=CC=C(NS(=O)(=O)C2=C(C3=CC(Cl)=CC=C3S2)C)C=C1N1CCNCC1 LOCQRDBFWSXQQI-UHFFFAOYSA-N 0.000 description 1
- LAVXKKLCYIGYCO-UHFFFAOYSA-N 5-fluoro-2-methyl-3-[4-(3-piperidin-1-ylpropoxy)phenyl]quinazolin-4-one Chemical compound CC1=NC2=CC=CC(F)=C2C(=O)N1C(C=C1)=CC=C1OCCCN1CCCCC1 LAVXKKLCYIGYCO-UHFFFAOYSA-N 0.000 description 1
- IJYGEPNOYVLSBD-MRXNPFEDSA-N 5-fluoro-2-methyl-3-[4-[3-[(2r)-2-methylpyrrolidin-1-yl]propoxy]phenyl]quinazolin-4-one Chemical compound C[C@@H]1CCCN1CCCOC1=CC=C(N2C(C3=C(F)C=CC=C3N=C2C)=O)C=C1 IJYGEPNOYVLSBD-MRXNPFEDSA-N 0.000 description 1
- 102100024959 5-hydroxytryptamine receptor 2C Human genes 0.000 description 1
- 101710138093 5-hydroxytryptamine receptor 2C Proteins 0.000 description 1
- 239000003406 5-lipoxygenase-activating protein inhibitor Substances 0.000 description 1
- NIGFETKUOUPLSS-SFHVURJKSA-N 5-methoxy-2-methyl-3-[4-[3-[(3s)-3-methylpiperidin-1-yl]propoxy]phenyl]quinazolin-4-one Chemical compound O=C1C=2C(OC)=CC=CC=2N=C(C)N1C(C=C1)=CC=C1OCCCN1CCC[C@H](C)C1 NIGFETKUOUPLSS-SFHVURJKSA-N 0.000 description 1
- RZTAMFZIAATZDJ-HNNXBMFYSA-N 5-o-ethyl 3-o-methyl (4s)-4-(2,3-dichlorophenyl)-2,6-dimethyl-1,4-dihydropyridine-3,5-dicarboxylate Chemical compound CCOC(=O)C1=C(C)NC(C)=C(C(=O)OC)[C@@H]1C1=CC=CC(Cl)=C1Cl RZTAMFZIAATZDJ-HNNXBMFYSA-N 0.000 description 1
- SDMBRCRVFFHJKR-UHFFFAOYSA-N 6-(5-carboxy-5-methylhexoxy)-2,2-dimethylhexanoic acid Chemical compound OC(=O)C(C)(C)CCCCOCCCCC(C)(C)C(O)=O SDMBRCRVFFHJKR-UHFFFAOYSA-N 0.000 description 1
- VFFZWMWTUSXDCB-ZDUSSCGKSA-N 6-[2-[[2-[(2s)-2-cyanopyrrolidin-1-yl]-2-oxoethyl]amino]ethylamino]pyridine-3-carbonitrile Chemical compound N1([C@@H](CCC1)C#N)C(=O)CNCCNC1=CC=C(C#N)C=N1 VFFZWMWTUSXDCB-ZDUSSCGKSA-N 0.000 description 1
- RBSGUQYXRDKPAE-QFIPXVFZSA-N 6-[4-[2-[[(2s)-3-(9h-carbazol-4-yloxy)-2-hydroxypropyl]amino]-2-methylpropyl]phenoxy]pyridine-3-carboxamide Chemical compound C([C@H](O)COC=1C=2C3=CC=CC=C3NC=2C=CC=1)NC(C)(C)CC(C=C1)=CC=C1OC1=CC=C(C(N)=O)C=N1 RBSGUQYXRDKPAE-QFIPXVFZSA-N 0.000 description 1
- UQGAGDGXKFPWII-UHFFFAOYSA-N 6-methoxy-2-methyl-3-[4-(3-piperidin-1-ylpropoxy)phenyl]pyrido[3,4-d]pyrimidin-4-one Chemical compound C1=NC(OC)=CC(C2=O)=C1N=C(C)N2C(C=C1)=CC=C1OCCCN1CCCCC1 UQGAGDGXKFPWII-UHFFFAOYSA-N 0.000 description 1
- ZCFFFHDINZMHQW-UHFFFAOYSA-N 6-methoxy-2-methyl-3-[4-(3-piperidin-1-ylpropoxy)phenyl]quinazolin-4-one Chemical compound O=C1C2=CC(OC)=CC=C2N=C(C)N1C(C=C1)=CC=C1OCCCN1CCCCC1 ZCFFFHDINZMHQW-UHFFFAOYSA-N 0.000 description 1
- SOIUXCOAQMHEEB-UHFFFAOYSA-N 6-methoxy-2-methyl-3-[4-(3-pyrrolidin-1-ylpropoxy)phenyl]pyrido[3,4-d]pyrimidin-4-one Chemical compound C1=NC(OC)=CC(C2=O)=C1N=C(C)N2C(C=C1)=CC=C1OCCCN1CCCC1 SOIUXCOAQMHEEB-UHFFFAOYSA-N 0.000 description 1
- JZNZPGCCJXJZOA-QGZVFWFLSA-N 6-methoxy-2-methyl-3-[4-[3-[(2r)-2-methylpyrrolidin-1-yl]propoxy]phenyl]quinazolin-4-one Chemical compound O=C1C2=CC(OC)=CC=C2N=C(C)N1C(C=C1)=CC=C1OCCCN1CCC[C@H]1C JZNZPGCCJXJZOA-QGZVFWFLSA-N 0.000 description 1
- JZNZPGCCJXJZOA-KRWDZBQOSA-N 6-methoxy-2-methyl-3-[4-[3-[(2s)-2-methylpyrrolidin-1-yl]propoxy]phenyl]quinazolin-4-one Chemical compound O=C1C2=CC(OC)=CC=C2N=C(C)N1C(C=C1)=CC=C1OCCCN1CCC[C@@H]1C JZNZPGCCJXJZOA-KRWDZBQOSA-N 0.000 description 1
- HYOLRLHUZQNHLM-SFHVURJKSA-N 7-methoxy-2-methyl-3-[4-[3-[(3s)-3-methylpiperidin-1-yl]propoxy]phenyl]quinazolin-4-one Chemical compound C=1C(OC)=CC=C(C2=O)C=1N=C(C)N2C(C=C1)=CC=C1OCCCN1CCC[C@H](C)C1 HYOLRLHUZQNHLM-SFHVURJKSA-N 0.000 description 1
- 108010023016 A 71378 Proteins 0.000 description 1
- 108700024421 A 71623 Proteins 0.000 description 1
- 108010070305 AOD 9604 Proteins 0.000 description 1
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 206010000599 Acromegaly Diseases 0.000 description 1
- 102400000069 Activation peptide Human genes 0.000 description 1
- 101800001401 Activation peptide Proteins 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 1
- 102000057234 Acyl transferases Human genes 0.000 description 1
- 108700016155 Acyl transferases Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- JBMKAUGHUNFTOL-UHFFFAOYSA-N Aldoclor Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC2=C1NC=NS2(=O)=O JBMKAUGHUNFTOL-UHFFFAOYSA-N 0.000 description 1
- PQSUYGKTWSAVDQ-ZVIOFETBSA-N Aldosterone Chemical compound C([C@@]1([C@@H](C(=O)CO)CC[C@H]1[C@@H]1CC2)C=O)[C@H](O)[C@@H]1[C@]1(C)C2=CC(=O)CC1 PQSUYGKTWSAVDQ-ZVIOFETBSA-N 0.000 description 1
- PQSUYGKTWSAVDQ-UHFFFAOYSA-N Aldosterone Natural products C1CC2C3CCC(C(=O)CO)C3(C=O)CC(O)C2C2(C)C1=CC(=O)CC2 PQSUYGKTWSAVDQ-UHFFFAOYSA-N 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- DHMQDGOQFOQNFH-UHFFFAOYSA-M Aminoacetate Chemical compound NCC([O-])=O DHMQDGOQFOQNFH-UHFFFAOYSA-M 0.000 description 1
- 229940127438 Amylin Agonists Drugs 0.000 description 1
- 206010002383 Angina Pectoris Diseases 0.000 description 1
- 102100034608 Angiopoietin-2 Human genes 0.000 description 1
- 108010048036 Angiopoietin-2 Proteins 0.000 description 1
- 208000019901 Anxiety disease Diseases 0.000 description 1
- 108010059886 Apolipoprotein A-I Proteins 0.000 description 1
- 102000005666 Apolipoprotein A-I Human genes 0.000 description 1
- NCUCGYYHUFIYNU-UHFFFAOYSA-N Aranidipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OCC(C)=O)C1C1=CC=CC=C1[N+]([O-])=O NCUCGYYHUFIYNU-UHFFFAOYSA-N 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- PTQXTEKSNBVPQJ-UHFFFAOYSA-N Avasimibe Chemical compound CC(C)C1=CC(C(C)C)=CC(C(C)C)=C1CC(=O)NS(=O)(=O)OC1=C(C(C)C)C=CC=C1C(C)C PTQXTEKSNBVPQJ-UHFFFAOYSA-N 0.000 description 1
- ZKFQEACEUNWPMT-UHFFFAOYSA-N Azelnidipine Chemical compound CC(C)OC(=O)C1=C(C)NC(N)=C(C(=O)OC2CN(C2)C(C=2C=CC=CC=2)C=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 ZKFQEACEUNWPMT-UHFFFAOYSA-N 0.000 description 1
- FBMCYYWIBYEOST-GJFSDDNBSA-N BIBO-3304 Chemical compound OC(=O)C(F)(F)F.N([C@H](CCCNC(=N)N)C(=O)NCC=1C=CC(CNC(N)=O)=CC=1)C(=O)C(C=1C=CC=CC=1)C1=CC=CC=C1 FBMCYYWIBYEOST-GJFSDDNBSA-N 0.000 description 1
- 108700001281 BIM 51077 Proteins 0.000 description 1
- 101000963440 Bacillus subtilis (strain 168) Biotin carboxylase 1 Proteins 0.000 description 1
- 102100021334 Bcl-2-related protein A1 Human genes 0.000 description 1
- XPCFTKFZXHTYIP-PMACEKPBSA-N Benazepril Chemical compound C([C@@H](C(=O)OCC)N[C@@H]1C(N(CC(O)=O)C2=CC=CC=C2CC1)=O)CC1=CC=CC=C1 XPCFTKFZXHTYIP-PMACEKPBSA-N 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- DIZWSDNSTNAYHK-XGWVBXMLSA-N Betulinic acid Natural products CC(=C)[C@@H]1C[C@H]([C@H]2CC[C@]3(C)[C@H](CC[C@@H]4[C@@]5(C)CC[C@H](O)C(C)(C)[C@@H]5CC[C@@]34C)[C@@H]12)C(=O)O DIZWSDNSTNAYHK-XGWVBXMLSA-N 0.000 description 1
- 229940123208 Biguanide Drugs 0.000 description 1
- 102100038495 Bile acid receptor Human genes 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- 208000032841 Bulimia Diseases 0.000 description 1
- 206010006550 Bulimia nervosa Diseases 0.000 description 1
- RHLJLALHBZGAFM-UHFFFAOYSA-N Bunazosinum Chemical compound C1CN(C(=O)CCC)CCCN1C1=NC(N)=C(C=C(OC)C(OC)=C2)C2=N1 RHLJLALHBZGAFM-UHFFFAOYSA-N 0.000 description 1
- 239000002080 C09CA02 - Eprosartan Substances 0.000 description 1
- 239000004072 C09CA03 - Valsartan Substances 0.000 description 1
- 239000002947 C09CA04 - Irbesartan Substances 0.000 description 1
- 239000002081 C09CA05 - Tasosartan Substances 0.000 description 1
- 239000002053 C09CA06 - Candesartan Substances 0.000 description 1
- 239000005537 C09CA07 - Telmisartan Substances 0.000 description 1
- OBMZMSLWNNWEJA-XNCRXQDQSA-N C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 Chemical compound C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 OBMZMSLWNNWEJA-XNCRXQDQSA-N 0.000 description 1
- 229940124802 CB1 antagonist Drugs 0.000 description 1
- PWDLDBWXTVILPC-WGAVTJJLSA-N CC(C)(N)CC1=CC=CC=C1.C1O[C@@]2(COS(N)(=O)=O)OC(C)(C)O[C@H]2[C@@H]2OC(C)(C)O[C@@H]21 Chemical compound CC(C)(N)CC1=CC=CC=C1.C1O[C@@]2(COS(N)(=O)=O)OC(C)(C)O[C@H]2[C@@H]2OC(C)(C)O[C@@H]21 PWDLDBWXTVILPC-WGAVTJJLSA-N 0.000 description 1
- UYNYHTXDTCBXTN-UHFFFAOYSA-N CC1=NN(C2=C1C(=O)CC(C2)(C)C)C3=CC(=C(C=C3)C(=O)N)NCCCOCCOCCOCCOCCOCCCNCC4=CC=C(C=C4)/C(=C\C=C\5/C(C6=CC=CC=C6N5CCCCS(=O)(=O)[O-])(C)C)/C=C/C7=[N+](C8=CC=CC=C8C7(C)C)CCCCS(=O)(=O)O Chemical compound CC1=NN(C2=C1C(=O)CC(C2)(C)C)C3=CC(=C(C=C3)C(=O)N)NCCCOCCOCCOCCOCCOCCCNCC4=CC=C(C=C4)/C(=C\C=C\5/C(C6=CC=CC=C6N5CCCCS(=O)(=O)[O-])(C)C)/C=C/C7=[N+](C8=CC=CC=C8C7(C)C)CCCCS(=O)(=O)O UYNYHTXDTCBXTN-UHFFFAOYSA-N 0.000 description 1
- UMQUQWCJKFOUGV-UHFFFAOYSA-N CGP 12177 Chemical compound CC(C)(C)NCC(O)COC1=CC=CC2=C1NC(=O)N2 UMQUQWCJKFOUGV-UHFFFAOYSA-N 0.000 description 1
- 108010055448 CJC 1131 Proteins 0.000 description 1
- PHKYGBHARUTZOY-UHFFFAOYSA-N CKD-711 Natural products OC1C(O)C(NC2C(C(O)C(O)C3(CO)OC32)O)C(CO)OC1OC(C(C1O)O)C(CO)OC1OC1C(CO)OC(O)C(O)C1O PHKYGBHARUTZOY-UHFFFAOYSA-N 0.000 description 1
- HPAFSYKXBHXQFJ-AYPREFSESA-N CNC(CSC1CC(=O)N(CCC(=O)CCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCC(=O)NCC(=O)OC2CC[C@@]3(C)C(=CCC4C3CC[C@]3(C)C(C(C)CCCC(C)C)CCC43)C2)C1=O)C(N)=O Chemical compound CNC(CSC1CC(=O)N(CCC(=O)CCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCC(=O)NCC(=O)OC2CC[C@@]3(C)C(=CCC4C3CC[C@]3(C)C(C(C)CCCC(C)C)CCC43)C2)C1=O)C(N)=O HPAFSYKXBHXQFJ-AYPREFSESA-N 0.000 description 1
- XUGNODIBKREYKF-XDQIXOBESA-N CNC(CSCC(=O)NCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCC(=O)OC1CC[C@@]2(C)C(=CCC3C2CC[C@@]2(C)C3CC[C@@H]2[C@H](C)CCCC(C)C)C1)C(N)=O Chemical compound CNC(CSCC(=O)NCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCC(=O)OC1CC[C@@]2(C)C(=CCC3C2CC[C@@]2(C)C3CC[C@@H]2[C@H](C)CCCC(C)C)C1)C(N)=O XUGNODIBKREYKF-XDQIXOBESA-N 0.000 description 1
- 229940127291 Calcium channel antagonist Drugs 0.000 description 1
- BQENDLAVTKRQMS-SBBGFIFASA-L Carbenoxolone sodium Chemical compound [Na+].[Na+].C([C@H]1C2=CC(=O)[C@H]34)[C@@](C)(C([O-])=O)CC[C@]1(C)CC[C@@]2(C)[C@]4(C)CC[C@@H]1[C@]3(C)CC[C@H](OC(=O)CCC([O-])=O)C1(C)C BQENDLAVTKRQMS-SBBGFIFASA-L 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 206010007559 Cardiac failure congestive Diseases 0.000 description 1
- 102000002666 Carnitine O-palmitoyltransferase Human genes 0.000 description 1
- 108010018424 Carnitine O-palmitoyltransferase Proteins 0.000 description 1
- JOATXPAWOHTVSZ-UHFFFAOYSA-N Celiprolol Chemical compound CCN(CC)C(=O)NC1=CC=C(OCC(O)CNC(C)(C)C)C(C(C)=O)=C1 JOATXPAWOHTVSZ-UHFFFAOYSA-N 0.000 description 1
- 206010008132 Cerebral thrombosis Diseases 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 101710150887 Cholecystokinin A Proteins 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- 208000000668 Chronic Pancreatitis Diseases 0.000 description 1
- KJEBULYHNRNJTE-DHZHZOJOSA-N Cinalong Chemical compound COCCOC(=O)C1=C(C)NC(C)=C(C(=O)OC\C=C\C=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 KJEBULYHNRNJTE-DHZHZOJOSA-N 0.000 description 1
- KPSRODZRAIWAKH-JTQLQIEISA-N Ciprofibrate Natural products C1=CC(OC(C)(C)C(O)=O)=CC=C1[C@H]1C(Cl)(Cl)C1 KPSRODZRAIWAKH-JTQLQIEISA-N 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- HZZVJAQRINQKSD-UHFFFAOYSA-N Clavulanic acid Natural products OC(=O)C1C(=CCO)OC2CC(=O)N21 HZZVJAQRINQKSD-UHFFFAOYSA-N 0.000 description 1
- GJSURZIOUXUGAL-UHFFFAOYSA-N Clonidine Chemical compound ClC1=CC=CC(Cl)=C1NC1=NCCN1 GJSURZIOUXUGAL-UHFFFAOYSA-N 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 206010010071 Coma Diseases 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 208000009798 Craniopharyngioma Diseases 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 125000002824 D-alpha-aminobutyric acid group Chemical group 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- 125000004077 D-glutamic acid group Chemical group [H]N([H])[C@@]([H])(C(=O)[*])C([H])([H])C([H])([H])C(N([H])[H])=O 0.000 description 1
- KDXKERNSBIXSRK-RXMQYKEDSA-N D-lysine group Chemical group N[C@H](CCCCN)C(=O)O KDXKERNSBIXSRK-RXMQYKEDSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 102000002148 Diacylglycerol O-acyltransferase Human genes 0.000 description 1
- 108010001348 Diacylglycerol O-acyltransferase Proteins 0.000 description 1
- 206010012735 Diarrhoea Diseases 0.000 description 1
- 102000016862 Dicarboxylic Acid Transporters Human genes 0.000 description 1
- 108010092943 Dicarboxylic Acid Transporters Proteins 0.000 description 1
- 101100122490 Drosophila melanogaster Galphaq gene Proteins 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 108010040545 ETC 642 Proteins 0.000 description 1
- 108010016695 ETC216 Proteins 0.000 description 1
- WOISDAHQBUYEAF-UHFFFAOYSA-N Ebelactone A Natural products CCC(C)C(O)C(C)C(=O)C(C)C=C(C)CC(C)C1OC(=O)C1C WOISDAHQBUYEAF-UHFFFAOYSA-N 0.000 description 1
- UNBMQQNYLCPCHS-UHFFFAOYSA-N Ebelactone B Natural products CCC(C)C(O)C(C)C(=O)C(C)C=C(C)CC(C)C1OC(=O)C1CC UNBMQQNYLCPCHS-UHFFFAOYSA-N 0.000 description 1
- 108010061435 Enalapril Proteins 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 102000002045 Endothelin Human genes 0.000 description 1
- 108050009340 Endothelin Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 102000018711 Facilitative Glucose Transport Proteins Human genes 0.000 description 1
- 208000004930 Fatty Liver Diseases 0.000 description 1
- CWYNVVGOOAEACU-UHFFFAOYSA-N Fe2+ Chemical compound [Fe+2] CWYNVVGOOAEACU-UHFFFAOYSA-N 0.000 description 1
- 201000001498 Froelich syndrome Diseases 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 1
- QTQMRBZOBKYXCG-MHZLTWQESA-N GW 1929 Chemical compound N([C@@H](CC1=CC=C(C=C1)OCCN(C)C=1N=CC=CC=1)C(O)=O)C1=CC=CC=C1C(=O)C1=CC=CC=C1 QTQMRBZOBKYXCG-MHZLTWQESA-N 0.000 description 1
- PKNYXWMTHFMHKD-UHFFFAOYSA-N GW 7647 Chemical compound C1=CC(SC(C)(C)C(O)=O)=CC=C1CCN(C(=O)NC1CCCCC1)CCCCC1CCCCC1 PKNYXWMTHFMHKD-UHFFFAOYSA-N 0.000 description 1
- XQLWNAFCTODIRK-UHFFFAOYSA-N Gallopamil Chemical compound C1=C(OC)C(OC)=CC=C1CCN(C)CCCC(C#N)(C(C)C)C1=CC(OC)=C(OC)C(OC)=C1 XQLWNAFCTODIRK-UHFFFAOYSA-N 0.000 description 1
- 101000783757 Gallus gallus Adenosine receptor A2b Proteins 0.000 description 1
- 208000018522 Gastrointestinal disease Diseases 0.000 description 1
- 208000017228 Gastrointestinal motility disease Diseases 0.000 description 1
- 102400000322 Glucagon-like peptide 1 Human genes 0.000 description 1
- FAEKWTJYAYMJKF-QHCPKHFHSA-N GlucoNorm Chemical compound C1=C(C(O)=O)C(OCC)=CC(CC(=O)N[C@@H](CC(C)C)C=2C(=CC=CC=2)N2CCCCC2)=C1 FAEKWTJYAYMJKF-QHCPKHFHSA-N 0.000 description 1
- 108091052347 Glucose transporter family Proteins 0.000 description 1
- 102100033839 Glucose-dependent insulinotropic receptor Human genes 0.000 description 1
- 102000007390 Glycogen Phosphorylase Human genes 0.000 description 1
- 108010046163 Glycogen Phosphorylase Proteins 0.000 description 1
- 102000019058 Glycogen Synthase Kinase 3 beta Human genes 0.000 description 1
- 108010051975 Glycogen Synthase Kinase 3 beta Proteins 0.000 description 1
- 108010051696 Growth Hormone Proteins 0.000 description 1
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 206010019708 Hepatic steatosis Diseases 0.000 description 1
- 206010020112 Hirsutism Diseases 0.000 description 1
- 229940115480 Histamine H3 receptor antagonist Drugs 0.000 description 1
- 102000004384 Histamine H3 receptors Human genes 0.000 description 1
- 108090000981 Histamine H3 receptors Proteins 0.000 description 1
- 101000894929 Homo sapiens Bcl-2-related protein A1 Proteins 0.000 description 1
- 101000908391 Homo sapiens Dipeptidyl peptidase 4 Proteins 0.000 description 1
- 101000886868 Homo sapiens Gastric inhibitory polypeptide Proteins 0.000 description 1
- 101000996752 Homo sapiens Glucose-dependent insulinotropic receptor Proteins 0.000 description 1
- 101000843809 Homo sapiens Hydroxycarboxylic acid receptor 2 Proteins 0.000 description 1
- 101001063991 Homo sapiens Leptin Proteins 0.000 description 1
- 101000978418 Homo sapiens Melanocortin receptor 4 Proteins 0.000 description 1
- 102100030643 Hydroxycarboxylic acid receptor 2 Human genes 0.000 description 1
- 108010000775 Hydroxymethylglutaryl-CoA synthase Proteins 0.000 description 1
- 102100028888 Hydroxymethylglutaryl-CoA synthase, cytoplasmic Human genes 0.000 description 1
- OMCPLEZZPVJJIS-UHFFFAOYSA-N Hypadil (TN) Chemical compound C1C(O[N+]([O-])=O)COC2=C1C=CC=C2OCC(O)CNC(C)C OMCPLEZZPVJJIS-UHFFFAOYSA-N 0.000 description 1
- 206010020710 Hyperphagia Diseases 0.000 description 1
- 201000001431 Hyperuricemia Diseases 0.000 description 1
- 208000013016 Hypoglycemia Diseases 0.000 description 1
- 206010058359 Hypogonadism Diseases 0.000 description 1
- 102100021711 Ileal sodium/bile acid cotransporter Human genes 0.000 description 1
- 101710156096 Ileal sodium/bile acid cotransporter Proteins 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108010089308 Insulin Detemir Proteins 0.000 description 1
- 108010057186 Insulin Glargine Proteins 0.000 description 1
- COCFEDIXXNGUNL-RFKWWTKHSA-N Insulin glargine Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H]1CSSC[C@H]2C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3NC=NC=3)NC(=O)[C@H](CO)NC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(=O)NCC(O)=O)=O)CSSC[C@@H](C(N2)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CN=CN1 COCFEDIXXNGUNL-RFKWWTKHSA-N 0.000 description 1
- 201000001429 Intracranial Thrombosis Diseases 0.000 description 1
- 241000764238 Isis Species 0.000 description 1
- LPHGQDQBBGAPDZ-UHFFFAOYSA-N Isocaffeine Natural products CN1C(=O)N(C)C(=O)C2=C1N(C)C=N2 LPHGQDQBBGAPDZ-UHFFFAOYSA-N 0.000 description 1
- 108700040553 JMV 180 Proteins 0.000 description 1
- YQEZLKZALYSWHR-UHFFFAOYSA-N Ketamine Chemical compound C=1C=CC=C(Cl)C=1C1(NC)CCCCC1=O YQEZLKZALYSWHR-UHFFFAOYSA-N 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- OIGHTPDWPMLMGT-UHFFFAOYSA-N LSM-3233 Chemical compound C1CNCC2=CC=CC3=C2N1C1=C3CCCC1 OIGHTPDWPMLMGT-UHFFFAOYSA-N 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- 208000007177 Left Ventricular Hypertrophy Diseases 0.000 description 1
- WTOVRSWDBLIFHU-UHFFFAOYSA-N Lemildipine Chemical compound COC(=O)C1=C(C)NC(COC(N)=O)=C(C(=O)OC(C)C)C1C1=CC=CC(Cl)=C1Cl WTOVRSWDBLIFHU-UHFFFAOYSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 229940086609 Lipase inhibitor Drugs 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- SIKWOTFNWURSAY-UHFFFAOYSA-N Lipstatin Natural products CCCCCCC1C(CC(CC=CCC=CCCCCC)C(=O)OC(CC(C)C)NC=O)OC1=O SIKWOTFNWURSAY-UHFFFAOYSA-N 0.000 description 1
- YSDQQAXHVYUZIW-QCIJIYAXSA-N Liraglutide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCNC(=O)CC[C@H](NC(=O)CCCCCCCCCCCCCCC)C(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 YSDQQAXHVYUZIW-QCIJIYAXSA-N 0.000 description 1
- 108010019598 Liraglutide Proteins 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- XVVOERDUTLJJHN-UHFFFAOYSA-N Lixisenatide Chemical compound C=1NC2=CC=CC=C2C=1CC(C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(CC(N)=O)C(=O)NCC(=O)NCC(=O)N1C(CCC1)C(=O)NC(CO)C(=O)NC(CO)C(=O)NCC(=O)NC(C)C(=O)N1C(CCC1)C(=O)N1C(CCC1)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)CC)NC(=O)C(NC(=O)C(CC(C)C)NC(=O)C(CCCNC(N)=N)NC(=O)C(NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(CCC(O)=O)NC(=O)C(CCC(O)=O)NC(=O)C(CCSC)NC(=O)C(CCC(N)=O)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(NC(=O)C(CC=1C=CC=CC=1)NC(=O)C(NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)CNC(=O)C(N)CC=1NC=NC=1)C(C)O)C(C)O)C(C)C)CC1=CC=CC=C1 XVVOERDUTLJJHN-UHFFFAOYSA-N 0.000 description 1
- 208000008930 Low Back Pain Diseases 0.000 description 1
- 101150051050 MC3R gene Proteins 0.000 description 1
- 101150110867 MC4R gene Proteins 0.000 description 1
- 101150048659 MC5R gene Proteins 0.000 description 1
- 102000001796 Melanocortin 4 receptors Human genes 0.000 description 1
- 102000030612 Melanocortin 5 receptor Human genes 0.000 description 1
- 108010088565 Melanocortin 5 receptor Proteins 0.000 description 1
- 102100023724 Melanocortin receptor 4 Human genes 0.000 description 1
- 102100034216 Melanocyte-stimulating hormone receptor Human genes 0.000 description 1
- 208000019255 Menstrual disease Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- IBAQFPQHRJAVAV-ULAWRXDQSA-N Miglitol Chemical compound OCCN1C[C@H](O)[C@@H](O)[C@H](O)[C@H]1CO IBAQFPQHRJAVAV-ULAWRXDQSA-N 0.000 description 1
- ZFMITUMMTDLWHR-UHFFFAOYSA-N Minoxidil Chemical compound NC1=[N+]([O-])C(N)=CC(N2CCCCC2)=N1 ZFMITUMMTDLWHR-UHFFFAOYSA-N 0.000 description 1
- UWWDHYUMIORJTA-HSQYWUDLSA-N Moexipril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](CC2=CC(OC)=C(OC)C=C2C1)C(O)=O)CC1=CC=CC=C1 UWWDHYUMIORJTA-HSQYWUDLSA-N 0.000 description 1
- PCZOHLXUXFIOCF-UHFFFAOYSA-N Monacolin X Natural products C12C(OC(=O)C(C)CC)CC(C)C=C2C=CC(C)C1CCC1CC(O)CC(=O)O1 PCZOHLXUXFIOCF-UHFFFAOYSA-N 0.000 description 1
- WPNJAUFVNXKLIM-UHFFFAOYSA-N Moxonidine Chemical compound COC1=NC(C)=NC(Cl)=C1NC1=NCCN1 WPNJAUFVNXKLIM-UHFFFAOYSA-N 0.000 description 1
- 101100380295 Mus musculus Asah1 gene Proteins 0.000 description 1
- 208000023178 Musculoskeletal disease Diseases 0.000 description 1
- QKDDJDBFONZGBW-UHFFFAOYSA-N N-Cyclohexy-4-(imidazol-4-yl)-1-piperidinecarbothioamide Chemical compound C1CC(C=2NC=NC=2)CCN1C(=S)NC1CCCCC1 QKDDJDBFONZGBW-UHFFFAOYSA-N 0.000 description 1
- UIAYVIIHMORPSJ-UHFFFAOYSA-N N-cyclohexyl-N-methyl-4-[(2-oxo-1H-quinolin-6-yl)oxy]butanamide Chemical compound C=1C=C2NC(=O)C=CC2=CC=1OCCCC(=O)N(C)C1CCCCC1 UIAYVIIHMORPSJ-UHFFFAOYSA-N 0.000 description 1
- UEEJHVSXFDXPFK-UHFFFAOYSA-N N-dimethylaminoethanol Chemical compound CN(C)CCO UEEJHVSXFDXPFK-UHFFFAOYSA-N 0.000 description 1
- GHAZCVNUKKZTLG-UHFFFAOYSA-N N-ethyl-succinimide Natural products CCN1C(=O)CCC1=O GHAZCVNUKKZTLG-UHFFFAOYSA-N 0.000 description 1
- HDFGOPSGAURCEO-UHFFFAOYSA-N N-ethylmaleimide Chemical compound CCN1C(=O)C=CC1=O HDFGOPSGAURCEO-UHFFFAOYSA-N 0.000 description 1
- HTLZVHNRZJPSMI-UHFFFAOYSA-N N-ethylpiperidine Chemical compound CCN1CCCCC1 HTLZVHNRZJPSMI-UHFFFAOYSA-N 0.000 description 1
- AAKDPDFZMNYDLR-UHFFFAOYSA-N N-methyl deoxynojirimycin Natural products CN1CC(O)C(O)C(O)C1CO AAKDPDFZMNYDLR-UHFFFAOYSA-N 0.000 description 1
- AAKDPDFZMNYDLR-XZBKPIIZSA-N N-methyl-1-deoxynojirimycin Chemical compound CN1C[C@H](O)[C@@H](O)[C@H](O)[C@H]1CO AAKDPDFZMNYDLR-XZBKPIIZSA-N 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 229910002651 NO3 Inorganic materials 0.000 description 1
- HRRBJVNMSRJFHQ-UHFFFAOYSA-N Naftopidil Chemical compound COC1=CC=CC=C1N1CCN(CC(O)COC=2C3=CC=CC=C3C=CC=2)CC1 HRRBJVNMSRJFHQ-UHFFFAOYSA-N 0.000 description 1
- OKJHGOPITGTTIM-DEOSSOPVSA-N Naveglitazar Chemical compound C1=CC(C[C@H](OC)C(O)=O)=CC=C1OCCCOC(C=C1)=CC=C1OC1=CC=CC=C1 OKJHGOPITGTTIM-DEOSSOPVSA-N 0.000 description 1
- 108010025020 Nerve Growth Factor Proteins 0.000 description 1
- 102000007072 Nerve Growth Factors Human genes 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 102000030937 Neuromedin U receptor Human genes 0.000 description 1
- 108010002741 Neuromedin U receptor Proteins 0.000 description 1
- 102000011015 Neuropeptide FF receptor Human genes 0.000 description 1
- 108010061550 Neuropeptide FF receptor Proteins 0.000 description 1
- ZBBHBTPTTSWHBA-UHFFFAOYSA-N Nicardipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OCCN(C)CC=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 ZBBHBTPTTSWHBA-UHFFFAOYSA-N 0.000 description 1
- 108700010041 Nicotinic acid receptor Proteins 0.000 description 1
- FAIIFDPAEUKBEP-UHFFFAOYSA-N Nilvadipine Chemical compound COC(=O)C1=C(C#N)NC(C)=C(C(=O)OC(C)C)C1C1=CC=CC([N+]([O-])=O)=C1 FAIIFDPAEUKBEP-UHFFFAOYSA-N 0.000 description 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 1
- 208000004166 Obesity Hypoventilation Syndrome Diseases 0.000 description 1
- PSZDOEIIIJFCFE-UHFFFAOYSA-N Oleanolic alcohol Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C)CCC5(CO)CCC(C)(C)CC5C4=CCC3C21C PSZDOEIIIJFCFE-UHFFFAOYSA-N 0.000 description 1
- 102000002512 Orexin Human genes 0.000 description 1
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 1
- JYDNKGUBLIKNAM-UHFFFAOYSA-N Oxyallobutulin Natural products C1CC(=O)C(C)(C)C2CCC3(C)C4(C)CCC5(CO)CCC(C(=C)C)C5C4CCC3C21C JYDNKGUBLIKNAM-UHFFFAOYSA-N 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 108010015181 PPAR delta Proteins 0.000 description 1
- 235000021314 Palmitic acid Nutrition 0.000 description 1
- 206010033649 Pancreatitis chronic Diseases 0.000 description 1
- 241000282320 Panthera leo Species 0.000 description 1
- AHOUBRCZNHFOSL-UHFFFAOYSA-N Paroxetine hydrochloride Natural products C1=CC(F)=CC=C1C1C(COC=2C=C3OCOC3=CC=2)CNCC1 AHOUBRCZNHFOSL-UHFFFAOYSA-N 0.000 description 1
- BYPFEZZEUUWMEJ-UHFFFAOYSA-N Pentoxifylline Chemical compound O=C1N(CCCCC(=O)C)C(=O)N(C)C2=C1N(C)C=N2 BYPFEZZEUUWMEJ-UHFFFAOYSA-N 0.000 description 1
- 101710176384 Peptide 1 Proteins 0.000 description 1
- 101800001672 Peptide YY(3-36) Proteins 0.000 description 1
- 108010017419 Ph(CH(2))(3)CO-His-D-Phe-Arg-Trp-NH(2) Proteins 0.000 description 1
- 102000016462 Phosphate Transport Proteins Human genes 0.000 description 1
- 108010092528 Phosphate Transport Proteins Proteins 0.000 description 1
- 208000010067 Pituitary ACTH Hypersecretion Diseases 0.000 description 1
- 208000020627 Pituitary-dependent Cushing syndrome Diseases 0.000 description 1
- 229920000361 Poly(styrene)-block-poly(ethylene glycol) Polymers 0.000 description 1
- 201000010769 Prader-Willi syndrome Diseases 0.000 description 1
- QJLPWVUZFKETMK-UHFFFAOYSA-N Pradimicin Q Natural products O=C1C2=C(O)C=C(O)C=C2C(=O)C2=C1C(O)=C1CC(O)C(C=C(C(=C3O)C(O)=O)C)=C3C1=C2O QJLPWVUZFKETMK-UHFFFAOYSA-N 0.000 description 1
- 239000005477 Pratosartan Substances 0.000 description 1
- TUZYXOIXSAXUGO-UHFFFAOYSA-N Pravastatin Natural products C1=CC(C)C(CCC(O)CC(O)CC(O)=O)C2C(OC(=O)C(C)CC)CC(O)C=C21 TUZYXOIXSAXUGO-UHFFFAOYSA-N 0.000 description 1
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 108010058003 Proglucagon Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 102000007568 Proto-Oncogene Proteins c-fos Human genes 0.000 description 1
- 108010071563 Proto-Oncogene Proteins c-fos Proteins 0.000 description 1
- 101150114644 Rapgef3 gene Proteins 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 208000017442 Retinal disease Diseases 0.000 description 1
- 206010038923 Retinopathy Diseases 0.000 description 1
- CQXADFVORZEARL-UHFFFAOYSA-N Rilmenidine Chemical compound C1CC1C(C1CC1)NC1=NCCO1 CQXADFVORZEARL-UHFFFAOYSA-N 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- AJLFOPYRIVGYMJ-UHFFFAOYSA-N SJ000287055 Natural products C12C(OC(=O)C(C)CC)CCC=C2C=CC(C)C1CCC1CC(O)CC(=O)O1 AJLFOPYRIVGYMJ-UHFFFAOYSA-N 0.000 description 1
- OCTNNXHKAOLDJL-BMGYQPLYSA-N Salbostatin Chemical compound O[C@H]1[C@H](O)[C@@H](CO)OC[C@@H]1N[C@@H]1[C@H](O)[C@@H](O)[C@H](O)C(CO)=C1 OCTNNXHKAOLDJL-BMGYQPLYSA-N 0.000 description 1
- OCTNNXHKAOLDJL-UHFFFAOYSA-N Salbostatin Natural products OC1C(O)C(CO)OCC1NC1C(O)C(O)C(O)C(CO)=C1 OCTNNXHKAOLDJL-UHFFFAOYSA-N 0.000 description 1
- 208000020221 Short stature Diseases 0.000 description 1
- 102000000070 Sodium-Glucose Transport Proteins Human genes 0.000 description 1
- 108010080361 Sodium-Glucose Transport Proteins Proteins 0.000 description 1
- 102100038803 Somatotropin Human genes 0.000 description 1
- 102000005782 Squalene Monooxygenase Human genes 0.000 description 1
- 108020003891 Squalene monooxygenase Proteins 0.000 description 1
- 229930182558 Sterol Natural products 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- RKSMVPNZHBRNNS-UHFFFAOYSA-N Succinobucol Chemical compound CC(C)(C)C1=C(O)C(C(C)(C)C)=CC(SC(C)(C)SC=2C=C(C(OC(=O)CCC(O)=O)=C(C=2)C(C)(C)C)C(C)(C)C)=C1 RKSMVPNZHBRNNS-UHFFFAOYSA-N 0.000 description 1
- 206010042434 Sudden death Diseases 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 229940100389 Sulfonylurea Drugs 0.000 description 1
- ODKDMMTXTVCCLJ-UHFFFAOYSA-N TMC-2A Natural products C1=CC=C2C(CC(N)C(=O)N3C(CC4=CC(O)=C(C(=C4C3)O)OC)C(=O)NC(CC(CO)CO)C(O)=O)=CNC2=C1 ODKDMMTXTVCCLJ-UHFFFAOYSA-N 0.000 description 1
- 206010043087 Tachyphylaxis Diseases 0.000 description 1
- 229920002253 Tannate Polymers 0.000 description 1
- HTWFXPCUFWKXOP-UHFFFAOYSA-N Tertatalol Chemical compound C1CCSC2=C1C=CC=C2OCC(O)CNC(C)(C)C HTWFXPCUFWKXOP-UHFFFAOYSA-N 0.000 description 1
- 229940123464 Thiazolidinedione Drugs 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- AUYYCJSJGJYCDS-LBPRGKRZSA-N Thyrolar Chemical class IC1=CC(C[C@H](N)C(O)=O)=CC(I)=C1OC1=CC=C(O)C(I)=C1 AUYYCJSJGJYCDS-LBPRGKRZSA-N 0.000 description 1
- JLRGJRBPOGGCBT-UHFFFAOYSA-N Tolbutamide Chemical compound CCCCNC(=O)NS(=O)(=O)C1=CC=C(C)C=C1 JLRGJRBPOGGCBT-UHFFFAOYSA-N 0.000 description 1
- NGBFQHCMQULJNZ-UHFFFAOYSA-N Torsemide Chemical compound CC(C)NC(=O)NS(=O)(=O)C1=CN=CC=C1NC1=CC=CC(C)=C1 NGBFQHCMQULJNZ-UHFFFAOYSA-N 0.000 description 1
- VXFJYXUZANRPDJ-WTNASJBWSA-N Trandopril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](C[C@H]2CCCC[C@@H]21)C(O)=O)CC1=CC=CC=C1 VXFJYXUZANRPDJ-WTNASJBWSA-N 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 208000032109 Transient ischaemic attack Diseases 0.000 description 1
- 229930186167 Trestatin Natural products 0.000 description 1
- FNYLWPVRPXGIIP-UHFFFAOYSA-N Triamterene Chemical compound NC1=NC2=NC(N)=NC(N)=C2N=C1C1=CC=CC=C1 FNYLWPVRPXGIIP-UHFFFAOYSA-N 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 208000026928 Turner syndrome Diseases 0.000 description 1
- 108010021428 Type 1 Melanocortin Receptor Proteins 0.000 description 1
- 108010021433 Type 3 Melanocortin Receptor Proteins 0.000 description 1
- 102000008318 Type 3 Melanocortin Receptor Human genes 0.000 description 1
- 108010021436 Type 4 Melanocortin Receptor Proteins 0.000 description 1
- ICMGLRUYEQNHPF-UHFFFAOYSA-N Uraprene Chemical compound COC1=CC=CC=C1N1CCN(CCCNC=2N(C(=O)N(C)C(=O)C=2)C)CC1 ICMGLRUYEQNHPF-UHFFFAOYSA-N 0.000 description 1
- WWGVIIVMPMBQFV-HAGHYFMRSA-N Valilactone Natural products CCCCCC[C@H]1[C@@H](C[C@H](CCCCC)OC(=O)[C@@H](NC=O)C(C)C)OC1=O WWGVIIVMPMBQFV-HAGHYFMRSA-N 0.000 description 1
- 102100038286 Vasoactive intestinal polypeptide receptor 2 Human genes 0.000 description 1
- 101710137651 Vasoactive intestinal polypeptide receptor 2 Proteins 0.000 description 1
- FZNCGRZWXLXZSZ-CIQUZCHMSA-N Voglibose Chemical compound OCC(CO)N[C@H]1C[C@](O)(CO)[C@@H](O)[C@H](O)[C@H]1O FZNCGRZWXLXZSZ-CIQUZCHMSA-N 0.000 description 1
- 206010047700 Vomiting Diseases 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- WWGVIIVMPMBQFV-MUGJNUQGSA-N [(2s)-1-[(2s,3s)-3-hexyl-4-oxooxetan-2-yl]heptan-2-yl] (2s)-2-formamido-3-methylbutanoate Chemical compound CCCCCC[C@H]1[C@H](C[C@H](CCCCC)OC(=O)[C@@H](NC=O)C(C)C)OC1=O WWGVIIVMPMBQFV-MUGJNUQGSA-N 0.000 description 1
- HSAZLLJXXMJGPB-LUICLMBMSA-N [(3r,4r)-1-tert-butyl-3-(2,3,4-trifluorophenyl)piperidin-4-yl]-[(5s)-3-chloro-2-methyl-5-[2-(2-methyl-1,2,4-triazol-3-yl)propan-2-yl]spiro[5h-furo[3,4-b]pyridine-7,4'-piperidine]-1'-yl]methanone Chemical compound C1([C@@H]2CN(CC[C@H]2C(=O)N2CCC3(CC2)O[C@@H](C2=C3N=C(C(=C2)Cl)C)C(C)(C)C=2N(N=CN=2)C)C(C)(C)C)=CC=C(F)C(F)=C1F HSAZLLJXXMJGPB-LUICLMBMSA-N 0.000 description 1
- CERRORPJQOKMDZ-BIUYVPHKSA-N [(3s,4r)-1-tert-butyl-4-(2,4-difluorophenyl)pyrrolidin-3-yl]-[3-chloro-2-methyl-5-[2-(2-methyl-1,2,4-triazol-3-yl)propan-2-yl]spiro[5h-furo[3,4-b]pyridine-7,4'-piperidine]-1'-yl]methanone Chemical compound C1([C@@H]2CN(C[C@H]2C(=O)N2CCC3(CC2)OC(C2=C3N=C(C(=C2)Cl)C)C(C)(C)C=2N(N=CN=2)C)C(C)(C)C)=CC=C(F)C=C1F CERRORPJQOKMDZ-BIUYVPHKSA-N 0.000 description 1
- IMIPDPVHGGHVNH-YWVHRCQQSA-N [(8r,9s,13s,14s)-13-methyl-17-oxo-7,8,9,11,12,14,15,16-octahydro-6h-cyclopenta[a]phenanthren-3-yl] (z)-octadec-9-enoate Chemical compound C1C[C@]2(C)C(=O)CC[C@H]2[C@@H]2CCC3=CC(OC(=O)CCCCCCC\C=C/CCCCCCCC)=CC=C3[C@H]21 IMIPDPVHGGHVNH-YWVHRCQQSA-N 0.000 description 1
- RLVLLBHWAQWLKL-UHFFFAOYSA-N [2-[4-(2-methylpropyl)cyclohexyl]-2-oxoethyl] benzenesulfonate Chemical compound C1CC(CC(C)C)CCC1C(=O)COS(=O)(=O)C1=CC=CC=C1 RLVLLBHWAQWLKL-UHFFFAOYSA-N 0.000 description 1
- RRVPPYNAZJRZFR-MRCUWXFGSA-N [2-hexadecanoyloxy-3-[(z)-octadec-9-enoyl]oxypropyl] 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OC(COP([O-])(=O)OCC[N+](C)(C)C)COC(=O)CCCCCCC\C=C/CCCCCCCC RRVPPYNAZJRZFR-MRCUWXFGSA-N 0.000 description 1
- LMNURGKCJVWFQY-UHFFFAOYSA-N [5-[1'-(4,8-dimethoxyquinoline-2-carbonyl)-4-oxospiro[3h-chromene-2,4'-piperidine]-6-yl]tetrazol-2-yl]methyl 2,2-dimethylpropanoate Chemical compound N=1C2=C(OC)C=CC=C2C(OC)=CC=1C(=O)N(CC1)CCC1(OC1=CC=2)CC(=O)C1=CC=2C=1N=NN(COC(=O)C(C)(C)C)N=1 LMNURGKCJVWFQY-UHFFFAOYSA-N 0.000 description 1
- BURXPKLPMVCPBI-PEUYHFQRSA-N [H][C@@]12CC=C3CC(OC(=O)CCOCCOCCOCCOCCNC(=O)CSC[C@H](NC)C(N)=O)CC[C@]3(C)[C@@]1([H])CC[C@]1(C)[C@@H]([C@H](C)CCCC(C)C)CC[C@@]21[H] Chemical compound [H][C@@]12CC=C3CC(OC(=O)CCOCCOCCOCCOCCNC(=O)CSC[C@H](NC)C(N)=O)CC[C@]3(C)[C@@]1([H])CC[C@]1(C)[C@@H]([C@H](C)CCCC(C)C)CC[C@@]21[H] BURXPKLPMVCPBI-PEUYHFQRSA-N 0.000 description 1
- UMMWUGLAXPLWDZ-ATWYKNOESA-N [H][C@@]12CC=C3CC(OC(=O)CSC[C@H](NC)C(N)=O)CC[C@]3(C)[C@@]1([H])CC[C@]1(C)[C@@H]([C@H](C)CCCC(C)C)CC[C@@]21[H] Chemical compound [H][C@@]12CC=C3CC(OC(=O)CSC[C@H](NC)C(N)=O)CC[C@]3(C)[C@@]1([H])CC[C@]1(C)[C@@H]([C@H](C)CCCC(C)C)CC[C@@]21[H] UMMWUGLAXPLWDZ-ATWYKNOESA-N 0.000 description 1
- XLTMUFRACYRYJG-WYJCYURMSA-A [Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].COCCO[C@@H]1[C@H](O)[C@@H](COP([O-])(=S)O[C@@H]2[C@@H](COP([S-])(=O)O[C@@H]3[C@@H](COP([O-])(=S)O[C@@H]4[C@@H](COP([O-])(=S)O[C@@H]5[C@@H](COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@@H]6[C@@H](COP([O-])(=S)O[C@@H]7[C@@H](COP([O-])(=S)O[C@@H]8[C@@H](COP([O-])(=S)O[C@@H]9[C@@H](COP([O-])(=S)O[C@@H]%10[C@@H](CO)O[C@H]([C@@H]%10OCCOC)n%10cnc%11c%10nc(N)[nH]c%11=O)O[C@H]([C@@H]9OCCOC)n9cc(C)c(N)nc9=O)O[C@H]([C@@H]8OCCOC)n8cc(C)c(N)nc8=O)O[C@H]([C@@H]7OCCOC)n7cc(C)c(=O)[nH]c7=O)O[C@H]([C@@H]6OCCOC)n6cc(C)c(N)nc6=O)n6cnc7c(N)ncnc67)n6cnc7c6nc(N)[nH]c7=O)n6cc(C)c(=O)[nH]c6=O)n6cc(C)c(N)nc6=O)n6cc(C)c(=O)[nH]c6=O)n6cnc7c6nc(N)[nH]c7=O)n6cc(C)c(N)nc6=O)n6cc(C)c(=O)[nH]c6=O)n6cc(C)c(=O)[nH]c6=O)n6cc(C)c(N)nc6=O)O[C@H]([C@@H]5OCCOC)n5cnc6c5nc(N)[nH]c6=O)O[C@H]([C@@H]4OCCOC)n4cc(C)c(N)nc4=O)O[C@H]([C@@H]3OCCOC)n3cnc4c(N)ncnc34)O[C@H]([C@@H]2OCCOC)n2cc(C)c(N)nc2=O)O[C@H]1n1cc(C)c(N)nc1=O Chemical compound [Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].COCCO[C@@H]1[C@H](O)[C@@H](COP([O-])(=S)O[C@@H]2[C@@H](COP([S-])(=O)O[C@@H]3[C@@H](COP([O-])(=S)O[C@@H]4[C@@H](COP([O-])(=S)O[C@@H]5[C@@H](COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@H]6C[C@@H](O[C@@H]6COP([O-])(=S)O[C@@H]6[C@@H](COP([O-])(=S)O[C@@H]7[C@@H](COP([O-])(=S)O[C@@H]8[C@@H](COP([O-])(=S)O[C@@H]9[C@@H](COP([O-])(=S)O[C@@H]%10[C@@H](CO)O[C@H]([C@@H]%10OCCOC)n%10cnc%11c%10nc(N)[nH]c%11=O)O[C@H]([C@@H]9OCCOC)n9cc(C)c(N)nc9=O)O[C@H]([C@@H]8OCCOC)n8cc(C)c(N)nc8=O)O[C@H]([C@@H]7OCCOC)n7cc(C)c(=O)[nH]c7=O)O[C@H]([C@@H]6OCCOC)n6cc(C)c(N)nc6=O)n6cnc7c(N)ncnc67)n6cnc7c6nc(N)[nH]c7=O)n6cc(C)c(=O)[nH]c6=O)n6cc(C)c(N)nc6=O)n6cc(C)c(=O)[nH]c6=O)n6cnc7c6nc(N)[nH]c7=O)n6cc(C)c(N)nc6=O)n6cc(C)c(=O)[nH]c6=O)n6cc(C)c(=O)[nH]c6=O)n6cc(C)c(N)nc6=O)O[C@H]([C@@H]5OCCOC)n5cnc6c5nc(N)[nH]c6=O)O[C@H]([C@@H]4OCCOC)n4cc(C)c(N)nc4=O)O[C@H]([C@@H]3OCCOC)n3cnc4c(N)ncnc34)O[C@H]([C@@H]2OCCOC)n2cc(C)c(N)nc2=O)O[C@H]1n1cc(C)c(N)nc1=O XLTMUFRACYRYJG-WYJCYURMSA-A 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 229960002122 acebutolol Drugs 0.000 description 1
- GOEMGAFJFRBGGG-UHFFFAOYSA-N acebutolol Chemical compound CCCC(=O)NC1=CC=C(OCC(O)CNC(C)C)C(C(C)=O)=C1 GOEMGAFJFRBGGG-UHFFFAOYSA-N 0.000 description 1
- 229940022663 acetate Drugs 0.000 description 1
- 229960001466 acetohexamide Drugs 0.000 description 1
- VGZSUPCWNCWDAN-UHFFFAOYSA-N acetohexamide Chemical compound C1=CC(C(=O)C)=CC=C1S(=O)(=O)NC(=O)NC1CCCCC1 VGZSUPCWNCWDAN-UHFFFAOYSA-N 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 229960004733 albiglutide Drugs 0.000 description 1
- OGWAVGNOAMXIIM-UHFFFAOYSA-N albiglutide Chemical compound O=C(O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)CNC(=O)C(N)CC=1(N=CNC=1))CCC(=O)O)C(O)C)CC2(=CC=CC=C2))C(O)C)CO)CC(=O)O)C(C)C)CO)CO)CC3(=CC=C(O)C=C3))CC(C)C)CCC(=O)O)CCC(=O)N)C)C)CCCCN)CCC(=O)O)CC4(=CC=CC=C4))C(CC)C)C)CC=6(C5(=C(C=CC=C5)NC=6)))CC(C)C)C(C)C)CCCCN)CCCNC(=N)N OGWAVGNOAMXIIM-UHFFFAOYSA-N 0.000 description 1
- 229960002478 aldosterone Drugs 0.000 description 1
- 239000002170 aldosterone antagonist Substances 0.000 description 1
- 229940083712 aldosterone antagonist Drugs 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- ZSBOMTDTBDDKMP-OAHLLOKOSA-N alogliptin Chemical compound C=1C=CC=C(C#N)C=1CN1C(=O)N(C)C(=O)C=C1N1CCC[C@@H](N)C1 ZSBOMTDTBDDKMP-OAHLLOKOSA-N 0.000 description 1
- 239000002160 alpha blocker Substances 0.000 description 1
- 239000003888 alpha glucosidase inhibitor Substances 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XSDQTOBWRPYKKA-UHFFFAOYSA-N amiloride Chemical compound NC(=N)NC(=O)C1=NC(Cl)=C(N)N=C1N XSDQTOBWRPYKKA-UHFFFAOYSA-N 0.000 description 1
- 229960002576 amiloride Drugs 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- HTIQEAQVCYTUBX-UHFFFAOYSA-N amlodipine Chemical compound CCOC(=O)C1=C(COCCN)NC(C)=C(C(=O)OC)C1C1=CC=CC=C1Cl HTIQEAQVCYTUBX-UHFFFAOYSA-N 0.000 description 1
- 229960000528 amlodipine Drugs 0.000 description 1
- 235000019270 ammonium chloride Nutrition 0.000 description 1
- 150000003863 ammonium salts Chemical class 0.000 description 1
- LVEXHFZHOIWIIP-UHFFFAOYSA-N amosulalol Chemical compound COC1=CC=CC=C1OCCNCC(O)C1=CC=C(C)C(S(N)(=O)=O)=C1 LVEXHFZHOIWIIP-UHFFFAOYSA-N 0.000 description 1
- 229950010351 amosulalol Drugs 0.000 description 1
- 239000003392 amylase inhibitor Substances 0.000 description 1
- LDXYBEHACFJIEL-HNNXBMFYSA-N anagliptin Chemical compound C=1N2N=C(C)C=C2N=CC=1C(=O)NCC(C)(C)NCC(=O)N1CCC[C@H]1C#N LDXYBEHACFJIEL-HNNXBMFYSA-N 0.000 description 1
- 239000002333 angiotensin II receptor antagonist Substances 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 150000004303 annulenes Chemical class 0.000 description 1
- 229940125708 antidiabetic agent Drugs 0.000 description 1
- 239000003472 antidiabetic agent Substances 0.000 description 1
- 229940030600 antihypertensive agent Drugs 0.000 description 1
- 239000002220 antihypertensive agent Substances 0.000 description 1
- 239000003524 antilipemic agent Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 229940127218 antiplatelet drug Drugs 0.000 description 1
- 230000036506 anxiety Effects 0.000 description 1
- 239000002830 appetite depressant Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 229950007556 aranidipine Drugs 0.000 description 1
- FOIVPCKZDPCJJY-JQIJEIRASA-N arotinoid acid Chemical compound C=1C=C(C(CCC2(C)C)(C)C)C2=CC=1C(/C)=C/C1=CC=C(C(O)=O)C=C1 FOIVPCKZDPCJJY-JQIJEIRASA-N 0.000 description 1
- BHIAIPWSVYSKJS-UHFFFAOYSA-N arotinolol Chemical compound S1C(SCC(O)CNC(C)(C)C)=NC(C=2SC(=CC=2)C(N)=O)=C1 BHIAIPWSVYSKJS-UHFFFAOYSA-N 0.000 description 1
- 229950010731 arotinolol Drugs 0.000 description 1
- 206010003119 arrhythmia Diseases 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 239000012131 assay buffer Substances 0.000 description 1
- FAIMGWSOSCFGRU-UHFFFAOYSA-N atc-0175 Chemical compound N=1C2=CC=CC=C2C(N(C)C)=NC=1NC(CC1)CCC1NC(=O)C1=CC=C(F)C(F)=C1 FAIMGWSOSCFGRU-UHFFFAOYSA-N 0.000 description 1
- 229960002274 atenolol Drugs 0.000 description 1
- 230000000923 atherogenic effect Effects 0.000 description 1
- 230000003143 atherosclerotic effect Effects 0.000 description 1
- 229940054739 avandamet Drugs 0.000 description 1
- 229950010046 avasimibe Drugs 0.000 description 1
- 108010014210 axokine Proteins 0.000 description 1
- 229950004646 azelnidipine Drugs 0.000 description 1
- MNFORVFSTILPAW-UHFFFAOYSA-N azetidin-2-one Chemical class O=C1CCN1 MNFORVFSTILPAW-UHFFFAOYSA-N 0.000 description 1
- 125000004567 azetidin-3-yl group Chemical group N1CC(C1)* 0.000 description 1
- OGBUMNBNEWYMNJ-UHFFFAOYSA-N batilol Chemical class CCCCCCCCCCCCCCCCCCOCC(O)CO OGBUMNBNEWYMNJ-UHFFFAOYSA-N 0.000 description 1
- HYHMLYSLQUKXKP-UHFFFAOYSA-N bempedoic acid Chemical compound OC(=O)C(C)(C)CCCCCC(O)CCCCCC(C)(C)C(O)=O HYHMLYSLQUKXKP-UHFFFAOYSA-N 0.000 description 1
- 229960004530 benazepril Drugs 0.000 description 1
- 229960004916 benidipine Drugs 0.000 description 1
- QZVNQOLPLYWLHQ-ZEQKJWHPSA-N benidipine Chemical compound C1([C@H]2C(=C(C)NC(C)=C2C(=O)OC)C(=O)O[C@H]2CN(CC=3C=CC=CC=3)CCC2)=CC=CC([N+]([O-])=O)=C1 QZVNQOLPLYWLHQ-ZEQKJWHPSA-N 0.000 description 1
- JUHORIMYRDESRB-UHFFFAOYSA-N benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- 229940050390 benzoate Drugs 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- 150000008366 benzophenones Chemical class 0.000 description 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 1
- 125000001584 benzyloxycarbonyl group Chemical group C(=O)(OCC1=CC=CC=C1)* 0.000 description 1
- UIEATEWHFDRYRU-UHFFFAOYSA-N bepridil Chemical compound C1CCCN1C(COCC(C)C)CN(C=1C=CC=CC=1)CC1=CC=CC=C1 UIEATEWHFDRYRU-UHFFFAOYSA-N 0.000 description 1
- 229960003665 bepridil Drugs 0.000 description 1
- 102000012740 beta Adrenergic Receptors Human genes 0.000 description 1
- 108010079452 beta Adrenergic Receptors Proteins 0.000 description 1
- 229940125388 beta agonist Drugs 0.000 description 1
- 229940076810 beta sitosterol Drugs 0.000 description 1
- 102000000072 beta-Arrestins Human genes 0.000 description 1
- 108010080367 beta-Arrestins Proteins 0.000 description 1
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 description 1
- LGJMUZUPVCAVPU-UHFFFAOYSA-N beta-Sitostanol Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(C)CCC(CC)C(C)C)C1(C)CC2 LGJMUZUPVCAVPU-UHFFFAOYSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- NJKOMDUNNDKEAI-UHFFFAOYSA-N beta-sitosterol Natural products CCC(CCC(C)C1CCC2(C)C3CC=C4CC(O)CCC4C3CCC12C)C(C)C NJKOMDUNNDKEAI-UHFFFAOYSA-N 0.000 description 1
- 229960003237 betaine Drugs 0.000 description 1
- 229960004324 betaxolol Drugs 0.000 description 1
- NWIUTZDMDHAVTP-UHFFFAOYSA-N betaxolol Chemical compound C1=CC(OCC(O)CNC(C)C)=CC=C1CCOCC1CC1 NWIUTZDMDHAVTP-UHFFFAOYSA-N 0.000 description 1
- FVWJYYTZTCVBKE-ROUWMTJPSA-N betulin Chemical compound C1C[C@H](O)C(C)(C)[C@@H]2CC[C@@]3(C)[C@]4(C)CC[C@@]5(CO)CC[C@@H](C(=C)C)[C@@H]5[C@H]4CC[C@@H]3[C@]21C FVWJYYTZTCVBKE-ROUWMTJPSA-N 0.000 description 1
- MVIRREHRVZLANQ-UHFFFAOYSA-N betulin Natural products CC(=O)OC1CCC2(C)C(CCC3(C)C2CC=C4C5C(CCC5(CO)CCC34C)C(=C)C)C1(C)C MVIRREHRVZLANQ-UHFFFAOYSA-N 0.000 description 1
- QGJZLNKBHJESQX-FZFNOLFKSA-N betulinic acid Chemical compound C1C[C@H](O)C(C)(C)[C@@H]2CC[C@@]3(C)[C@]4(C)CC[C@@]5(C(O)=O)CC[C@@H](C(=C)C)[C@@H]5[C@H]4CC[C@@H]3[C@]21C QGJZLNKBHJESQX-FZFNOLFKSA-N 0.000 description 1
- 229960003588 bevantolol Drugs 0.000 description 1
- HXLAFSUPPDYFEO-UHFFFAOYSA-N bevantolol Chemical compound C1=C(OC)C(OC)=CC=C1CCNCC(O)COC1=CC=CC(C)=C1 HXLAFSUPPDYFEO-UHFFFAOYSA-N 0.000 description 1
- KUWBXRGRMQZCSS-HSZRJFAPSA-N bibp-3226 Chemical compound N([C@H](CCCN=C(N)N)C(=O)NCC=1C=CC(O)=CC=1)C(=O)C(C=1C=CC=CC=1)C1=CC=CC=C1 KUWBXRGRMQZCSS-HSZRJFAPSA-N 0.000 description 1
- 125000002619 bicyclic group Chemical group 0.000 description 1
- 150000004283 biguanides Chemical class 0.000 description 1
- 229920000080 bile acid sequestrant Polymers 0.000 description 1
- 229940096699 bile acid sequestrants Drugs 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229960002781 bisoprolol Drugs 0.000 description 1
- VHYCDWMUTMEGQY-UHFFFAOYSA-N bisoprolol Chemical compound CC(C)NCC(O)COC1=CC=C(COCCOC(C)C)C=C1 VHYCDWMUTMEGQY-UHFFFAOYSA-N 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 229960001035 bopindolol Drugs 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 235000021170 buffet Nutrition 0.000 description 1
- 229960004111 buformin Drugs 0.000 description 1
- XSEUMFJMFFMCIU-UHFFFAOYSA-N buformin Chemical compound CCCC\N=C(/N)N=C(N)N XSEUMFJMFFMCIU-UHFFFAOYSA-N 0.000 description 1
- 229960004064 bumetanide Drugs 0.000 description 1
- MAEIEVLCKWDQJH-UHFFFAOYSA-N bumetanide Chemical compound CCCCNC1=CC(C(O)=O)=CC(S(N)(=O)=O)=C1OC1=CC=CC=C1 MAEIEVLCKWDQJH-UHFFFAOYSA-N 0.000 description 1
- 229960002467 bunazosin Drugs 0.000 description 1
- 229960001058 bupropion Drugs 0.000 description 1
- 229940084891 byetta Drugs 0.000 description 1
- 230000003491 cAMP production Effects 0.000 description 1
- GVEZIHKRYBHEFX-UHFFFAOYSA-N caerulein A Natural products CC=CCC=CCCC(=O)C1OC1C(N)=O GVEZIHKRYBHEFX-UHFFFAOYSA-N 0.000 description 1
- 229960001948 caffeine Drugs 0.000 description 1
- VJEONQKOZGKCAK-UHFFFAOYSA-N caffeine Natural products CN1C(=O)N(C)C(=O)C2=C1C=CN2C VJEONQKOZGKCAK-UHFFFAOYSA-N 0.000 description 1
- 239000000480 calcium channel blocker Substances 0.000 description 1
- ZJKZKKPIKDNHDM-UHFFFAOYSA-L calcium;6-(5-carboxylato-5-methylhexoxy)-2,2-dimethylhexanoate Chemical compound [Ca+2].[O-]C(=O)C(C)(C)CCCCOCCCCC(C)(C)C([O-])=O ZJKZKKPIKDNHDM-UHFFFAOYSA-L 0.000 description 1
- 229950001261 camiglibose Drugs 0.000 description 1
- MIOPJNTWMNEORI-UHFFFAOYSA-N camphorsulfonic acid Chemical compound C1CC2(CS(O)(=O)=O)C(=O)CC1C2(C)C MIOPJNTWMNEORI-UHFFFAOYSA-N 0.000 description 1
- 229960000932 candesartan Drugs 0.000 description 1
- SGZAIDDFHDDFJU-UHFFFAOYSA-N candesartan Chemical compound CCOC1=NC2=CC=CC(C(O)=O)=C2N1CC(C=C1)=CC=C1C1=CC=CC=C1C1=NN=N[N]1 SGZAIDDFHDDFJU-UHFFFAOYSA-N 0.000 description 1
- LEMUFSYUPGXXCM-JNEQYSBXSA-N caninsulin Chemical compound [Zn].C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H]1CSSC[C@H]2C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC3N=CN=C3)NC(=O)[C@H](CO)NC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)O)C(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)=O)CSSC[C@@H](C(N2)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1C=NC=N1 LEMUFSYUPGXXCM-JNEQYSBXSA-N 0.000 description 1
- 229930003827 cannabinoid Natural products 0.000 description 1
- 239000003557 cannabinoid Substances 0.000 description 1
- KVLLHLWBPNCVNR-SKCUWOTOSA-N capromorelin Chemical compound C([C@@]12CN(CCC1=NN(C2=O)C)C(=O)[C@@H](COCC=1C=CC=CC=1)NC(=O)C(C)(C)N)C1=CC=CC=C1 KVLLHLWBPNCVNR-SKCUWOTOSA-N 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 229960000830 captopril Drugs 0.000 description 1
- FAKRSMQSSFJEIM-RQJHMYQMSA-N captopril Chemical compound SC[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O FAKRSMQSSFJEIM-RQJHMYQMSA-N 0.000 description 1
- 150000004657 carbamic acid derivatives Chemical class 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 150000007942 carboxylates Chemical group 0.000 description 1
- 125000002843 carboxylic acid group Chemical group 0.000 description 1
- 229960001222 carteolol Drugs 0.000 description 1
- LWAFSWPYPHEXKX-UHFFFAOYSA-N carteolol Chemical compound N1C(=O)CCC2=C1C=CC=C2OCC(O)CNC(C)(C)C LWAFSWPYPHEXKX-UHFFFAOYSA-N 0.000 description 1
- 229960004195 carvedilol Drugs 0.000 description 1
- NPAKNKYSJIDKMW-UHFFFAOYSA-N carvedilol Chemical compound COC1=CC=CC=C1OCCNCC(O)COC1=CC=CC2=NC3=CC=C[CH]C3=C12 NPAKNKYSJIDKMW-UHFFFAOYSA-N 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 229960002320 celiprolol Drugs 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 241000902900 cellular organisms Species 0.000 description 1
- 206010008118 cerebral infarction Diseases 0.000 description 1
- 208000026106 cerebrovascular disease Diseases 0.000 description 1
- GPUADMRJQVPIAS-QCVDVZFFSA-M cerivastatin sodium Chemical compound [Na+].COCC1=C(C(C)C)N=C(C(C)C)C(\C=C\[C@@H](O)C[C@@H](O)CC([O-])=O)=C1C1=CC=C(F)C=C1 GPUADMRJQVPIAS-QCVDVZFFSA-M 0.000 description 1
- GVEZIHKRYBHEFX-NQQPLRFYSA-N cerulenin Chemical compound C\C=C\C\C=C\CCC(=O)[C@H]1O[C@H]1C(N)=O GVEZIHKRYBHEFX-NQQPLRFYSA-N 0.000 description 1
- 229950005984 cerulenin Drugs 0.000 description 1
- MVCQKIKWYUURMU-UHFFFAOYSA-N cetilistat Chemical compound C1=C(C)C=C2C(=O)OC(OCCCCCCCCCCCCCCCC)=NC2=C1 MVCQKIKWYUURMU-UHFFFAOYSA-N 0.000 description 1
- 229950002397 cetilistat Drugs 0.000 description 1
- CFBUZOUXXHZCFB-OYOVHJISSA-N chembl511115 Chemical compound COC1=CC=C([C@@]2(CC[C@H](CC2)C(O)=O)C#N)C=C1OC1CCCC1 CFBUZOUXXHZCFB-OYOVHJISSA-N 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960001761 chlorpropamide Drugs 0.000 description 1
- 229960001523 chlortalidone Drugs 0.000 description 1
- 230000001906 cholesterol absorption Effects 0.000 description 1
- 239000003354 cholesterol ester transfer protein inhibitor Substances 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- 229910052804 chromium Inorganic materials 0.000 description 1
- 239000011651 chromium Substances 0.000 description 1
- 231100000762 chronic effect Toxicity 0.000 description 1
- YZFWTZACSRHJQD-UHFFFAOYSA-N ciglitazone Chemical compound C=1C=C(CC2C(NC(=O)S2)=O)C=CC=1OCC1(C)CCCCC1 YZFWTZACSRHJQD-UHFFFAOYSA-N 0.000 description 1
- 229950009226 ciglitazone Drugs 0.000 description 1
- 229960005025 cilazapril Drugs 0.000 description 1
- HHHKFGXWKKUNCY-FHWLQOOXSA-N cilazapril Chemical compound C([C@@H](C(=O)OCC)N[C@@H]1C(N2[C@@H](CCCN2CCC1)C(O)=O)=O)CC1=CC=CC=C1 HHHKFGXWKKUNCY-FHWLQOOXSA-N 0.000 description 1
- 230000001886 ciliary effect Effects 0.000 description 1
- 229960003020 cilnidipine Drugs 0.000 description 1
- 229950001653 cilomilast Drugs 0.000 description 1
- 229950002934 cilostamide Drugs 0.000 description 1
- 229960002174 ciprofibrate Drugs 0.000 description 1
- KPSRODZRAIWAKH-UHFFFAOYSA-N ciprofibrate Chemical compound C1=CC(OC(C)(C)C(O)=O)=CC=C1C1C(Cl)(Cl)C1 KPSRODZRAIWAKH-UHFFFAOYSA-N 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- PHKYGBHARUTZOY-KTVVNDHVSA-N ckd-711 Chemical compound O([C@H]1O[C@H](CO)[C@H]([C@@H]([C@H]1O)O)O[C@H]1O[C@@H]([C@H]([C@H](O)[C@H]1O)N[C@@H]1[C@@H]([C@@H](O)[C@H](O)[C@]2(CO)O[C@@H]21)O)CO)[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O PHKYGBHARUTZOY-KTVVNDHVSA-N 0.000 description 1
- 229940090805 clavulanate Drugs 0.000 description 1
- HZZVJAQRINQKSD-PBFISZAISA-N clavulanic acid Chemical compound OC(=O)[C@H]1C(=C/CO)/O[C@@H]2CC(=O)N21 HZZVJAQRINQKSD-PBFISZAISA-N 0.000 description 1
- 229960003597 clevidipine Drugs 0.000 description 1
- KPBZROQVTHLCDU-GOSISDBHSA-N clevidipine Chemical compound CCCC(=O)OCOC(=O)C1=C(C)NC(C)=C(C(=O)OC)[C@H]1C1=CC=CC(Cl)=C1Cl KPBZROQVTHLCDU-GOSISDBHSA-N 0.000 description 1
- UCAIEVHKDLMIFL-UHFFFAOYSA-N clobenpropit Chemical compound C1=CC(Cl)=CC=C1CNC(=N)SCCCC1=CNC=N1 UCAIEVHKDLMIFL-UHFFFAOYSA-N 0.000 description 1
- 229960001214 clofibrate Drugs 0.000 description 1
- 229950006376 clomoxir Drugs 0.000 description 1
- 229960002896 clonidine Drugs 0.000 description 1
- 239000005515 coenzyme Substances 0.000 description 1
- 230000019771 cognition Effects 0.000 description 1
- 208000010877 cognitive disease Diseases 0.000 description 1
- 229960001152 colesevelam Drugs 0.000 description 1
- 229940097479 colestid Drugs 0.000 description 1
- GMRWGQCZJGVHKL-UHFFFAOYSA-N colestipol Chemical compound ClCC1CO1.NCCNCCNCCNCCN GMRWGQCZJGVHKL-UHFFFAOYSA-N 0.000 description 1
- 229960002604 colestipol Drugs 0.000 description 1
- 229960002424 collagenase Drugs 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000011284 combination treatment Methods 0.000 description 1
- 229940127113 compound 57 Drugs 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 230000001517 counterregulatory effect Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- MDZKJHQSJHYOHJ-UHFFFAOYSA-N crataegolic acid Natural products C1C(O)C(O)C(C)(C)C2CCC3(C)C4(C)CCC5(C(O)=O)CCC(C)(C)CC5C4=CCC3C21C MDZKJHQSJHYOHJ-UHFFFAOYSA-N 0.000 description 1
- SLQAVEDMASVHTL-VXGBXAGGSA-N cyclohexylmethyl n-[(1r,2r)-2-(1h-imidazol-5-yl)cyclopropyl]carbamate Chemical compound C1([C@@H]2C[C@H]2NC(=O)OCC2CCCCC2)=CN=CN1 SLQAVEDMASVHTL-VXGBXAGGSA-N 0.000 description 1
- QQKNSPHAFATFNQ-UHFFFAOYSA-N darglitazone Chemical compound CC=1OC(C=2C=CC=CC=2)=NC=1CCC(=O)C(C=C1)=CC=C1CC1SC(=O)NC1=O QQKNSPHAFATFNQ-UHFFFAOYSA-N 0.000 description 1
- 229950006689 darglitazone Drugs 0.000 description 1
- 230000009615 deamination Effects 0.000 description 1
- 238000006481 deamination reaction Methods 0.000 description 1
- 206010061428 decreased appetite Diseases 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 229960005227 delapril Drugs 0.000 description 1
- WOUOLAUOZXOLJQ-MBSDFSHPSA-N delapril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N(CC(O)=O)C1CC2=CC=CC=C2C1)CC1=CC=CC=C1 WOUOLAUOZXOLJQ-MBSDFSHPSA-N 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- BADQRNHAZHSOKC-UHFFFAOYSA-N deriglidole Chemical compound C1C(C2=3)=CC=CC=3CCN2C1(CCC)C1=NCCN1 BADQRNHAZHSOKC-UHFFFAOYSA-N 0.000 description 1
- 229950011527 deriglidole Drugs 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 229960004597 dexfenfluramine Drugs 0.000 description 1
- 125000004985 dialkyl amino alkyl group Chemical group 0.000 description 1
- 125000004663 dialkyl amino group Chemical group 0.000 description 1
- ACYGYJFTZSAZKR-UHFFFAOYSA-J dicalcium;2-[2-[bis(carboxylatomethyl)amino]ethyl-(carboxylatomethyl)amino]acetate Chemical compound [Ca+2].[Ca+2].[O-]C(=O)CN(CC([O-])=O)CCN(CC([O-])=O)CC([O-])=O ACYGYJFTZSAZKR-UHFFFAOYSA-J 0.000 description 1
- GJQPMPFPNINLKP-UHFFFAOYSA-N diclofenamide Chemical compound NS(=O)(=O)C1=CC(Cl)=C(Cl)C(S(N)(=O)=O)=C1 GJQPMPFPNINLKP-UHFFFAOYSA-N 0.000 description 1
- 229960005081 diclofenamide Drugs 0.000 description 1
- LZXQXHKDCNQUOF-UHFFFAOYSA-N diethyl (2-oxochromen-7-yl) phosphate Chemical compound C1=CC(=O)OC2=CC(OP(=O)(OCC)OCC)=CC=C21 LZXQXHKDCNQUOF-UHFFFAOYSA-N 0.000 description 1
- FPUQGCOBYOXAED-UHFFFAOYSA-N diethyl 2-[[2-[3-(dimethylcarbamoyl)-4-[[2-[4-(trifluoromethyl)phenyl]benzoyl]amino]phenyl]acetyl]oxymethyl]-2-phenylpropanedioate Chemical compound C=1C=CC=CC=1C(C(=O)OCC)(C(=O)OCC)COC(=O)CC(C=C1C(=O)N(C)C)=CC=C1NC(=O)C1=CC=CC=C1C1=CC=C(C(F)(F)F)C=C1 FPUQGCOBYOXAED-UHFFFAOYSA-N 0.000 description 1
- HPNMFZURTQLUMO-UHFFFAOYSA-N diethylamine Chemical compound CCNCC HPNMFZURTQLUMO-UHFFFAOYSA-N 0.000 description 1
- 230000001079 digestive effect Effects 0.000 description 1
- 208000010643 digestive system disease Diseases 0.000 description 1
- PZXJOHSZQAEJFE-UHFFFAOYSA-N dihydrobetulinic acid Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C)CCC5(C(O)=O)CCC(C(C)C)C5C4CCC3C21C PZXJOHSZQAEJFE-UHFFFAOYSA-N 0.000 description 1
- HSUGRBWQSSZJOP-RTWAWAEBSA-N diltiazem Chemical compound C1=CC(OC)=CC=C1[C@H]1[C@@H](OC(C)=O)C(=O)N(CCN(C)C)C2=CC=CC=C2S1 HSUGRBWQSSZJOP-RTWAWAEBSA-N 0.000 description 1
- 229960004166 diltiazem Drugs 0.000 description 1
- SPCNPOWOBZQWJK-UHFFFAOYSA-N dimethoxy-(2-propan-2-ylsulfanylethylsulfanyl)-sulfanylidene-$l^{5}-phosphane Chemical compound COP(=S)(OC)SCCSC(C)C SPCNPOWOBZQWJK-UHFFFAOYSA-N 0.000 description 1
- 229940090124 dipeptidyl peptidase 4 (dpp-4) inhibitors for blood glucose lowering Drugs 0.000 description 1
- 239000001177 diphosphate Substances 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- FUZBPOHHSBDTJQ-CFOQQKEYSA-L disodium;5-[(2r)-2-[[(2r)-2-(3-chlorophenyl)-2-hydroxyethyl]amino]propyl]-1,3-benzodioxole-2,2-dicarboxylate Chemical compound [Na+].[Na+].C1([C@@H](O)CN[C@@H](CC=2C=C3OC(OC3=CC=2)(C([O-])=O)C([O-])=O)C)=CC=CC(Cl)=C1 FUZBPOHHSBDTJQ-CFOQQKEYSA-L 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000002934 diuretic Substances 0.000 description 1
- 229940030606 diuretics Drugs 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-M dodecanoate Chemical compound CCCCCCCCCCCC([O-])=O POULHZVOKOAJMA-UHFFFAOYSA-M 0.000 description 1
- 229940052760 dopamine agonists Drugs 0.000 description 1
- 239000003136 dopamine receptor stimulating agent Substances 0.000 description 1
- 239000000221 dopamine uptake inhibitor Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229960001389 doxazosin Drugs 0.000 description 1
- RUZYUOTYCVRMRZ-UHFFFAOYSA-N doxazosin Chemical compound C1OC2=CC=CC=C2OC1C(=O)N(CC1)CCN1C1=NC(N)=C(C=C(C(OC)=C2)OC)C2=N1 RUZYUOTYCVRMRZ-UHFFFAOYSA-N 0.000 description 1
- IQQBRKLVEALROM-UHFFFAOYSA-N drinabant Chemical compound C=1C(F)=CC(F)=CC=1N(S(=O)(=O)C)C(C1)CN1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 IQQBRKLVEALROM-UHFFFAOYSA-N 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- UNBMQQNYLCPCHS-VYNDPHDASA-N ebelactone b Chemical compound CC[C@@H](C)[C@@H](O)[C@H](C)C(=O)[C@H](C)\C=C(/C)C[C@H](C)[C@@H]1OC(=O)[C@H]1CC UNBMQQNYLCPCHS-VYNDPHDASA-N 0.000 description 1
- ODUOJXZPIYUATO-LJQANCHMSA-N ecadotril Chemical compound C([C@H](CSC(=O)C)C(=O)NCC(=O)OCC=1C=CC=CC=1)C1=CC=CC=C1 ODUOJXZPIYUATO-LJQANCHMSA-N 0.000 description 1
- 229950001184 ecadotril Drugs 0.000 description 1
- 229940009662 edetate Drugs 0.000 description 1
- 229950005925 eflucimibe Drugs 0.000 description 1
- 229950003102 efonidipine Drugs 0.000 description 1
- XFLQIRAKKLNXRQ-UUWRZZSWSA-N elobixibat Chemical compound C12=CC(SC)=C(OCC(=O)N[C@@H](C(=O)NCC(O)=O)C=3C=CC=CC=3)C=C2S(=O)(=O)CC(CCCC)(CCCC)CN1C1=CC=CC=C1 XFLQIRAKKLNXRQ-UUWRZZSWSA-N 0.000 description 1
- 229950005627 embonate Drugs 0.000 description 1
- 229950000269 emiglitate Drugs 0.000 description 1
- 229960000873 enalapril Drugs 0.000 description 1
- GBXSMTUPTTWBMN-XIRDDKMYSA-N enalapril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(O)=O)CC1=CC=CC=C1 GBXSMTUPTTWBMN-XIRDDKMYSA-N 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 230000002357 endometrial effect Effects 0.000 description 1
- ZUBDGKVDJUIMQQ-UBFCDGJISA-N endothelin-1 Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(O)=O)NC(=O)[C@H]1NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@@H](CC=2C=CC(O)=CC=2)NC(=O)[C@H](C(C)C)NC(=O)[C@H]2CSSC[C@@H](C(N[C@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N2)=O)NC(=O)[C@@H](CO)NC(=O)[C@H](N)CSSC1)C1=CNC=N1 ZUBDGKVDJUIMQQ-UBFCDGJISA-N 0.000 description 1
- 230000037149 energy metabolism Effects 0.000 description 1
- 229950002375 englitazone Drugs 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 239000002792 enkephalinase inhibitor Substances 0.000 description 1
- 229960004563 eprosartan Drugs 0.000 description 1
- OROAFUQRIXKEMV-LDADJPATSA-N eprosartan Chemical compound C=1C=C(C(O)=O)C=CC=1CN1C(CCCC)=NC=C1\C=C(C(O)=O)/CC1=CC=CS1 OROAFUQRIXKEMV-LDADJPATSA-N 0.000 description 1
- PSZDOEIIIJFCFE-OSQDELBUSA-N erythrodiol Chemical compound C1C[C@H](O)C(C)(C)[C@@H]2CC[C@@]3(C)[C@]4(C)CC[C@@]5(CO)CCC(C)(C)C[C@H]5C4=CC[C@@H]3[C@]21C PSZDOEIIIJFCFE-OSQDELBUSA-N 0.000 description 1
- HTZRWCSRPTWJCT-UHFFFAOYSA-N erythrodiol Natural products CC1(C)CCC2(CO)CCC3C(CCC4C3(C)CCC5C(C)(C)C(O)CCC45C)C2C1 HTZRWCSRPTWJCT-UHFFFAOYSA-N 0.000 description 1
- 229960003745 esmolol Drugs 0.000 description 1
- AQNDDEOPVVGCPG-UHFFFAOYSA-N esmolol Chemical compound COC(=O)CCC1=CC=C(OCC(O)CNC(C)C)C=C1 AQNDDEOPVVGCPG-UHFFFAOYSA-N 0.000 description 1
- 229950000206 estolate Drugs 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- AVOLMBLBETYQHX-UHFFFAOYSA-N etacrynic acid Chemical compound CCC(=C)C(=O)C1=CC=C(OCC(O)=O)C(Cl)=C1Cl AVOLMBLBETYQHX-UHFFFAOYSA-N 0.000 description 1
- 229960003199 etacrynic acid Drugs 0.000 description 1
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 1
- NWWORXYTJRPSMC-QKPAOTATSA-N ethyl 4-[2-[(2r,3r,4r,5s)-3,4,5-trihydroxy-2-(hydroxymethyl)piperidin-1-yl]ethoxy]benzoate Chemical compound C1=CC(C(=O)OCC)=CC=C1OCCN1[C@H](CO)[C@@H](O)[C@H](O)[C@@H](O)C1 NWWORXYTJRPSMC-QKPAOTATSA-N 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 229960003501 etofibrate Drugs 0.000 description 1
- XXRVYAFBUDSLJX-UHFFFAOYSA-N etofibrate Chemical compound C=1C=CN=CC=1C(=O)OCCOC(=O)C(C)(C)OC1=CC=C(Cl)C=C1 XXRVYAFBUDSLJX-UHFFFAOYSA-N 0.000 description 1
- 229950006213 etomoxir Drugs 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000010228 ex vivo assay Methods 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- ZZCHHVUQYRMYLW-HKBQPEDESA-N farglitazar Chemical compound N([C@@H](CC1=CC=C(C=C1)OCCC=1N=C(OC=1C)C=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1C(=O)C1=CC=CC=C1 ZZCHHVUQYRMYLW-HKBQPEDESA-N 0.000 description 1
- 229950003707 farglitazar Drugs 0.000 description 1
- 235000013861 fat-free Nutrition 0.000 description 1
- 208000010706 fatty liver disease Diseases 0.000 description 1
- 229960003580 felodipine Drugs 0.000 description 1
- 229960001582 fenfluramine Drugs 0.000 description 1
- 229960002297 fenofibrate Drugs 0.000 description 1
- 229940125753 fibrate Drugs 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 206010016766 flatulence Diseases 0.000 description 1
- XSOUHEXVEOQRKJ-IUCAKERBSA-N fluparoxan Chemical compound O1[C@H]2CNC[C@@H]2OC2=C1C=CC=C2F XSOUHEXVEOQRKJ-IUCAKERBSA-N 0.000 description 1
- 229950006702 fluparoxan Drugs 0.000 description 1
- 229960003765 fluvastatin Drugs 0.000 description 1
- CJOFXWAVKWHTFT-XSFVSMFZSA-N fluvoxamine Chemical compound COCCCC\C(=N/OCCN)C1=CC=C(C(F)(F)F)C=C1 CJOFXWAVKWHTFT-XSFVSMFZSA-N 0.000 description 1
- 229960004038 fluvoxamine Drugs 0.000 description 1
- 210000000497 foam cell Anatomy 0.000 description 1
- 229960002490 fosinopril Drugs 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 229960003883 furosemide Drugs 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 208000020694 gallbladder disease Diseases 0.000 description 1
- 229960000457 gallopamil Drugs 0.000 description 1
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical group NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 1
- 208000021302 gastroesophageal reflux disease Diseases 0.000 description 1
- 208000018685 gastrointestinal system disease Diseases 0.000 description 1
- 229950004781 gemcabene Drugs 0.000 description 1
- 229960003627 gemfibrozil Drugs 0.000 description 1
- 229960000346 gliclazide Drugs 0.000 description 1
- 229960004346 glimepiride Drugs 0.000 description 1
- WIGIZIANZCJQQY-RUCARUNLSA-N glimepiride Chemical compound O=C1C(CC)=C(C)CN1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)N[C@@H]2CC[C@@H](C)CC2)C=C1 WIGIZIANZCJQQY-RUCARUNLSA-N 0.000 description 1
- 229960001381 glipizide Drugs 0.000 description 1
- ZJJXGWJIGJFDTL-UHFFFAOYSA-N glipizide Chemical compound C1=NC(C)=CN=C1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)NC2CCCCC2)C=C1 ZJJXGWJIGJFDTL-UHFFFAOYSA-N 0.000 description 1
- 229960003468 gliquidone Drugs 0.000 description 1
- NSJYMFYVNWVGON-UHFFFAOYSA-N glisentide Chemical compound COC1=CC=CC=C1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)NC2CCCC2)C=C1 NSJYMFYVNWVGON-UHFFFAOYSA-N 0.000 description 1
- 229950008402 glisentide Drugs 0.000 description 1
- GZKDXUIWCNCNBJ-UHFFFAOYSA-N glisolamide Chemical compound O1C(C)=CC(C(=O)NCCC=2C=CC(=CC=2)S(=O)(=O)NC(=O)NC2CCCCC2)=N1 GZKDXUIWCNCNBJ-UHFFFAOYSA-N 0.000 description 1
- 229950005319 glisolamide Drugs 0.000 description 1
- 229960001731 gluceptate Drugs 0.000 description 1
- 239000003850 glucocorticoid receptor antagonist Substances 0.000 description 1
- KWMLJOLKUYYJFJ-VFUOTHLCSA-N glucoheptonic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(O)=O KWMLJOLKUYYJFJ-VFUOTHLCSA-N 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 229960002442 glucosamine Drugs 0.000 description 1
- 230000010030 glucose lowering effect Effects 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 229940049906 glutamate Drugs 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- 101150090422 gsk-3 gene Proteins 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 229910052736 halogen Inorganic materials 0.000 description 1
- 150000002367 halogens Chemical class 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-M hexadecanoate Chemical compound CCCCCCCCCCCCCCCC([O-])=O IPCSVZSSVZVIGE-UHFFFAOYSA-M 0.000 description 1
- 108010070965 hexarelin Proteins 0.000 description 1
- 239000003395 histamine H3 receptor antagonist Substances 0.000 description 1
- 235000017277 hoodia Nutrition 0.000 description 1
- WNRQPCUGRUFHED-DETKDSODSA-N humalog Chemical compound C([C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(O)=O)C1=CC=C(O)C=C1.C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CN=CN1 WNRQPCUGRUFHED-DETKDSODSA-N 0.000 description 1
- 102000049953 human LEP Human genes 0.000 description 1
- 235000003642 hunger Nutrition 0.000 description 1
- 229960002474 hydralazine Drugs 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- DMDGGSIALPNSEE-UHFFFAOYSA-N hydroflumethiazide Chemical compound C1=C(C(F)(F)F)C(S(=O)(=O)N)=CC2=C1NCNS2(=O)=O DMDGGSIALPNSEE-UHFFFAOYSA-N 0.000 description 1
- 229960003313 hydroflumethiazide Drugs 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-M hydrogensulfate Chemical compound OS([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-M 0.000 description 1
- 239000002471 hydroxymethylglutaryl coenzyme A reductase inhibitor Substances 0.000 description 1
- 230000002267 hypothalamic effect Effects 0.000 description 1
- HPMRFMKYPGXPEP-UHFFFAOYSA-N idazoxan Chemical compound N1CCN=C1C1OC2=CC=CC=C2OC1 HPMRFMKYPGXPEP-UHFFFAOYSA-N 0.000 description 1
- 229950001476 idazoxan Drugs 0.000 description 1
- 238000005417 image-selected in vivo spectroscopy Methods 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 229960001195 imidapril Drugs 0.000 description 1
- KLZWOWYOHUKJIG-BPUTZDHNSA-N imidapril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1C(N(C)C[C@H]1C(O)=O)=O)CC1=CC=CC=C1 KLZWOWYOHUKJIG-BPUTZDHNSA-N 0.000 description 1
- BCGWQEUPMDMJNV-UHFFFAOYSA-N imipramine Chemical compound C1CC2=CC=CC=C2N(CCCN(C)C)C2=CC=CC=C21 BCGWQEUPMDMJNV-UHFFFAOYSA-N 0.000 description 1
- 229960004801 imipramine Drugs 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 229950005809 implitapide Drugs 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000010874 in vitro model Methods 0.000 description 1
- NDDAHWYSQHTHNT-UHFFFAOYSA-N indapamide Chemical compound CC1CC2=CC=CC=C2N1NC(=O)C1=CC=C(Cl)C(S(N)(=O)=O)=C1 NDDAHWYSQHTHNT-UHFFFAOYSA-N 0.000 description 1
- 229960004569 indapamide Drugs 0.000 description 1
- 229950008838 indenolol Drugs 0.000 description 1
- MPGBPFMOOXKQRX-UHFFFAOYSA-N indenolol Chemical compound CC(C)NCC(O)COC1=CC=CC2=C1C=CC2 MPGBPFMOOXKQRX-UHFFFAOYSA-N 0.000 description 1
- 229960002056 indoramin Drugs 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 239000013546 insoluble monolayer Substances 0.000 description 1
- 229960003948 insulin detemir Drugs 0.000 description 1
- 229960002869 insulin glargine Drugs 0.000 description 1
- 229960002068 insulin lispro Drugs 0.000 description 1
- 238000012739 integrated shape imaging system Methods 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 210000004347 intestinal mucosa Anatomy 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 239000003456 ion exchange resin Substances 0.000 description 1
- 229920003303 ion-exchange polymer Polymers 0.000 description 1
- 229960002198 irbesartan Drugs 0.000 description 1
- YCPOHTHPUREGFM-UHFFFAOYSA-N irbesartan Chemical compound O=C1N(CC=2C=CC(=CC=2)C=2C(=CC=CC=2)C=2[N]N=NN=2)C(CCCC)=NC21CCCC2 YCPOHTHPUREGFM-UHFFFAOYSA-N 0.000 description 1
- 208000002551 irritable bowel syndrome Diseases 0.000 description 1
- 229950011269 isaglidole Drugs 0.000 description 1
- 208000028867 ischemia Diseases 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 1
- 229960004427 isradipine Drugs 0.000 description 1
- 210000004731 jugular vein Anatomy 0.000 description 1
- 229960003299 ketamine Drugs 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 229960004340 lacidipine Drugs 0.000 description 1
- GKQPCPXONLDCMU-CCEZHUSRSA-N lacidipine Chemical compound CCOC(=O)C1=C(C)NC(C)=C(C(=O)OCC)C1C1=CC=CC=C1\C=C\C(=O)OC(C)(C)C GKQPCPXONLDCMU-CCEZHUSRSA-N 0.000 description 1
- 229940099584 lactobionate Drugs 0.000 description 1
- JYTUSYBCFIZPBE-AMTLMPIISA-N lactobionic acid Chemical compound OC(=O)[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O JYTUSYBCFIZPBE-AMTLMPIISA-N 0.000 description 1
- 229940070765 laurate Drugs 0.000 description 1
- 239000010410 layer Substances 0.000 description 1
- 229950001530 lemildipine Drugs 0.000 description 1
- 229960004294 lercanidipine Drugs 0.000 description 1
- ZDXUKAKRHYTAKV-UHFFFAOYSA-N lercanidipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OC(C)(C)CN(C)CCC(C=2C=CC=CC=2)C=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 ZDXUKAKRHYTAKV-UHFFFAOYSA-N 0.000 description 1
- UGOZVNFCFYTPAZ-IOXYNQHNSA-N levemir Chemical compound CCCCCCCCCCCCCC(=O)NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]([C@@H](C)O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H]1NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=2C=CC(O)=CC=2)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=2N=CNC=2)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=2N=CNC=2)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=2C=CC=CC=2)C(C)C)CSSC[C@@H]2NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)C(C)C)CSSC[C@H](NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC2=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H](CSSC1)C(=O)N[C@@H](CC(N)=O)C(O)=O)CC1=CC=C(O)C=C1 UGOZVNFCFYTPAZ-IOXYNQHNSA-N 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 229950004872 linogliride Drugs 0.000 description 1
- 230000037356 lipid metabolism Effects 0.000 description 1
- OQMAKWGYQLJJIA-CUOOPAIESA-N lipstatin Chemical compound CCCCCC[C@H]1[C@H](C[C@H](C\C=C/C\C=C/CCCCC)OC(=O)[C@H](CC(C)C)NC=O)OC1=O OQMAKWGYQLJJIA-CUOOPAIESA-N 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000004973 liquid crystal related substance Substances 0.000 description 1
- 229960002701 liraglutide Drugs 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 108010004367 lixisenatide Proteins 0.000 description 1
- 229960001093 lixisenatide Drugs 0.000 description 1
- KSMAGQUYOIHWFS-UHFFFAOYSA-N lofexidine Chemical compound N=1CCNC=1C(C)OC1=C(Cl)C=CC=C1Cl KSMAGQUYOIHWFS-UHFFFAOYSA-N 0.000 description 1
- 229960005209 lofexidine Drugs 0.000 description 1
- 239000002171 loop diuretic Substances 0.000 description 1
- 229940063720 lopid Drugs 0.000 description 1
- 229960004844 lovastatin Drugs 0.000 description 1
- PCZOHLXUXFIOCF-BXMDZJJMSA-N lovastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)[C@@H](C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 PCZOHLXUXFIOCF-BXMDZJJMSA-N 0.000 description 1
- QLJODMDSTUBWDW-UHFFFAOYSA-N lovastatin hydroxy acid Natural products C1=CC(C)C(CCC(O)CC(O)CC(O)=O)C2C(OC(=O)C(C)CC)CC(C)C=C21 QLJODMDSTUBWDW-UHFFFAOYSA-N 0.000 description 1
- 229940049920 malate Drugs 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N malic acid Chemical compound OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- IWYDHOAUDWTVEP-UHFFFAOYSA-M mandelate Chemical compound [O-]C(=O)C(O)C1=CC=CC=C1 IWYDHOAUDWTVEP-UHFFFAOYSA-M 0.000 description 1
- 229960003963 manidipine Drugs 0.000 description 1
- ANEBWFXPVPTEET-UHFFFAOYSA-N manidipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OCCN2CCN(CC2)C(C=2C=CC=CC=2)C=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 ANEBWFXPVPTEET-UHFFFAOYSA-N 0.000 description 1
- MDZKJHQSJHYOHJ-LLICELPBSA-N maslinic acid Chemical compound C1[C@@H](O)[C@H](O)C(C)(C)[C@@H]2CC[C@@]3(C)[C@]4(C)CC[C@@]5(C(O)=O)CCC(C)(C)C[C@H]5C4=CC[C@@H]3[C@]21C MDZKJHQSJHYOHJ-LLICELPBSA-N 0.000 description 1
- 235000012054 meals Nutrition 0.000 description 1
- 229950004994 meglitinide Drugs 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- IVAQJHSXBVHUQT-ZVHZXABRSA-N methyl (e)-3-(3,5-dimethoxyphenyl)-2-[4-[4-[(2,4-dioxo-1,3-thiazolidin-5-yl)methyl]phenoxy]phenyl]prop-2-enoate Chemical compound C=1C=C(OC=2C=CC(CC3C(NC(=O)S3)=O)=CC=2)C=CC=1/C(C(=O)OC)=C\C1=CC(OC)=CC(OC)=C1 IVAQJHSXBVHUQT-ZVHZXABRSA-N 0.000 description 1
- LPDGLMPJFGGZGN-XEJVECFOSA-N methyl 2-[4-[2-[[(2r)-2-(3-chlorophenyl)-2-hydroxyethyl]amino]propyl]phenoxy]acetate;hydrobromide Chemical compound Br.C1=CC(OCC(=O)OC)=CC=C1CC(C)NC[C@H](O)C1=CC=CC(Cl)=C1 LPDGLMPJFGGZGN-XEJVECFOSA-N 0.000 description 1
- VKQFCGNPDRICFG-UHFFFAOYSA-N methyl 2-methylpropyl 2,6-dimethyl-4-(2-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OCC(C)C)C1C1=CC=CC=C1[N+]([O-])=O VKQFCGNPDRICFG-UHFFFAOYSA-N 0.000 description 1
- 229940102396 methyl bromide Drugs 0.000 description 1
- LRMHVVPPGGOAJQ-UHFFFAOYSA-N methyl nitrate Chemical compound CO[N+]([O-])=O LRMHVVPPGGOAJQ-UHFFFAOYSA-N 0.000 description 1
- JZMJDSHXVKJFKW-UHFFFAOYSA-M methyl sulfate(1-) Chemical compound COS([O-])(=O)=O JZMJDSHXVKJFKW-UHFFFAOYSA-M 0.000 description 1
- MGJXBDMLVWIYOQ-UHFFFAOYSA-N methylazanide Chemical group [NH-]C MGJXBDMLVWIYOQ-UHFFFAOYSA-N 0.000 description 1
- AJLFOPYRIVGYMJ-INTXDZFKSA-N mevastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=CCC[C@@H]([C@H]12)OC(=O)[C@@H](C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 AJLFOPYRIVGYMJ-INTXDZFKSA-N 0.000 description 1
- 229950009116 mevastatin Drugs 0.000 description 1
- BOZILQFLQYBIIY-UHFFFAOYSA-N mevastatin hydroxy acid Natural products C1=CC(C)C(CCC(O)CC(O)CC(O)=O)C2C(OC(=O)C(C)CC)CCC=C21 BOZILQFLQYBIIY-UHFFFAOYSA-N 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 230000003228 microsomal effect Effects 0.000 description 1
- 229950001332 midaglizole Drugs 0.000 description 1
- 229960001110 miglitol Drugs 0.000 description 1
- PZRHRDRVRGEVNW-UHFFFAOYSA-N milrinone Chemical compound N1C(=O)C(C#N)=CC(C=2C=CN=CC=2)=C1C PZRHRDRVRGEVNW-UHFFFAOYSA-N 0.000 description 1
- 229960003574 milrinone Drugs 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 229960003632 minoxidil Drugs 0.000 description 1
- 108091060283 mipomersen Proteins 0.000 description 1
- 229960003365 mitiglinide Drugs 0.000 description 1
- WPGGHFDDFPHPOB-BBWFWOEESA-N mitiglinide Chemical compound C([C@@H](CC(=O)N1C[C@@H]2CCCC[C@@H]2C1)C(=O)O)C1=CC=CC=C1 WPGGHFDDFPHPOB-BBWFWOEESA-N 0.000 description 1
- 229960005170 moexipril Drugs 0.000 description 1
- 230000000407 monoamine reuptake Effects 0.000 description 1
- 210000002200 mouth mucosa Anatomy 0.000 description 1
- 229960003938 moxonidine Drugs 0.000 description 1
- GACQNVJDWUAPFY-UHFFFAOYSA-N n'-[2-[2-(2-aminoethylamino)ethylamino]ethyl]ethane-1,2-diamine;hydrochloride Chemical compound Cl.NCCNCCNCCNCCN GACQNVJDWUAPFY-UHFFFAOYSA-N 0.000 description 1
- CVABPTLRAQIZJU-UHFFFAOYSA-N n'-[3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl]-n-(oxan-4-yl)ethane-1,2-diamine Chemical compound ClC1=CC(OC)=CC(Cl)=C1C1=C2N=C(C)C=C(NCCNC3CCOCC3)N2N=C1C CVABPTLRAQIZJU-UHFFFAOYSA-N 0.000 description 1
- ATKZKAYWARYLBW-UHFFFAOYSA-N n-(3,5-dichloro-2-methoxyphenyl)-4-methoxy-3-piperazin-1-ylbenzenesulfonamide Chemical compound COC1=CC=C(S(=O)(=O)NC=2C(=C(Cl)C=C(Cl)C=2)OC)C=C1N1CCNCC1 ATKZKAYWARYLBW-UHFFFAOYSA-N 0.000 description 1
- ZLVARELBORDLAV-UHFFFAOYSA-N n-(4,5-dihydro-1h-imidazol-2-yl)-4-fluoro-1,3-dihydroisoindol-2-amine Chemical compound C1C=2C(F)=CC=CC=2CN1NC1=NCCN1 ZLVARELBORDLAV-UHFFFAOYSA-N 0.000 description 1
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 1
- QCTHLCFVVACBSA-JVNHZCFISA-N n-[(2s,3r,4r,5s,6r)-4,5-dihydroxy-6-(hydroxymethyl)-2-(4-methyl-2-oxochromen-7-yl)oxyoxan-3-yl]acetamide Chemical compound CC(=O)N[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC=C(C(C)=CC(=O)O2)C2=C1 QCTHLCFVVACBSA-JVNHZCFISA-N 0.000 description 1
- VGXVGVLUSMHCIK-OXJNMPFZSA-N n-[(2s,3s)-4-(4-chlorophenyl)-3-phenylbutan-2-yl]-2-methyl-2-[4-(trifluoromethyl)pyrimidin-2-yl]oxypropanamide Chemical compound N([C@@H](C)[C@@H](CC=1C=CC(Cl)=CC=1)C=1C=CC=CC=1)C(=O)C(C)(C)OC1=NC=CC(C(F)(F)F)=N1 VGXVGVLUSMHCIK-OXJNMPFZSA-N 0.000 description 1
- RMYZIRFUCOMQRH-UHFFFAOYSA-N n-[1-(2-fluorophenyl)pyrazol-3-yl]-1'-oxospiro[cyclohexane-4,3'-furo[3,4-c]pyridine]-1-carboxamide Chemical compound FC1=CC=CC=C1N1N=C(NC(=O)C2CCC3(CC2)C2=CN=CC=C2C(=O)O3)C=C1 RMYZIRFUCOMQRH-UHFFFAOYSA-N 0.000 description 1
- WDPFJWLDPVQCAJ-UHFFFAOYSA-N n-[2-(diethylamino)ethyl]-2-[2-[(4-fluorophenyl)methylsulfanyl]-4-oxo-6,7-dihydro-5h-cyclopenta[d]pyrimidin-1-yl]-n-[[4-[4-(trifluoromethyl)phenyl]phenyl]methyl]acetamide Chemical compound C1=2CCCC=2C(=O)N=C(SCC=2C=CC(F)=CC=2)N1CC(=O)N(CCN(CC)CC)CC(C=C1)=CC=C1C1=CC=C(C(F)(F)F)C=C1 WDPFJWLDPVQCAJ-UHFFFAOYSA-N 0.000 description 1
- QLYKJCMUNUWAGO-UHFFFAOYSA-N n-[4-(4-chlorophenyl)-3-(3-cyanophenyl)butan-2-yl]-2-methyl-2-[5-(trifluoromethyl)pyridin-2-yl]oxypropanamide Chemical compound C=1C=C(Cl)C=CC=1CC(C=1C=C(C=CC=1)C#N)C(C)NC(=O)C(C)(C)OC1=CC=C(C(F)(F)F)C=N1 QLYKJCMUNUWAGO-UHFFFAOYSA-N 0.000 description 1
- UYTUXABSUBMTPQ-UHFFFAOYSA-N n-[4-(4-chlorophenyl)-3-(5-chloropyridin-3-yl)butan-2-yl]-2-methyl-2-[5-(trifluoromethyl)pyridin-2-yl]oxypropanamide Chemical compound C=1C=C(Cl)C=CC=1CC(C=1C=C(Cl)C=NC=1)C(C)NC(=O)C(C)(C)OC1=CC=C(C(F)(F)F)C=N1 UYTUXABSUBMTPQ-UHFFFAOYSA-N 0.000 description 1
- ZJGVTBCFAZUUBP-UHFFFAOYSA-N n-[5-(3-fluorophenyl)pyrimidin-2-yl]-3-oxospiro[2-benzofuran-1,4'-piperidine]-1'-carboxamide Chemical compound FC1=CC=CC(C=2C=NC(NC(=O)N3CCC4(CC3)C3=CC=CC=C3C(=O)O4)=NC=2)=C1 ZJGVTBCFAZUUBP-UHFFFAOYSA-N 0.000 description 1
- XWLVOJZVWRCRMD-OFNKIYASSA-N n-[5-[(1r)-2-[[(1r)-1-[4-(difluoromethoxy)phenyl]-2-phenylethyl]amino]-1-hydroxyethyl]-2-hydroxyphenyl]methanesulfonamide Chemical compound C1=C(O)C(NS(=O)(=O)C)=CC([C@@H](O)CN[C@H](CC=2C=CC=CC=2)C=2C=CC(OC(F)F)=CC=2)=C1 XWLVOJZVWRCRMD-OFNKIYASSA-N 0.000 description 1
- TUYWTLTWNJOZNY-UHFFFAOYSA-N n-[6-(2-hydroxyethoxy)-5-(2-methoxyphenoxy)-2-[2-(2h-tetrazol-5-yl)pyridin-4-yl]pyrimidin-4-yl]-5-propan-2-ylpyridine-2-sulfonamide Chemical compound COC1=CC=CC=C1OC(C(=NC(=N1)C=2C=C(N=CC=2)C2=NNN=N2)OCCO)=C1NS(=O)(=O)C1=CC=C(C(C)C)C=N1 TUYWTLTWNJOZNY-UHFFFAOYSA-N 0.000 description 1
- GXAQELJVODWLDD-UHFFFAOYSA-N n-[6-[(dimethylamino)methyl]-5,6,7,8-tetrahydronaphthalen-2-yl]-4-(4-fluorophenyl)benzamide Chemical compound C=1C=C2CC(CN(C)C)CCC2=CC=1NC(=O)C(C=C1)=CC=C1C1=CC=C(F)C=C1 GXAQELJVODWLDD-UHFFFAOYSA-N 0.000 description 1
- DIQDKUNCSVFGHH-UHFFFAOYSA-N n-[[4-[[(4-aminoquinazolin-2-yl)amino]methyl]cyclohexyl]methyl]naphthalene-1-sulfonamide;hydrochloride Chemical compound Cl.C1=CC=C2C(N)=NC(NCC3CCC(CNS(=O)(=O)C=4C5=CC=CC=C5C=CC=4)CC3)=NC2=C1 DIQDKUNCSVFGHH-UHFFFAOYSA-N 0.000 description 1
- 229960004255 nadolol Drugs 0.000 description 1
- VWPOSFSPZNDTMJ-UCWKZMIHSA-N nadolol Chemical compound C1[C@@H](O)[C@@H](O)CC2=C1C=CC=C2OCC(O)CNC(C)(C)C VWPOSFSPZNDTMJ-UCWKZMIHSA-N 0.000 description 1
- 229950005705 naftopidil Drugs 0.000 description 1
- 229960005297 nalmefene Drugs 0.000 description 1
- UZHSEJADLWPNLE-GRGSLBFTSA-N naloxone Chemical compound O=C([C@@H]1O2)CC[C@@]3(O)[C@H]4CC5=CC=C(O)C2=C5[C@@]13CCN4CC=C UZHSEJADLWPNLE-GRGSLBFTSA-N 0.000 description 1
- 229960004127 naloxone Drugs 0.000 description 1
- 239000003887 narcotic antagonist Substances 0.000 description 1
- 229950003494 naveglitazar Drugs 0.000 description 1
- 229960000619 nebivolol Drugs 0.000 description 1
- 239000006199 nebulizer Substances 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- MQYXUWHLBZFQQO-UHFFFAOYSA-N nepehinol Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C)CCC5(C)CCC(C(=C)C)C5C4CCC3C21C MQYXUWHLBZFQQO-UHFFFAOYSA-N 0.000 description 1
- NCXBPZJQQSNIRA-UHFFFAOYSA-N ness-0327 Chemical compound ClC1=CC(Cl)=CC=C1N1C(C2=CC=C(Cl)C=C2CCC2)=C2C(C(=O)NN2CCCCC2)=N1 NCXBPZJQQSNIRA-UHFFFAOYSA-N 0.000 description 1
- 229950001628 netoglitazone Drugs 0.000 description 1
- 230000008555 neuronal activation Effects 0.000 description 1
- 239000003900 neurotrophic factor Substances 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229960001783 nicardipine Drugs 0.000 description 1
- 229960004738 nicotinyl alcohol Drugs 0.000 description 1
- HYIMSNHJOBLJNT-UHFFFAOYSA-N nifedipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OC)C1C1=CC=CC=C1[N+]([O-])=O HYIMSNHJOBLJNT-UHFFFAOYSA-N 0.000 description 1
- 229960001597 nifedipine Drugs 0.000 description 1
- 229960005366 nilvadipine Drugs 0.000 description 1
- 229950000754 nipradilol Drugs 0.000 description 1
- 229960000227 nisoldipine Drugs 0.000 description 1
- 229960005425 nitrendipine Drugs 0.000 description 1
- XXPANQJNYNUNES-UHFFFAOYSA-N nomifensine Chemical compound C12=CC=CC(N)=C2CN(C)CC1C1=CC=CC=C1 XXPANQJNYNUNES-UHFFFAOYSA-N 0.000 description 1
- 229960001073 nomifensine Drugs 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 229960002748 norepinephrine Drugs 0.000 description 1
- SFLSHLFXELFNJZ-UHFFFAOYSA-N norepinephrine Natural products NCC(O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-UHFFFAOYSA-N 0.000 description 1
- 235000015816 nutrient absorption Nutrition 0.000 description 1
- 230000035764 nutrition Effects 0.000 description 1
- 208000001797 obstructive sleep apnea Diseases 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 229940049964 oleate Drugs 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 108060005714 orexin Proteins 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- UNAZAADNBYXMIV-UHFFFAOYSA-N otenabant Chemical compound C1CC(NCC)(C(N)=O)CCN1C1=NC=NC2=C1N=C(C=1C(=CC=CC=1)Cl)N2C1=CC=C(Cl)C=C1 UNAZAADNBYXMIV-UHFFFAOYSA-N 0.000 description 1
- 235000020830 overeating Nutrition 0.000 description 1
- 229940039748 oxalate Drugs 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 125000003854 p-chlorophenyl group Chemical group [H]C1=C([H])C(*)=C([H])C([H])=C1Cl 0.000 description 1
- 229950003510 pactimibe Drugs 0.000 description 1
- 235000019629 palatability Nutrition 0.000 description 1
- 210000000277 pancreatic duct Anatomy 0.000 description 1
- 229940014662 pantothenate Drugs 0.000 description 1
- 235000019161 pantothenic acid Nutrition 0.000 description 1
- 239000011713 pantothenic acid Substances 0.000 description 1
- 229960002296 paroxetine Drugs 0.000 description 1
- 239000004031 partial agonist Substances 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 108700027320 pegylated leptin Proteins 0.000 description 1
- 229950000811 peliglitazar Drugs 0.000 description 1
- 229960002035 penbutolol Drugs 0.000 description 1
- KQXKVJAGOJTNJS-HNNXBMFYSA-N penbutolol Chemical compound CC(C)(C)NC[C@H](O)COC1=CC=CC=C1C1CCCC1 KQXKVJAGOJTNJS-HNNXBMFYSA-N 0.000 description 1
- 229960001476 pentoxifylline Drugs 0.000 description 1
- 239000000863 peptide conjugate Substances 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 229960002582 perindopril Drugs 0.000 description 1
- IPVQLZZIHOAWMC-QXKUPLGCSA-N perindopril Chemical compound C1CCC[C@H]2C[C@@H](C(O)=O)N(C(=O)[C@H](C)N[C@@H](CCC)C(=O)OCC)[C@H]21 IPVQLZZIHOAWMC-QXKUPLGCSA-N 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 238000011422 pharmacological therapy Methods 0.000 description 1
- 229960003243 phenformin Drugs 0.000 description 1
- ICFJFFQQTFMIBG-UHFFFAOYSA-N phenformin Chemical compound NC(=N)NC(=N)NCCC1=CC=CC=C1 ICFJFFQQTFMIBG-UHFFFAOYSA-N 0.000 description 1
- 229960003562 phentermine Drugs 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- PWXJULSLLONQHY-UHFFFAOYSA-N phenylcarbamic acid Chemical class OC(=O)NC1=CC=CC=C1 PWXJULSLLONQHY-UHFFFAOYSA-N 0.000 description 1
- UYWQUFXKFGHYNT-UHFFFAOYSA-N phenylmethyl ester of formic acid Natural products O=COCC1=CC=CC=C1 UYWQUFXKFGHYNT-UHFFFAOYSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 229930029653 phosphoenolpyruvate Natural products 0.000 description 1
- DTBNBXWJWCWCIK-UHFFFAOYSA-N phosphoenolpyruvic acid Chemical compound OC(=O)C(=C)OP(O)(O)=O DTBNBXWJWCWCIK-UHFFFAOYSA-N 0.000 description 1
- 239000003358 phospholipase A2 inhibitor Substances 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 229960002508 pindolol Drugs 0.000 description 1
- PHUTUTUABXHXLW-UHFFFAOYSA-N pindolol Chemical compound CC(C)NCC(O)COC1=CC=CC2=NC=C[C]12 PHUTUTUABXHXLW-UHFFFAOYSA-N 0.000 description 1
- HYAFETHFCAUJAY-UHFFFAOYSA-N pioglitazone Chemical compound N1=CC(CC)=CC=C1CCOC(C=C1)=CC=C1CC1C(=O)NC(=O)S1 HYAFETHFCAUJAY-UHFFFAOYSA-N 0.000 description 1
- 229940096701 plain lipid modifying drug hmg coa reductase inhibitors Drugs 0.000 description 1
- 230000036470 plasma concentration Effects 0.000 description 1
- 239000000106 platelet aggregation inhibitor Substances 0.000 description 1
- 229920000768 polyamine Polymers 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 229940097241 potassium-sparing diuretic Drugs 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- TZIRZGBAFTZREM-MKAGXXMWSA-N pramlintide Chemical compound C([C@@H](C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H]1NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)CSSC1)[C@@H](C)O)C(C)C)C1=CC=CC=C1 TZIRZGBAFTZREM-MKAGXXMWSA-N 0.000 description 1
- 229960003611 pramlintide Drugs 0.000 description 1
- 229950004891 pranidipine Drugs 0.000 description 1
- 229950005649 pratosartan Drugs 0.000 description 1
- KCTFTBCZZUBAKN-UHFFFAOYSA-N pratosartan Chemical compound CCCC1=NC=2CCCCC(=O)C=2N1CC(C=C1)=CC=C1C1=CC=CC=C1C1=NN=NN1 KCTFTBCZZUBAKN-UHFFFAOYSA-N 0.000 description 1
- 229960002965 pravastatin Drugs 0.000 description 1
- TUZYXOIXSAXUGO-PZAWKZKUSA-N pravastatin Chemical compound C1=C[C@H](C)[C@H](CC[C@@H](O)C[C@@H](O)CC(O)=O)[C@H]2[C@@H](OC(=O)[C@@H](C)CC)C[C@H](O)C=C21 TUZYXOIXSAXUGO-PZAWKZKUSA-N 0.000 description 1
- 229960001289 prazosin Drugs 0.000 description 1
- IENZQIKPVFGBNW-UHFFFAOYSA-N prazosin Chemical compound N=1C(N)=C2C=C(OC)C(OC)=CC2=NC=1N(CC1)CCN1C(=O)C1=CC=CO1 IENZQIKPVFGBNW-UHFFFAOYSA-N 0.000 description 1
- 201000009104 prediabetes syndrome Diseases 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 238000002953 preparative HPLC Methods 0.000 description 1
- GCYXWQUSHADNBF-AAEALURTSA-N preproglucagon 78-108 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 GCYXWQUSHADNBF-AAEALURTSA-N 0.000 description 1
- 150000003141 primary amines Chemical class 0.000 description 1
- FYPMFJGVHOHGLL-UHFFFAOYSA-N probucol Chemical compound C=1C(C(C)(C)C)=C(O)C(C(C)(C)C)=CC=1SC(C)(C)SC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 FYPMFJGVHOHGLL-UHFFFAOYSA-N 0.000 description 1
- 229960003912 probucol Drugs 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- AZGZXUZMWKHDDH-UHFFFAOYSA-N propan-2-yl n-[3-chloro-5-[1-[[6-[2-(5-ethyl-4-methyl-1,3-thiazol-2-yl)ethyl]-4-morpholin-4-ylpyridin-2-yl]amino]ethyl]phenyl]carbamate Chemical compound CC1=C(CC)SC(CCC=2N=C(NC(C)C=3C=C(NC(=O)OC(C)C)C=C(Cl)C=3)C=C(C=2)N2CCOCC2)=N1 AZGZXUZMWKHDDH-UHFFFAOYSA-N 0.000 description 1
- AQHHHDLHHXJYJD-UHFFFAOYSA-N propranolol Chemical compound C1=CC=C2C(OCC(O)CNC(C)C)=CC=CC2=C1 AQHHHDLHHXJYJD-UHFFFAOYSA-N 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- UBQKCCHYAOITMY-UHFFFAOYSA-N pyridin-2-ol Chemical compound OC1=CC=CC=N1 UBQKCCHYAOITMY-UHFFFAOYSA-N 0.000 description 1
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 229940073095 questran Drugs 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 229960001455 quinapril Drugs 0.000 description 1
- JSDRRTOADPPCHY-HSQYWUDLSA-N quinapril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](CC2=CC=CC=C2C1)C(O)=O)CC1=CC=CC=C1 JSDRRTOADPPCHY-HSQYWUDLSA-N 0.000 description 1
- FLSLEGPOVLMJMN-YSSFQJQWSA-N quinaprilat Chemical compound C([C@H](N[C@@H](C)C(=O)N1[C@@H](CC2=CC=CC=C2C1)C(O)=O)C(O)=O)CC1=CC=CC=C1 FLSLEGPOVLMJMN-YSSFQJQWSA-N 0.000 description 1
- 229960001007 quinaprilat Drugs 0.000 description 1
- 108700040249 racecadotril Proteins 0.000 description 1
- 229960003401 ramipril Drugs 0.000 description 1
- HDACQVRGBOVJII-JBDAPHQKSA-N ramipril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](C[C@@H]2CCC[C@@H]21)C(O)=O)CC1=CC=CC=C1 HDACQVRGBOVJII-JBDAPHQKSA-N 0.000 description 1
- 230000009103 reabsorption Effects 0.000 description 1
- 238000001525 receptor binding assay Methods 0.000 description 1
- 238000012292 receptor occupancy assay Methods 0.000 description 1
- 108700037321 recombinant methionyl human leptin Proteins 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 231100000272 reduced body weight Toxicity 0.000 description 1
- 229950005713 reglitazar Drugs 0.000 description 1
- 230000036454 renin-angiotensin system Effects 0.000 description 1
- 229960002354 repaglinide Drugs 0.000 description 1
- 230000001850 reproductive effect Effects 0.000 description 1
- 208000023504 respiratory system disease Diseases 0.000 description 1
- 230000003979 response to food Effects 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 150000004492 retinoid derivatives Chemical class 0.000 description 1
- 229940116238 revex Drugs 0.000 description 1
- 230000033764 rhythmic process Effects 0.000 description 1
- 229960000764 rilmenidine Drugs 0.000 description 1
- XMSXOLDPMGMWTH-UHFFFAOYSA-N rivoglitazone Chemical compound CN1C2=CC(OC)=CC=C2N=C1COC(C=C1)=CC=C1CC1SC(=O)NC1=O XMSXOLDPMGMWTH-UHFFFAOYSA-N 0.000 description 1
- 229950010764 rivoglitazone Drugs 0.000 description 1
- HJORMJIFDVBMOB-UHFFFAOYSA-N rolipram Chemical compound COC1=CC=C(C2CC(=O)NC2)C=C1OC1CCCC1 HJORMJIFDVBMOB-UHFFFAOYSA-N 0.000 description 1
- 229950005741 rolipram Drugs 0.000 description 1
- SUFUKZSWUHZXAV-BTJKTKAUSA-N rosiglitazone maleate Chemical compound [H+].[H+].[O-]C(=O)\C=C/C([O-])=O.C=1C=CC=NC=1N(C)CCOC(C=C1)=CC=C1CC1SC(=O)NC1=O SUFUKZSWUHZXAV-BTJKTKAUSA-N 0.000 description 1
- 229960001860 salicylate Drugs 0.000 description 1
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 description 1
- 229950001780 sampatrilat Drugs 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- QGJUIPDUBHWZPV-SGTAVMJGSA-N saxagliptin Chemical compound C1C(C2)CC(C3)CC2(O)CC13[C@H](N)C(=O)N1[C@H](C#N)C[C@@H]2C[C@@H]21 QGJUIPDUBHWZPV-SGTAVMJGSA-N 0.000 description 1
- 229960004937 saxagliptin Drugs 0.000 description 1
- 108010033693 saxagliptin Proteins 0.000 description 1
- 150000003335 secondary amines Chemical class 0.000 description 1
- 230000001235 sensitizing effect Effects 0.000 description 1
- UQDJGEHQDNVPGU-UHFFFAOYSA-N serine phosphoethanolamine Chemical compound [NH3+]CCOP([O-])(=O)OCC([NH3+])C([O-])=O UQDJGEHQDNVPGU-UHFFFAOYSA-N 0.000 description 1
- 230000000697 serotonin reuptake Effects 0.000 description 1
- 239000003772 serotonin uptake inhibitor Substances 0.000 description 1
- VGKDLMBJGBXTGI-SJCJKPOMSA-N sertraline Chemical compound C1([C@@H]2CC[C@@H](C3=CC=CC=C32)NC)=CC=C(Cl)C(Cl)=C1 VGKDLMBJGBXTGI-SJCJKPOMSA-N 0.000 description 1
- 229960002073 sertraline Drugs 0.000 description 1
- 230000001568 sexual effect Effects 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 229960003310 sildenafil Drugs 0.000 description 1
- KZJWDPNRJALLNS-VJSFXXLFSA-N sitosterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CC[C@@H](CC)C(C)C)[C@@]1(C)CC2 KZJWDPNRJALLNS-VJSFXXLFSA-N 0.000 description 1
- 229950005143 sitosterol Drugs 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 159000000000 sodium salts Chemical class 0.000 description 1
- 229960002370 sotalol Drugs 0.000 description 1
- ZBMZVLHSJCTVON-UHFFFAOYSA-N sotalol Chemical compound CC(C)NCC(O)C1=CC=C(NS(C)(=O)=O)C=C1 ZBMZVLHSJCTVON-UHFFFAOYSA-N 0.000 description 1
- 229960002909 spirapril Drugs 0.000 description 1
- HRWCVUIFMSZDJS-SZMVWBNQSA-N spirapril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](CC2(C1)SCCS2)C(O)=O)CC1=CC=CC=C1 HRWCVUIFMSZDJS-SZMVWBNQSA-N 0.000 description 1
- 108700035424 spirapril Proteins 0.000 description 1
- LXMSZDCAJNLERA-ZHYRCANASA-N spironolactone Chemical compound C([C@@H]1[C@]2(C)CC[C@@H]3[C@@]4(C)CCC(=O)C=C4C[C@H]([C@@H]13)SC(=O)C)C[C@@]21CCC(=O)O1 LXMSZDCAJNLERA-ZHYRCANASA-N 0.000 description 1
- 229960002256 spironolactone Drugs 0.000 description 1
- 239000004059 squalene synthase inhibitor Substances 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 229940114926 stearate Drugs 0.000 description 1
- 231100000240 steatosis hepatitis Toxicity 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 235000003702 sterols Nutrition 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 208000023516 stroke disease Diseases 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 125000005017 substituted alkenyl group Chemical group 0.000 description 1
- 125000000547 substituted alkyl group Chemical group 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 125000002653 sulfanylmethyl group Chemical group [H]SC([H])([H])[*] 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 229940099093 symlin Drugs 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 229950002139 talsupram Drugs 0.000 description 1
- 229950005022 taranabant Drugs 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 229960000651 tasosartan Drugs 0.000 description 1
- ADXGNEYLLLSOAR-UHFFFAOYSA-N tasosartan Chemical compound C12=NC(C)=NC(C)=C2CCC(=O)N1CC(C=C1)=CC=C1C1=CC=CC=C1C=1N=NNN=1 ADXGNEYLLLSOAR-UHFFFAOYSA-N 0.000 description 1
- WRGVLTAWMNZWGT-VQSPYGJZSA-N taspoglutide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NC(C)(C)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)C(C)(C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 WRGVLTAWMNZWGT-VQSPYGJZSA-N 0.000 description 1
- 229950007151 taspoglutide Drugs 0.000 description 1
- 229960005187 telmisartan Drugs 0.000 description 1
- 229950001790 tendamistat Drugs 0.000 description 1
- 108010037401 tendamistate Proteins 0.000 description 1
- 229950002757 teoclate Drugs 0.000 description 1
- 229960001693 terazosin Drugs 0.000 description 1
- VCKUSRYTPJJLNI-UHFFFAOYSA-N terazosin Chemical compound N=1C(N)=C2C=C(OC)C(OC)=CC2=NC=1N(CC1)CCN1C(=O)C1CCCO1 VCKUSRYTPJJLNI-UHFFFAOYSA-N 0.000 description 1
- 229960003352 tertatolol Drugs 0.000 description 1
- 150000003512 tertiary amines Chemical class 0.000 description 1
- 229950004704 tesaglitazar Drugs 0.000 description 1
- 229950000584 tezosentan Drugs 0.000 description 1
- 229960004559 theobromine Drugs 0.000 description 1
- 229960000278 theophylline Drugs 0.000 description 1
- 239000003451 thiazide diuretic agent Substances 0.000 description 1
- 150000001467 thiazolidinediones Chemical class 0.000 description 1
- 125000000101 thioether group Chemical group 0.000 description 1
- 239000005495 thyroid hormone Substances 0.000 description 1
- 229940036555 thyroid hormone Drugs 0.000 description 1
- CVWILQHZFWRYPB-UHFFFAOYSA-N tiamenidine Chemical compound CC1=CSC(Cl)=C1NC1=NCCN1 CVWILQHZFWRYPB-UHFFFAOYSA-N 0.000 description 1
- 229950000164 tiamenidine Drugs 0.000 description 1
- 229950008411 tilisolol Drugs 0.000 description 1
- TWVUMMQUXMYOOH-UHFFFAOYSA-N tilisolol Chemical compound C1=CC=C2C(=O)N(C)C=C(OCC(O)CNC(C)(C)C)C2=C1 TWVUMMQUXMYOOH-UHFFFAOYSA-N 0.000 description 1
- 238000002877 time resolved fluorescence resonance energy transfer Methods 0.000 description 1
- 229960004605 timolol Drugs 0.000 description 1
- 229950004437 tiqueside Drugs 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- ODKDMMTXTVCCLJ-BVSLBCMMSA-N tmc-2-a Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N3[C@@H](CC4=CC(O)=C(C(=C4C3)O)OC)C(=O)N[C@@H](CC(CO)CO)C(O)=O)=CNC2=C1 ODKDMMTXTVCCLJ-BVSLBCMMSA-N 0.000 description 1
- 229960002277 tolazamide Drugs 0.000 description 1
- OUDSBRTVNLOZBN-UHFFFAOYSA-N tolazamide Chemical compound C1=CC(C)=CC=C1S(=O)(=O)NC(=O)NN1CCCCCC1 OUDSBRTVNLOZBN-UHFFFAOYSA-N 0.000 description 1
- 229960005371 tolbutamide Drugs 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229960005461 torasemide Drugs 0.000 description 1
- CMSGWTNRGKRWGS-NQIIRXRSSA-N torcetrapib Chemical compound COC(=O)N([C@H]1C[C@@H](CC)N(C2=CC=C(C=C21)C(F)(F)F)C(=O)OCC)CC1=CC(C(F)(F)F)=CC(C(F)(F)F)=C1 CMSGWTNRGKRWGS-NQIIRXRSSA-N 0.000 description 1
- 229950004514 torcetrapib Drugs 0.000 description 1
- 229960002051 trandolapril Drugs 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 239000003558 transferase inhibitor Substances 0.000 description 1
- 201000010875 transient cerebral ischemia Diseases 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 230000008733 trauma Effects 0.000 description 1
- 229950002223 trecadrine Drugs 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 1
- 229960001288 triamterene Drugs 0.000 description 1
- 229940055755 tricor Drugs 0.000 description 1
- 229960002906 trimazosin Drugs 0.000 description 1
- YNZXWQJZEDLQEG-UHFFFAOYSA-N trimazosin Chemical compound N1=C2C(OC)=C(OC)C(OC)=CC2=C(N)N=C1N1CCN(C(=O)OCC(C)(C)O)CC1 YNZXWQJZEDLQEG-UHFFFAOYSA-N 0.000 description 1
- YFTHZRPMJXBUME-UHFFFAOYSA-N tripropylamine Chemical compound CCCN(CCC)CCC YFTHZRPMJXBUME-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- GXPHKUHSUJUWKP-UHFFFAOYSA-N troglitazone Chemical compound C1CC=2C(C)=C(O)C(C)=C(C)C=2OC1(C)COC(C=C1)=CC=C1CC1SC(=O)NC1=O GXPHKUHSUJUWKP-UHFFFAOYSA-N 0.000 description 1
- 229960001641 troglitazone Drugs 0.000 description 1
- GXPHKUHSUJUWKP-NTKDMRAZSA-N troglitazone Natural products C([C@@]1(OC=2C(C)=C(C(=C(C)C=2CC1)O)C)C)OC(C=C1)=CC=C1C[C@H]1SC(=O)NC1=O GXPHKUHSUJUWKP-NTKDMRAZSA-N 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- MDYZKJNTKZIUSK-UHFFFAOYSA-N tyloxapol Chemical compound O=C.C1CO1.CC(C)(C)CC(C)(C)C1=CC=C(O)C=C1 MDYZKJNTKZIUSK-UHFFFAOYSA-N 0.000 description 1
- 208000035408 type 1 diabetes mellitus 1 Diseases 0.000 description 1
- 229960001130 urapidil Drugs 0.000 description 1
- 229940096998 ursolic acid Drugs 0.000 description 1
- PLSAJKYPRJGMHO-UHFFFAOYSA-N ursolic acid Natural products CC1CCC2(CCC3(C)C(C=CC4C5(C)CCC(O)C(C)(C)C5CCC34C)C2C1C)C(=O)O PLSAJKYPRJGMHO-UHFFFAOYSA-N 0.000 description 1
- SYFNOXYZEIYOSE-UHFFFAOYSA-N uvaol Natural products CC1CCC2(O)CCC3(C)C(=CCC4(C)C5(C)CCC(O)C(C)(C)C5CCC34C)C2C1C SYFNOXYZEIYOSE-UHFFFAOYSA-N 0.000 description 1
- 229940070710 valerate Drugs 0.000 description 1
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 229960004699 valsartan Drugs 0.000 description 1
- SJSNUMAYCRRIOM-QFIPXVFZSA-N valsartan Chemical compound C1=CC(CN(C(=O)CCCC)[C@@H](C(C)C)C(O)=O)=CC=C1C1=CC=CC=C1C1=NN=N[N]1 SJSNUMAYCRRIOM-QFIPXVFZSA-N 0.000 description 1
- 208000019553 vascular disease Diseases 0.000 description 1
- 210000005166 vasculature Anatomy 0.000 description 1
- 229940124549 vasodilator Drugs 0.000 description 1
- 239000003071 vasodilator agent Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 229960001722 verapamil Drugs 0.000 description 1
- 229960001254 vildagliptin Drugs 0.000 description 1
- 229960001729 voglibose Drugs 0.000 description 1
- 229940111503 welchol Drugs 0.000 description 1
- 229940009065 wellbutrin Drugs 0.000 description 1
- BPICBUSOMSTKRF-UHFFFAOYSA-N xylazine Chemical compound CC1=CC=CC(C)=C1NC1=NCCCS1 BPICBUSOMSTKRF-UHFFFAOYSA-N 0.000 description 1
- 229960001600 xylazine Drugs 0.000 description 1
- REZGGXNDEMKIQB-UHFFFAOYSA-N zaprinast Chemical compound CCCOC1=CC=CC=C1C1=NC(=O)C2=NNNC2=N1 REZGGXNDEMKIQB-UHFFFAOYSA-N 0.000 description 1
- 229950005371 zaprinast Drugs 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 229960002769 zofenopril Drugs 0.000 description 1
- IAIDUHCBNLFXEF-MNEFBYGVSA-N zofenopril Chemical compound C([C@@H](C)C(=O)N1[C@@H](C[C@@H](C1)SC=1C=CC=CC=1)C(O)=O)SC(=O)C1=CC=CC=C1 IAIDUHCBNLFXEF-MNEFBYGVSA-N 0.000 description 1
- 229940061639 zonegran Drugs 0.000 description 1
- 229960002911 zonisamide Drugs 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to peptide analogs of oxyntomodulin (OXM, glucagon-37), which have been modified to be resistant to cleavage and inactivation by dipeptidyl peptidase IV (DPP-IV) and to increase in vivo half-life of the peptide analog while enabling the peptide analog to act as a dual GLP-1/glucagon receptor (GCGR) agonist, and the use of such peptide analogs for treatment of metabolic disorders such as diabetes and obesity.
- OXM oxyntomodulin
- DPP-IV dipeptidyl peptidase IV
- GCGR GLP-1/glucagon receptor
- the hormone oxyntomodulin (OXM, glucagon-37) is a posttranslational product of preproglucagon processing in the intestine and central nervous system (CNS) and is secreted from L-cells in the gut in response to food intake.
- OXM has been implicated in the regulation of food intake and energy expenditure (Jarrouse et al., Endocrinol. 115: 102-105 (1984); Schjoldager et al., Eur. J. Clin. Invest., 18: 499-503 (1988)).
- Central or peripheral administration of OXM in rats causes a decrease in short term food intake with minimal effects on gastric emptying (Dakin et al.
- OXM peripheral administration of OXM dose-dependently inhibited both fast-induced and dark phase food intake, but unlike GLP-1, had no effect on gastric emptying. OXM also reduced levels of fasting ghrelin and increased c-fos immunoreactivity, in the arcuate nucleus (ARC). Repeated seven-day IP administration of OXM caused a reduction in the rate of body weight gain and adiposity in rats (See Dakin et al. Endocrinology, 145: 2687-2695 (2004)).
- OXM is a weak agonist at the GLP-1 receptor, when used in pharmacological concentrations (See Baggio et al., Gastroenterol. 127: 546-58 (2004)).
- OXM was also found to ameliorate glucose intolerance in mice fed a high fat diet (Dakin et al., Am. J. Physiol. Endocrinol, Metab. 294: E142-E147 (2008) and increase the intrinsic heart rate in mice independent of the GLP-1 receptor (Sowden et al., Am. J. Physiol. Regal. Integr. Comp. Physiol. 292: R962-R970 (2007). OXM has also been shown to differentially affect GLP-1 receptor beta-arrestin recruitment and signaling through Galpha (Jorgensen et al., J. Pharma. Exp. Therapeut.
- OXM has a very short half-life and is rapidly inactivated by the cell surface dipeptidyl peptidase IV (DPP-IV) (Zhu et al., J. Biol. Chem. 278: 22418-22423 (2002).
- DPP-IV inhibitors are weight-neutral in the clinic, suggesting that supraphysiological levels of OXM (900-1000 pM) may be required to achieve weight loss in humans.
- OXM peptide analogs for inducing weight loss in humans has been the object of Published International Application Nos. WO03/022304, WO2004/062685, and WO2006/134340.
- OXM therefore shows potential as a treatment for metabolic disorders such as diabetes and obesity.
- OXM analogs that can be safely and efficaciously administered for the treatment of metabolic diseases, such as diabetes and obesity. It would be further desirable if analogs or derivatives were developed that were modified by conjugation to moieties that would improve stability and pharmacokinetics, more particularly modifications that confer resistance to DPP-IV cleavage. It would further be desirable to provide OXM analogs that are capable of acting as dual GLP-1 receptor/glucagon receptor agonists.
- the present invention provides oxyntomodulin (OXM, glucagon-37) peptide analogs, which have been modified to be resistant to cleavage and inactivation by dipeptidyl peptidase IV (DPP-IV) and to increase in vivo half-life of the peptide analog while enabling the peptide analog to act as a dual GLP-1/glucagon receptor (GCGR) agonist, and the use of such peptide analogs for treatment of metabolic disorders such as diabetes and obesity.
- OXM oxyntomodulin
- DPP-IV dipeptidyl peptidase IV
- GCGR GLP-1/glucagon receptor
- the analogs disclosed herein reduce food intake and body weight, increase metabolic rate, mediate glucose-dependent insulin secretion (GDIS) from pancreatic islets and improve glucose tolerance, thereby providing a treatment option for individuals afflicted with a metabolic disorder such as metabolic syndrome, obesity, diabetes, metabolic syndrome X, hyperglycemia, impaired fasting glucose, dyslipidemia, atherosclerosis, and other prediabetic states.
- GDIS glucose-dependent insulin secretion
- the present invention provides a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO:1 wherein the second amino acid from the N-terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide is capable of acting as a dual GLP-1 receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof.
- the amino acid substituted for the second amino acid from the N-terminus is selected from the group consisting of D-s
- a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO:1 wherein the second amino acid from the N-terminus is substituted with an amino acid selected from the group consisting of D-serine and ⁇ -aminoisobutyric acid; the C-terminus of the peptide includes a cysteine residue in which the thiol group of the cysteine residue is covalently linked to a cholesterol moiety by a hydrophilic linker; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP-1 receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof.
- OXM human oxyntomodulin
- a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO:1 wherein the second amino acid from the N-terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 17, 18, and 27; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP-1 receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof.
- OXM human oxyntomodulin
- the one or more amino acid substitutions selected from the group consisting of glutamic acid for the arginine at position 17, alanine for the arginine at position 18, norleucine or O-methyl-L-homoserine for the methionine at position 27.
- a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO:1 wherein the second amino acid from the N-terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; the peptide lacks the amino acid sequence RNRNNIA (SEQ ID NO:104); and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP-1 receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof.
- OXM human oxyntomodulin
- the amino acid substitution at position 2 is an amino acid selected from the group consisting of D-serine and ⁇ -aminoisobutyric acid and the cholesterol moiety is covalently linked to the thiol group of a cysteine by a hydrophilic linker and the cysteine residue is covalently linked to the C-terminus of the peptide by a peptide bond.
- the peptide further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 17, 18, and 27.
- the peptide further includes one or more amino acid substitutions selected from the group consisting of arginine at position 17 to glutamic acid, arginine at position 18 to alanine, methionine at position 27 to norleucine or O-methyl-L-homoserine.
- the peptide includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue at the C-terminus of the peptide.
- the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker.
- the hydrophilic linker can be a peptide or polymer such as an ethoxy polymer that includes one to ten ethoxy units.
- the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
- the peptide includes a lipid moiety covalently linked to the ⁇ -amino group of a lysine residue covalently linked to the C-terminus of the peptide, which in particular embodiments is a palmitoyl.
- the lysine residue is linked to the C-terminus of the peptide by means of a linker moiety.
- the linker moiety includes one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino-4,7,10-tioxa-13-tridecanamine succinimic acid.
- OXM peptide analog selected from the peptide analogs presented in Table 1 and Table 2 and the use of one more of the OXM peptide analogs presented in Table 1 and Table 2 in the manufacture of a medicament for the treatment of a metabolic disorder.
- P is a peptide having the amino acid sequence
- X 1 is a D-serine, ⁇ -aminoisobutyric acid (aib), 1-Amino-1-cyclobutane carboxylic acid (Acb) residue, 1-Amino-1-cyclohexane carboxylic acid (Acx); alpha-aminobutyric acid (Abu); D-alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta-cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (Alg); 2-Amino-2-cyclohexyl-propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1-Amino-1-cyclopropane carboxylic acid (Acp); or 1-Amino-1-cyclopentane carboxylic acid (Acpe); X 2 is Ser (S) or Lys (K
- Z 1 is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L 1 is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO:104) or a linker moiety; Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L 1 -Z 2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- Z 2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety.
- the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker.
- the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
- Z 2 is a lysine residue, which in particular embodiments, the ⁇ -amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker.
- the lipid moiety is a palmitoyl.
- L 1 is a linker moiety.
- the linker moiety is a hydrophilic linker moiety.
- the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino-4,7,10-tioxa-13-tridecanamine succinimic acid.
- the peptide comprises a structure selected from OXM70 (SEQ ID NO:12); OXM110 (SEQ ID NO:19); OXM115 (SEQ ID NO:21); OXM177 (SEQ ID NO:24); OXM212 (SEQ ID NO:27); OXM213 (SEQ ID NO:28); OXM216 (SEQ ID NO:29); OXM290 (SEQ ID NO:46); OXM301 (SEQ ID NO:51); or OXM325 (SEQ ID NO:65).
- the peptide comprises a structure selected from OXM237 (SEQ ID NO:31); OXM238 (SEQ ID NO:32); OXM259 (SEQ ID NO:33); OXM260 (SEQ ID NO:34); OXM261 (SEQ ID NO:35); OXM262 (SEQ ID NO:36); OXM263 (SEQ ID NO:37); OXM264 (SEQ ID NO:38); OXM265 (SEQ ID NO:39); OXM266 (SEQ ID NO:40); OXM267 (SEQ ID NO:41); OXM268 (SEQ ID NO:42); OXM306 (SEQ ID NO:43); OXM307 (SEQ ID NO:44); and OXM308 (SEQ ID NO:45).
- OXM237 SEQ ID NO:31
- OXM238 SEQ ID NO:32
- OXM259 SEQ ID NO:33
- OXM260 SEQ ID NO:
- the peptide comprises a structure selected from OXM291 (SEQ ID NO:47); OXM292 (SEQ ID NO:48); OXM293 (SEQ ID NO:49); OXM294 (SEQ ID NO:50); OXM302 (SEQ ID NO:52); OXM303 (SEQ ID NO:53); OXM304 (SEQ ID NO:54); OXM305 (SEQ ID NO:55); OXM311 (SEQ ID NO:56); OXM312 (SEQ ID NO:57); OXM314 (SEQ ID NO:58); OXM313 (SEQ ID NO:59); OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:
- the peptide when the peptide lacks RNRNNIA (SEQ ID NO:104), the peptide comprises the structure selected from OXM345 (SEQ ID NO:69); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM404
- P is a peptide having the amino acid sequence
- X 1 is a D-serine, ⁇ -aminoisobutyric acid (aib), 1-Amino-1-cyclobutane carboxylic acid (Acb) residue, 1-Amino-1-cyclohexane carboxylic acid (Acx); alpha-aminobutyric acid (Abu); D-alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta-cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (Alg); 2-Amino-2-cyclohexyl-propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1-Amino-1-cyclopropane carboxylic acid (Acp); or 1-Amino-1-cyclopentane carboxylic acid (Acpe); X 2 is Ser (S) or Lys (K
- Z 1 is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L 1 is optional but when present is a linker moiety; Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L 1 -Z 2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- Z 2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety.
- the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker.
- the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
- Z 2 is a lysine residue, which in particular embodiments, the ⁇ -amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker.
- the lipid moiety is a palmitoyl.
- L 1 is a linker moiety.
- the linker moiety is a hydrophilic linker moiety.
- the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino-4,7,10-tioxa-13-tridecanamine succinimic acid.
- the peptide comprises a structure selected from OXM291 (SEQ ID NO:47); OXM292 (SEQ ID NO:48); OXM293 (SEQ ID NO:49); OXM294 (SEQ ID NO:50); OXM302 (SEQ ID NO:52); OXM303 (SEQ ID NO:53); OXM304 (SEQ ID NO:54); OXM305 (SEQ ID NO:55); OXM311 (SEQ ID NO:56); OXM312 (SEQ ID NO:57); OXM314 (SEQ ID NO:58); OXM313 (SEQ ID NO:59); OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:66); or OXM329 (SEQ ID NO:67).
- OXM291 SEQ ID NO:
- the peptide comprises the structure selected from OXM345 (SEQ ID NO:69); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM404 (SEQ ID NO:86); OXM406 (SEQ ID NO:69); OX
- P is a peptide having the amino acid sequence
- X 1 is a D-serine, ⁇ -aminoisobutyric acid (aib), 1-Amino-1-cyclobutane carboxylic acid (Acb) residue, 1-Amino-1-cyclohexane carboxylic acid (Acx); alpha-aminobutyric acid (Abu); D-alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta-cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (Alg); 2-Amino-2-cyclohexyl-propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1-Amino-1-cyclopropane carboxylic acid (Acp); or 1-Amino-1-cyclopentane carboxylic acid (Acpe); X 2 is Ser (S) or Lys (K
- Z 1 is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L 1 is optional but when present is a linker moiety; Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L 1 -Z 2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- Z 2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety.
- the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker.
- the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
- Z 2 is a lysine residue, which in particular embodiments, the ⁇ -amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker.
- the lipid moiety is a palmitoyl.
- L 1 is a linker moiety.
- the linker moiety is a hydrophilic linker moiety.
- the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino-4,7,10-tioxa-13-tridecanamine succinimic acid.
- the peptide comprises a structure selected from OXM290 (SEQ ID NO:46); OXM301 (SEQ ID NO:51); OXM321 (SEQ ID NO:63); OXM325 (SEQ ID NO:65); or OXM330 (SEQ ID NO:68).
- the peptide comprises a structure selected from OXM70 (SEQ ID NO:12); OXM110 (SEQ ID NO:19); OXM115 (SEQ ID NO:21); OXM177 (SEQ ID NO:24); OXM212 (SEQ ID NO:27); OXM213 (SEQ ID NO:28); or OXM216 (SEQ ID NO:29).
- the peptide comprises a structure selected from OXM237 (SEQ ID NO:31); OXM238 (SEQ ID NO:32); OXM259 (SEQ ID NO:33); OXM260 (SEQ ID NO:34); OXM261 (SEQ ID NO:35); OXM262 (SEQ ID NO:36); OXM263 (SEQ ID NO:37); OXM264 (SEQ ID NO:38); OXM265 (SEQ ID NO:39); OXM266 (SEQ ID NO:40); OXM267 (SEQ ID NO:41); OXM268 (SEQ ID NO:42); OXM306 (SEQ ID NO:43); OXM307 (SEQ ID NO:44); and OXM308 (SEQ ID NO:45).
- OXM237 SEQ ID NO:31
- OXM238 SEQ ID NO:32
- OXM259 SEQ ID NO:33
- OXM260 SEQ ID NO:
- peptide analogs that are a dual GLP-1/glucagon receptor (GCGR) agonist and have a pI of less than 6.0.
- Peptide analogs comprising a cholesterol or fatty acid moiety and have a pI of less than 6 have been found to have a reduced capacity for stimulating mast cell degranulation as determined by a in vitro counterscreening assay using the human mast cell line LAD2.
- a peptide analog comprising the amino acid sequence HSQGTFTSDYSKYLDSRRAQDFVQWLMNTK (SEQ ID NO:109) in which the second amino acid from the N-terminus of the peptide is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV;
- the peptide includes a lipid or cholesterol moiety covalently linked to the peptide by a spacer comprising one or more gamma-glutamic acid residues;
- the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide analog has a pI of less than 6.0 and is a dual GLP-1 receptor agonist and glucagon receptor agonist, and pharmaceutically acceptable salts thereof.
- peptide analogs has
- the amino acid substituted for the second amino acid from the N-terminus of the peptide analog is selected from the group consisting of D-serine, ⁇ -aminoisobutyric acid, and 1-amino-1-cyclobutane carboxylic acid.
- the peptide analog includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue that is covalently linked to the 8-amino group of the lysine residue at the C-terminus of the peptide analog by a spacer comprising one or more gamma glutamic acid residues.
- the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker, which in particular embodiments is an ethoxy polymer that includes one to twelve ethoxy units for example, an ethoxy polymer that includes four ethoxy units.
- the peptide analog includes a lipid moiety covalently linked to the ⁇ -amino group of a lysine residue: in particular embodiments the lipid moiety is a fatty acid such as a palmitoyl, myristoyl, or stearoyl moiety. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
- the lipid moiety is covalently linked to the 8-amino group of the lysine residue by one or more gamma-glutamic acid residues and the lysine residue linked to the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
- the peptide analog further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 10, 12, 16, 17, 18, and 27.
- the peptide analog includes one or more amino acid substitutions selected from the group consisting of lysine for the tyrosine at position 10, serine for the lysine at position 12, glutamic acid or ⁇ -aminoisobutyric acid for the serine at position 16, glutamic acid for the arginine at position 17, alanine for the arginine at position 18, lysine for the glutamine at position 20, and norleucine or O-methyl-L-homoserine for the methionine at position 27.
- the tyrosine at position 10 in the peptide analog is replaced with a lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues.
- the glutamine at position 20 in the peptide analog is replaced with lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine by one or more gamma-glutamic acid residues.
- the peptide analog further includes one or more gamma-glutamic acid residues covalently linked to the C-terminus.
- P is a peptide having the amino acid sequence
- X 1 is a D-serine, ⁇ -aminoisobutyric acid (aib), 1-Amino-1-cyclobutane carboxylic acid (Acb) residue, 1-Amino-1-cyclohexane carboxylic acid (Acx); alpha-aminobutyric acid (Abu); D-alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta-cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (Alg); 2-Amino-2-cyclohexyl-propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1-Amino-1-cyclopropane carboxylic acid (Acp); or 1-Amino-1-cyclopentane carboxylic acid (Acpe) residue; X 2 is a tyrosine,
- peptide analogs have a pI between 4 and 6, or a pI of about 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, or 5.9, or a pI of about 5.4 to 5.5.
- M is a cysteine residue covalently linked to a cholesterol moiety with a hydrophilic linker and the cysteine residue is linked to the C-terminus of P.
- the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units, which in particular aspects can include for example, four ethoxy units.
- M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is linked to the C-terminus of P or M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is at position X 2 or X 7 of P.
- the lipid moiety is a palmitoyl, myristoyl, or stearoyl moiety.
- the peptide analog is OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:66); or OXM329 (SEQ ID NO:67).
- the peptide analog is OXM345 (SEQ ID NO:69); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM404 (SEQ ID NO:86); OXM406 (SEQ ID NO:87); OXM345
- a GLP-1 agonist is a peptide, small molecule, or chemical compound that binds to the GLP-1 receptor and stimulates the same biological activity as does GLP-1.
- an agonist for the GLP-1 receptor binds to the receptor with at least 1% of the affinity as native GLP-1.
- an agonist for the GLP-1 receptor binds to the receptor with an equal or greater affinity than native GLP-1.
- a glucagon agonist is a peptide, small molecule, or chemical compound that binds to the glucagon receptor and stimulates the same biological activity as does glucagon.
- an agonist for the glucagon receptor binds to the receptor with at least 1% of the affinity as native glucagon.
- an agonist for the glucagon receptor binds to the receptor with an equal or greater affinity than native glucagon.
- a “dual GLP1/glucagon receptor agonist” is “GLP1 receptor/glucagon receptor co-agonist molecule”, which exhibit activity at both the glucagon receptor and the GLP1 receptor.
- a dual GLP1 receptor agonist and glucagon receptor agonist exhibits activity at the glucagon receptor of at least about 10% relative to native glucagon and also exhibits activity at the GLP-1 receptor of at least about 10% relative to native GLP-1.
- FIG. 1 shows the results of an ex vivo assay comparing glycogenolysis of native OXM to OXM (Q3E),
- the Figure shows that native OXM induces glycogenolysis in a dose dependent fashion and induces full glycogenolysis at 1.5 nM and has an approximate EC 50 of 0.5 nM whereas OXM-Q3E induced only about 58% at 300 nM, consistent with its poor GCGR agonist potency.
- FIG. 2 shows the results of an in vivo GCG Receptor occupancy experiment showing that glucagon (GCG) at 1.5 mpk gave 84% GCGR occupancy and 3 mpk OXM gave 31% GCGR occupancy but that OXM-Q3E gave 0% GCGR occupancy.
- GCG glucagon
- FIGS. 3A and 3B show the blood glucose levels and glucose infusion rates, respectively, in response to OXM and OXM-Q3E.
- FIG. 4 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous (s.c.) administration of OXM and OXM-Q3E.
- IPGTT intraperitoneal glucose tolerance test
- FIG. 5A shows ex vivo measurement of glycogenolysis in perfused liver in the presence of OXM70, OXM110, OXM177, OXM115, and OXM216.
- FIG. 58 shows GGCR occupancy following subcutaneous (s.c.) or intravenous (i.v.) administration of the OXM70, OXM110, OXM177, OXM115, and OXM216 compared to native OXM in a competition assay in wild-type mice.
- FIG. 6 summarizes the acute in vivo efficacy of OXM70 on reducing food intake and body weight in established DIO mice.
- Food intake was measured about two hours and 18 hours later.
- FIG. 7 summarizes the acute in vivo efficacy of OXM110 and OXM177 on reducing food intake and body weight in established DIO mice.
- Food intake was measured about two hours and 18 hours later.
- FIG. 8 summarizes the acute in vivo efficacy of OXM216, OXM115, and OXM177 on reducing food intake and body weight in established DIO mice.
- Food intake was measured about two hours and 18 hours later.
- FIGS. 9A-D shows the pharmacological end points of a chronic body weight and food intake study in DIO mice for OXM peptide analogs OXM110, OXM177, and OXM115.
- FIG. 9A shows the cumulative change in food intake.
- FIG. 9B shows the cumulative change in body weight.
- FIG. 9C shows basal glucose levels over several days of the study.
- FIG. 9D shows IPGTT assay on day 13 of the study.
- FIG. 10 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXM70.
- IPGTT intraperitoneal glucose tolerance test
- FIG. 11 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXM110.
- IPGTT intraperitoneal glucose tolerance test
- FIG. 12 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXM177.
- IPGTT intraperitoneal glucose tolerance test
- FIG. 13 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXM115.
- IPGTT intraperitoneal glucose tolerance test
- FIG. 14A shows the metabolic rate effects of OXM115 in DIO Mice over time.
- FIG. 14B shows the percent change in metabolic rate caused by OXM115 in the DIO Mice.
- FIG. 15 summarizes the acute in vivo efficacy of several +/+ peptides on reducing food intake and body weight in established DIO mice.
- FIG. 16 shows single dose of several +/+ peptides on food intake on reducing food intake and body weight in established DIO mice.
- OXM-based therapy has the potential to favorably impact both obesity and, the as yet to be carefully characterized, concomitant effects on improving diabetes.
- Weight loss efficacy and reduction in food intake upon peripheral administration of OXM has been well validated in humans (Wynne et al., Diabetes 54: 2390-2395 (2005)). More recently, OXM has been shown to increase metabolic rate and specifically activity-related energy expenditure in obese subjects (Wynne et al., Int. J. Obes. 30: 1729-1736 (2006), advance online publication, Apr. 18, 2006; doi:10.1038/sj.ijo.0803344). OXM has also been shown to reduce body weight in humans (See, for example, Published International Application Nos.
- OXM (and GLP-1) has a very short half-life and is rapidly inactivated by the cell surface dipeptidyl peptidase IV (DPP-IV). Mutations can be incorporated into the OXM peptide to render the peptide resistant to DPP-IV cleavage; however, many of these mutations have also been found to inactivate the native peptide or adversely affect the ability of the peptide to interact with the glucagon receptor (GCGR) or GLP-1 receptor (GLP-1R) (See Published International Application No. WO2007/100535, which is incorporated herein in its entirety). OXM (and GLP-1) is also rapidly cleared by the kidneys.
- DPP-IV cell surface dipeptidyl peptidase IV
- the OXM peptide analogs disclosed herein solve these problems.
- the limited in vivo stability of native OXM and GLP-1 due to cleavage by DPP-IV and rapid renal clearance, which necessitates frequent dosing (t.i.d. s.c. injections for OXM, continuous infusion for GLP-1) at high doses in humans has been solved by mutating the site of DPP-IV cleavage (the penultimate residue at the N-terminus) and lipidating the OXM peptide to increase in vivo half-life (t 1/2 ).
- the t 1/2 of the lipidated (such as acylated or conjugated with a cholesterol moiety) OXM peptide analogs in humans will be suitable for at least once daily administration.
- the OXM peptide analogs disclosed herein are more convenient for therapeutic purposes than native OXM, which requires t.i.d. dosing.
- the tolerability profile of polypeptides of the current invention is anticipated to be similar to that of native OXM in humans, which may be superior to that of conventional GLP-1 mimetics like exenatide and liraglutide.
- the chronic efficacy of the OXM analogs disclosed herein may therefore be better than conventional GLP-1 mimetics, such as Byetta® (Amylin Pharmaceuticals), due to minimal nausea and vomiting, which have typically been dose limiting for the GLP-1 mimetics. Unlike the latter, no dose-titrations to mitigate nausea may be required for polypeptides of this invention.
- OXM is potent agonist of the glucagon receptor
- the expectation would be that chronic administration would lead to impaired glucose control (hyperglycemia).
- the OXM analogs disclosed herein which incorporate a balanced GLP-1 receptor and GCGR co-agonism, gives enhanced reductions in food intake and body weight with chronic administration and results in improved glucose tolerance.
- OXM peptide analogs that have dual GLP-1 receptor (GLP-1R) and glucagon receptor (GCGR) agonist activity are indicated herein as (+/+).
- OXM peptide analogs that are GLP-1 agonists only are indicated herein as (+/0).
- OXM analogs disclosed herein can be used for is the treatment of obesity and/or diabetes. Secondary indications are metabolic syndrome, hyperglycemia, impaired fasting glucose, and other prediabetic states. Further indications include all indications for GLP-1 such as irritable bowel syndrome and other absorptive diseases of the gut, ischemia, stroke, and neurological disorders including anxiety, impaired cognition, and Alzheimer's disease.
- OXM analogs disclosed herein are anticipated to exhibit at least comparable if not superior efficacy and a better safety profile than current anti-obesity agents such as orlistat (Xenical® (Roche), a lipase inhibitor) and sibutramine (Meridia® (Abbott Laboratories), a seratonin/norepinephrine re-uptake inhibitor), for which GI intolerance (diarrhea, flatulence) and hypertension are common side effects, respectively.
- orlistat Xenical® (Roche)
- sibutramine Meridia® (Abbott Laboratories)
- GI intolerance diarrhea, flatulence
- the OXM peptide analogs optionally includes a protecting group covalently joined to the N-terminal amino group.
- a protecting group covalently joined to the N-terminal amino group of the peptide reduces the reactivity of the amino terminus under in vivo conditions.
- Amino protecting groups include —C 1-10 alkyl, —C 1-10 substituted alkyl, —C 2-10 alkenyl, —C 2-10 substituted alkenyl, aryl, —C 1-6 alkyl aryl, —C(O)—(CH 2 ) 1-6 —COOH, —C(O)—C 1-6 alkyl, —C(O)-aryl, —C(O)—O—C 1-6 alkyl, or —C(O)—O-aryl.
- the amino terminus protecting group is selected from the group consisting of acetyl, propyl, succinyl, benzyl, benzyloxycarbonyl, and t-butyloxycarbonyl.
- Deamination of the N-terminal amino acid is another modification that is contemplated for reducing the reactivity of the amino terminus under in vivo conditions.
- the OXM peptide analogs may be modified to have a protecting group covalently joined to the C-terminal carboxy group, which reduces the reactivity of the carboxy terminus under in vivo conditions.
- carboxylic acid groups of the peptide may be provided in the form of a salt of a pharmacologically-acceptable cation or esterified to form a C 1-6 ester, or converted to an amide of formula NRR 2 wherein R and R 2 are each independently H or C 1-6 alkyl, or combined to form a heterocyclic ring, such as a 5- or 6-membered ring.
- the carboxy terminus protecting group is preferably attached to the ⁇ -carbonyl group of the last amino acid.
- Carboxy terminus protecting groups include, but are not limited to, amide, methylamide, and ethylamide.
- Amino groups of the peptide, whether N-terminal or side chain, may be in the form of a pharmacologically-acceptable acid addition salt, such as the HCl, HBr, acetic, benzoic, toluene sulfonic, maleic, tartaric, and other organic salts, or may be modified to C 1-6 alkyl or dialkyl amino or further converted to an amide.
- the OXM peptide analogs that are capable of acting as dual GLP-1 and glucagon agonists comprise the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO:1 wherein the second amino acid from the N-terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; a lipid or cholesterol moiety covalently linked to the OXM peptide analog; optionally one to three amino acid substitutions in addition to the substitution at position 2; and optionally has a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide.
- OXM human oxyntomodulin
- the peptide analogs further lack the amino acid sequence RNRNNIA (SEQ ID NO:104).
- OXM peptide analogs having the above structure will act as a dual GLP-1 receptor and glucagon receptor agonist and have a serum half-life greater than the serum half-life of native human OXM.
- the OXM peptide analog can be represented by the structure
- P is a peptide having the amino acid sequence
- X 1 is a D-serine or ⁇ -aminoisobutyric acid (aib) residue
- X 2 is an arginine (R) or glutamic acid (E) residue
- X 3 is an arginine (R) or alanine (A) residue
- X 4 is a methionine (M), norleucine (Nle), or O-methyl-L-homoserine (o) residue
- M methionine
- Nle norleucine
- o O-methyl-L-homoserine
- Z 1 is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L 1 is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO:104) or a linker moiety; Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L 1 -Z 2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- the OXM peptide analog can be represented by the structure
- P is a peptide having the amino acid sequence
- X 1 is a D-serine or ⁇ -aminoisobutyric acid (aib) residue
- X 2 is an arginine (R) or glutamic acid (E) residue
- X 3 is an arginine (R) or alanine (A) residue
- X 4 is a methionine (M), norleucine (Nle), or O-methyl-L-homoserine (o) residue
- M methionine
- Nle norleucine
- o O-methyl-L-homoserine
- Z 1 is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L 1 is optional but when present is a linker moiety; Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L 1 -Z 2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- the OXM peptide analog can be represented by the structure
- P is a peptide having the amino acid sequence
- X 1 is a D-serine, ⁇ -aminoisobutyric acid (aib), 1-Amino-1-cyclobutane carboxylic acid (Acb) residue, 1-Amino-1-cyclohexane carboxylic acid (Acx); alpha-aminobutyric acid (Abu); D-alpha-aminobutyric acid (D-Abu); Aminovaleric acid (Nva); beta-cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (Alg); 2-Amino-2-cyclohexyl-propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1-Amino-1-cyclopropane carboxylic acid (Acp); or 1-Amino-1-cyclopentane carboxylic acid (Acpe); X 2 is an arginine (R)
- Z 1 is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L 1 is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO:104) or a linker moiety; Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L 1 -Z 2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- the OXM peptide analog can be represented by the structure
- P is a peptide having the amino acid sequence
- X 1 is a D-serine, ⁇ -aminoisobutyric acid (aib), 1-Amino-1-cyclobutane carboxylic acid (Acb) residue, 1-Amino-1-cyclohexane carboxylic acid (Acx); alpha-aminobutyric acid (Abu); D-alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta-cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (Alg); 2-Amino-2-cyclohexyl-propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1-Amino-1-cyclopropane carboxylic acid (Acp); or 1-Amino-1-cyclopentane carboxylic acid (Acpe); X 2 is Ser (S) or Lys (K
- Z 1 is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L 1 is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO:104) or a linker moiety;
- Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and
- P or Z 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof L 1 -Z 2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- the OXM peptide analog can be represented by the structure
- P is a peptide having the amino acid sequence
- X 1 is a D-serine, ⁇ -aminoisobutyric acid (aib), 1-Amino-1-cyclobutane carboxylic acid (Acb) residue, 1-Amino-1-cyclohexane carboxylic acid (Acx); alpha-aminobutyric acid (Abu); D-alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta-cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (Alg); 2-Amino-2-cyclohexyl-propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1-Amino-1-cyclopropane carboxylic acid (Acp); or 1-Amino-1-cyclopentane carboxylic acid (Acpe); X 2 is Ser (S) or Lys (K
- Z 1 is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L 1 is optional but when present is a linker moiety; Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L 1 -Z 2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- the OXM peptide analog can be represented by the structure
- P is a peptide having the amino acid sequence
- X 1 is a D-serine, ⁇ -aminoisobutyric acid (aib), 1-Amino-1-cyclobutane carboxylic acid (Acb) residue, 1-Amino-1-cyclohexane carboxylic acid (Acx); alpha-aminobutyric acid (Abu); D-alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta-cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (Alg); 2-Amino-2-cyclohexyl-propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1-Amino-1-cyclopropane carboxylic acid (Acp); or 1-Amino-1-cyclopentane carboxylic acid (Acpe); X 2 is Ser (S) or Lys (K
- Z 1 is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L 1 is optional but when present is a linker moiety; Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L 1 -Z 2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- the OXM peptide analog can be represented by the structure
- P is a peptide having the amino acid sequence
- X 1 is a D-serine, ⁇ -aminoisobutyric acid (aib), 1-Amino-1-cyclobutane carboxylic acid (Acb) residue, 1-Amino-1-cyclohexane carboxylic acid (Acx); alpha-aminobutyric acid (Abu); D-alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta-cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (Alg); 2-Amino-2-cyclohexyl-propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1-Amino-1-cyclopropane carboxylic acid (Acp); or 1-Amino-1-cyclopentane carboxylic acid (Acpe); X 2 is Tyr or Lys; X 3 is
- Z 1 is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L 1 is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO:104) or a linker moiety; Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L 1 -Z 2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- the lipid or cholesterol moiety can be directly or indirectly linked to the side chain of an amino acid.
- the lipid or cholesterol moiety is linked to the amino acid side-chain by means of a linker moiety.
- the lipid or cholesterol is directly linked to the side chain of an amino acid which is then linked to the OXM peptide analog by a linker moiety (L 1 ).
- residues 16 and 20 are Glu and Lys, respectively, the side chains of said residues can participate in a lactam bridge between said Glu and Lys residues.
- the linker moiety is a hydrophilic linker.
- the chemical structure of the linker moiety is not critical, however, since it serves primarily as a spacer. However, in certain embodiments, the linker moiety may itself provide improved properties to the OXM peptide analogs.
- the linker moiety is covalently linked to the C-terminal amino acid of the peptide (P) and Z 2 is covalently linked to the linker moiety.
- the linker moiety is covalently linked to an internal amino acid of P and Z 2 is covalently linked to the linker moiety.
- X 9 can include one or more gamma glutamic acid residues.
- the OXM peptide analogs include diastereomers as well as their racemic and resolved enantiomerically pure forms.
- the amino acids are in the L-form with particular amino acids in D-form.
- Table 1 shows the structures for a representative number of OXM peptide analogs based on the full-length OXM molecule that have activity at both the glucagon receptor and the GLP-1 receptor (+/+).
- OXM peptide analogs OXM29, 208, 209 and 229 are peptide analogs precursors (thiolated peptides) that were used for the conjugation reaction with the bromo-cholesterol moieties.
- OXM peptide analogs OXM36 and OXM115 were prepared from OXM229, which includes the native human OXM peptide but with a D-serine at amino acid position 2 and a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated.
- OXM36 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC 4 —CONH 2 (SEQ ID NO:8) wherein C 4 is a cysteine residue in which cholest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ acetate is covalently linked thereto as shown below.
- OXM115 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC 7 —CONH 2 (SEQ ID NO:21) wherein the C 7 is a cholest-5-en-3-yl 1- ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ -2-oxo-6,9,12,15-tetraoxa-3-azaoctadecan-18-oate (or Cys(Oxa4-cholesterol)) as shown below.
- C 7 differs from C 4 in that it has a hydrophilic spacer formed by four ethylene glycol repeats (ethoxy units) between the cholesterol group and the cysteine moiety.
- the C7 group increases solubility of the resulting peptide-cholesterol conjugate.
- the peptide-C 7 conjugate shows a less prominent serum shift than peptide-C 4 conjugates. This was found to be important for maintaining an optimal balanced activity on the two receptors GLP-1R and Glucagon receptor. The results shown in the Examples illustrate this aspect.
- OXM peptide analogs OXM70 and OXM216 were prepared from OXM29, which includes the native human OXM peptide but with ⁇ -aminoisobutyric acid at amino acid position 2 and with a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated.
- OXM70 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC 4 —CONH 2 (SEQ ID NO:12) wherein C 4 is cholest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ acetate as shown for OXM36.
- OXM216 has the structure H ⁇ QGTETSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC 7 —CONH 2 (SEQ ID NO:29) wherein the C 7 is a cholest-5-en-3-yl 1- ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ -2-oxo-6,9,12,15-tetraoxa-3-azaoctadecan-18-oate (or Cys(Oxa4-cholesterol)) as for OXM115.
- OXM peptide analog OXM212 was prepared from OXM208, which includes the native human OXM peptide but with ⁇ -aminoisobutyric acid at amino acid position 2, norleucine in place of the methionine residue at position 27, with a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated.
- OXM212 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLnNTKRNRNNIAC 4 —CONH 2 (SEQ ID NO:26) wherein C 4 is cholest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ acetate as shown for OXM36.
- OXM peptide analog OXM213 was prepared from OXM209, which includes the native human OXM peptide but with ⁇ -aminoisobutyric acid at amino acid position 2, O-methyl-L-homoserine in place of the methionine residue at position 27, with a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated.
- OXM213 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLYNTKRNRNNIAC 4 —CONH 2 (SEQ ID NO:28) wherein C 4 is cholest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ acetate as shown for OXM36.
- OXM237 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLmNTKRNRNNIAC 7 —CONH 2 (SEQ ID NO:31). It was designed to contain D-Ser (s) at position 2, Met(O) at position 27, and a Cys(Oxa 4 -cholesterol) (C 7 ) at position site 38.
- OXM238 was designed to contain D-Ser (s) at position 2, Met(O) at position 27, and a Cys(acetamide) (C 5 ) at position site 38.
- This peptide has the same peptide sequence of OXM237 and is a control peptide with no cholesterol but with the cysteine thiol blocked with acetamide.
- OXM259-OXM268 and OXM306-308 (as shown in Table 1) have the amino acid sequence of OXM but wherein the amino acid at position 2 has been substituted with a non-natural amino acid to identify amino acid substitutions that confer resistance to DPP4 catalytic activity.
- OXM peptide analogs that lack the amino acid sequence RNRNNIA can also display full agonistic activity on the GLP-1 and the Glucagon receptors.
- These OXM peptide analogs along with some additional peptides based upon the full-sized OXM peptide are shown in Table 2.
- These truncated OXM peptide analogs are variants of the Glucagon K (GcgK) genus of peptides that were disclosed in commonly owned International Published Application No. WO2007100535.
- the GcgK peptides are peptides where the OXM sequence has been truncated at the C terminus to eliminate the seven amino acid residues at the C-terminus.
- the resulting peptide is that one of glucagon with an extra lysine residue at the C-terminus.
- This GcgK peptide is compatible with a +/+ pattern in which the peptides show subnanomolar potency on both the GLP-1R and the GCGR.
- native OXM shows nanomolar potency on the two receptors.
- An additional advantage of the GcgK peptide is that the two basic arginine residues at the C-terminus have been eliminated. This was important in the construction of lipidated (acylated or cholesterylated) peptide analogs having dual GLP-1/GCGR agonist activity.
- lipidated peptide analogs with a pI above 7 based on the OXM sequence stimulate mast cell degranulation while lipidated peptide analogs with a pI of about 5 appear not to stimulate mast degranulation (See Example 11).
- the pI for lipidated based peptide analogs should be around 5. Therefore, in particular aspects the lipidated peptide analogs have a pI less than 6.0. In further aspects, the lipidated peptide analogs have a pI between 4.5 and 6.0. In a further aspect, the lipidated peptide analogs have a pI of about 5.4.
- Reduction of pI was done using one or more of the following three different strategies: 1) substitution of residues in the peptide, 2) introduction of a carboxylate group at the C terminus, and 3) introduction of negative residues such as one or more gamma-carboxy-glutamic acid residues as spacers.
- the acyl or cholesterol group is covalently linked to the peptide by means of a spacer that comprises two gamma-carboxy-glutamic acid residues.
- these peptide analogs include those peptide analogs shown in Table 2.
- peptides with a pI of about 5.4 include but are not limited to OXM345, OXM380, OXM381, OXM392, OXM395, OXM398, OXM399, OXM400, and OXM401.
- the acyl or cholesterol group is covalently linked to an internal amino acid in the peptide analogs by means of a spacer that comprises one or two gamma-carboxy-glutamic acid residues and the peptide further includes one or more gamma-carboxy-glutamic acid residue covalently to the lysine residue at the C-terminus.
- these peptide analogs include but are not limited to OXM407, OXM408, OXM414, and OXM418.
- the acyl or cholesterol group is covalently linked to the C-terminus of the peptide by means of a spacer that comprises one gamma-carboxy-glutamic acid residue and the peptide further includes one or more amino acid substitutions to reduce the pI of the peptide.
- OXM374 is an example of such a peptide analog.
- a peptide analog comprising the amino acid sequence HSQGTFTSDYSKYLDSRRAQDFVQWLMNTK (SEQ ID NO:109) in which the second amino acid from the N-terminus of the peptide is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV;
- the peptide includes a lipid or cholesterol moiety covalently linked to the peptide by a spacer comprising one or more gamma-glutamic acid residues;
- the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide analog has a pI of less than 6.0 and is a dual GLP-1 receptor agonist and glucagon receptor agonist, and pharmaceutically acceptable salts thereof.
- peptide analogs has
- the amino acid substituted for the second amino acid from the N-terminus of the peptide analog is selected from the group consisting of D-serine, ⁇ -aminoisobutyric acid, and 1-amino-1-cyclobutane carboxylic acid.
- the peptide analog includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue that is covalently linked to the ⁇ -amino group of the lysine residue at the C-terminus of the peptide analog by a spacer comprising one or more gamma glutamic acid residues.
- the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker, which in particular embodiments is an ethoxy polymer that includes one to twelve ethoxy units for example, an ethoxy polymer that includes four ethoxy units.
- the peptide analog includes a lipid moiety covalently linked to the ⁇ -amino group of a lysine residue: in particular embodiments the lipid moiety is a fatty acid such as a palmitoyl, myristoyl, or stearoyl moiety. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
- the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues and the lysine residue linked to the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
- the peptide analog further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 10, 12, 16, 17, 18, and 27.
- the peptide analog includes one or more amino acid substitutions selected from the group consisting of lysine for the tyrosine at position 10, serine for the lysine at position 12, glutamic acid or ⁇ -aminoisobutyric acid for the serine at position 16, glutamic acid for the arginine at position 17, alanine for the arginine at position 18, lysine for the glutamine at position 20, and norleucine or O-methyl-L-homoserine for the methionine at position 27.
- the tyrosine at position 10 in the peptide analog is replaced with a lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues.
- the glutamine at position 20 in the peptide analog is replaced with lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine by one or more gamma-glutamic acid residues.
- the peptide analog further includes one or more gamma-glutamic acid residues covalently linked to the C-terminus.
- P is a peptide having the amino acid sequence
- X 1 is a D-serine, ⁇ -aminoisobutyric acid (aib), 1-Amino-1-cyclobutane carboxylic acid (Acb) residue, 1-Amino-1-cyclohexane carboxylic acid (Acx); alpha-aminobutyric acid (Abu); D-alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta-cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (Alg); 2-Amino-2-cyclohexyl-propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1-Amino-1-cyclopropane carboxylic acid (Acp); or 1-Amino-1-cyclopentane carboxylic acid (Acpe) residue; X 2 is a tyrosine,
- peptide analogs have a pI between 4 and 6, or a pI of about 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, or 5.9, or a pI of about 5.4 to 5.5.
- M is a cysteine residue covalently linked to a cholesterol moiety with a hydrophilic linker and the cysteine residue is linked to the C-terminus of P.
- the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units, which in particular aspects can include for example, four ethoxy units.
- M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is linked to the C-terminus of P or M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is at position X 2 or X 7 of P.
- the lipid moiety is a palmitoyl, myristoyl, or stearoyl moiety. Examples of these peptide analogs are shown in Table 2.
- OXM Peptide Analogs SEQ ID NO. Name Structure 46 OXM290 H s QGTFTSDYSKYLDS EA AQDFVQWLMNTKRNRNNIA C -CONH 2 47 OXM291 H s QGTFTSDYSKYLDSRRAQDFVQWLMNTK C -CONH 2 48 OXM291 H s QGTFTSDYSKYLDS EA AQDFVQWLMNTK C -CONH 2 49 OXM293 H s QGTFTSDYSKYLDS E RAQDFVQWLMNTK C -CONH 2 50 OXM294 H s QGTFTSDYSKYLDSR A AQDFVQWLMNTK C -CONH 2 51 OXM301 H s QGTFTSDYSKYLDS EA AQDPVQWLMNTKRNRNNIA C 7 -CONH 2 52 OXM302 H s QGTFTSDYSKYLDSRRAQDF
- C 9 S- ⁇ 1-[46-(cholest-5-en-3-yloxy)-3,43,46-trioxo-7,10,13,16,19,22,25,28,31,34,37,40-dodecaoxa-4,44-diazahexatetracont-1-yl]-2,5-dioxopyrrolidin-3-yl ⁇ -L-cysteine or Cys (mal-oxa 12 -cholesterol)
- C 10 S-[42-(cholest-5-en-3-yloxy)-2,42-dioxo-6,9,12,15,18,21,24,27,30,33,36,39-dodecaoxa-3-azadotetracont-1-yl]-L-cysteine or Cys (oxa 12 -cholesterol)
- C 11 S-[78-(cholest-5-en-3-yloxy)-2,78-dioxo-6,9,12,15
- OXM290 is the precursor for OXM301 and OXM291 to 294 are precursors for the remainder of the peptide analogs shown in Table 2.
- OXM301 is an analogue having D-Ser in amino acid position 2 for DPPIV resistance, substitution of Glu and Ala, respectively, for the Arg 17 and Arm residues, and a C(Oxa 4 -cholesterol) group (C 7 ) for improved pharmacokinetic properties in vivo.
- the substitutions at Arg 17 and Arg 18 were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
- OXM302 is a peptide analog that lacks the amino acid sequence RNRNNIA (SEQ ID NO:96) at the C-terminus (See commonly owned International Published Application No. WO2007/100535, which is incorporated herein in its entirety). Thus, OXM302 is one amino acid longer than the glucagon peptide by one lysine residue at the C-terminus.
- OXM302 which has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK 7 —CONH 2 (SEQ ID NO:52) there is a D-Ser in amino acid position 2 for DPPIV resistance and a C(Oxa4-cholesterol) group (C 7 ) for improved pharmacokinetic properties in vivo.
- OXM303 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKC 7 —CONH 2 (SEQ ID NO:53).
- the D-Ser in amino acid position 2 provides DPPIV resistance, substitution of Glu and Ala, respectively, for the Arg 17 and Arg 18 residues improves stability and a C(Oxa4-cholesterol) group (C 7 ) improves the peptide analog's pharmacokinetic properties in vivo.
- OXM304 has the structure HsQGTFTSDYSKYLDSERAQDFVQWLMNTKC 7 —CONH 2 (SEQ ID NO:54).
- the D-Ser in position 2 provides DPPIV resistance, substitution of Glu for the Arg 17 residue improves stability and a C(Oxa4-cholesterol) group (C 7 ) improves the peptide analog's pharmacokinetic properties in vivo.
- OXM305 has the structure HsQGTFTSDYSKYLDSERAQDFVQWLMNTKC 7 —CONH 2 (SEQ ID NO:55).
- the D-Ser in position 2 provides DPPIV resistance, substitution of Ala for the Arg 18 residue improves stability and a C(Oxa4-cholesterol) group (C 7 ) improves the peptide analog's pharmacokinetic properties in vivo.
- OXM311 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-K(Palmitoyl)-CONH 2 (SEQ ID NO:56).
- the D-Ser in amino acid position 2 provides DPPIV resistance and the K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
- OXM312 has the structure HsQGTETSDYSKYLDSEAAQDFVQWLMNTKK(Palmitoyl)-CONH 2 (SEQ ID NO:57).
- the D-Ser in amino acid position 2 provides DPPIV resistance, substitution of Gln and Ala, respectively, for the Arg 17 and Arg 18 residues improves stability and the K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
- OXM314 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-Ttds-K(Palmitoyl)-CONH 2 (SEQ ID NO:58).
- the D-Ser in amino acid position 2 provides DPPIV resistance and the K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
- the Ttds (1-amino-4,7,10-trioxa-13-tridecanamine succinimic acid) is a linker that acts as a flexible and hydrophilic spacer between the peptide sequence and the K(palmitoyl) group.
- OXM313 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK-Ttds-K(Palmitoyl)-CONH 2 (SEQ ID NO:59).
- the D-Ser in amino acid position 2 provides DPPIV resistance, substitution of Glu and Ala, respectively, for the Arg 17 and Arg 18 residues improves stability and the Ttds-K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
- OXM317 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E-C 4 —CONH 2 (SEQ ID NO:60).
- the peptide there is a D-Ser in amino acid position 2 for DPPIV resistance, and a gamma glutamic residue linked to cholest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ acetate (C 4 ) for improves pharmacokinetic properties in vivo.
- the gamma glutamic residue ( ⁇ E) is a linker that acts as a flexible spacer between the peptide sequence and the C 4 group.
- OXM318 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK- ⁇ E-C 4 —CONH 2 (SEQ ID NO:61).
- the D-Ser in amino acid position 2 provides DPPIV resistance, substitution of Glu and Ala, respectively, for the Arg 17 and Arg 18 residues improves stability and the ⁇ E —C 4 group improves the peptide analog's pharmacokinetic properties in vivo.
- OXM319 has the structure H ⁇ QGTFTSDYSKYLDSEAAQDFVQWLMNTKC 7 —CONH 2 (SEQ ID NO:62).
- the peptide there is a Aib in amino acid position 2 for DPPIV resistance, and the C(Oxa 4 -cholesterol) group (C 7 ) improves the peptide analogs pharmacokinetic properties in vivo.
- OXM321 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA- ⁇ E-C 4 —CONH 2 (SEQ ID NO:63). It is an analogue having D-Ser in amino acid position 2 for DPPIV resistance, substitution of Glu and Ala, respectively, for the Arg 17 and Arg 18 residues and a C (-cholesterol) group (C 4 ) improves pharmacokinetic properties in vivo. The substitutions at Arg 17 and Arg 18 were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
- the gamma glutamic residue ( ⁇ E) is a linker that acts as a flexible spacer between the peptide sequence and the C 4 group.
- OXM323 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKR-C 7 —CONH 2 (SEQ ID NO:64).
- the D-Ser in position 2 provides DPPIV resistance
- substitution of Glu and Ala for Arg 17 and Arg 18 residue provides a peptide with improved stability
- the C(Oxa 4 -cholesterol) group (C 7 ) provides a peptide with improved pharmacokinetic properties in vivo.
- OXM325 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIAC 7 —CO 2 H (SEQ ID NO:65). It is an analogue having D-Ser in amino acid position 2 for DPPIV resistance, substitution of Glu and Ala, respectively, for the Arg 17 and Arg 18 residues, and a C(Oxa 4 -cholesterol) group (C 7 ) improves pharmacokinetic properties in viva. The substitutions at Arg 17 and Arg 18 were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
- OXM327 has the structure H ⁇ AQGTFTSDYSKYLDSERAQDFVQWLMNTKC 7 —CONH 2 (SEQ ID NO:66).
- the Aib in position 2 provides DPPIV resistance
- substitution of Glu for the Arg 17 residue provides a peptide with improved stability
- the C(Oxa 4 -cholesterol) group (C 7 ) provides improved pharmacokinetic properties in vivo.
- OXM329 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E-C 4 —CO 2 H (SEQ ID NO:67).
- the Aib in position 2 provides DPPIV resistance and a C(Oxa4-cholesterol) group (C 7 ) provides a peptide with improved pharmacokinetic properties in vivo.
- the gamma glutamic residue ( ⁇ E) is a linker that acts as a flexible spacer between the peptide sequence and the C 4 group.
- OXM330 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA- ⁇ E-K(Pam)-CONH 2 (SEQ ID NO:68). It is an analogue having D-Ser in amino acid position 2 for DPPIV resistance, substitution of Glu and Ala, respectively, for the Arg 17 and Arm residues and a -K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
- the gamma glutamic residue ( ⁇ E) is a linker that acts as a flexible spacer between the peptide sequence and the K(palmitoyl) group. The substitutions at Arg 17 and Arg 18 were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
- OXM345 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLIVINTK- ⁇ E- ⁇ E-C 4 —COOH (SEQ ID NO:69). It was designed to contain D-Ser (s) at position 2, two gamma-glutamic acid at positions 31 and 32 as spacers between the peptide sequence, and the cholesterol group, one Cys(cholesterol) at position 33 (C 4 ).
- OXM355 has the structure HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK- ⁇ E-C 4 —COOH (SEQ ID NO:70). It was designed to contain D-Ser (s) at position 2, a Lys 12 Ser substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol one Cys(cholesterol) at position 32 (C 4 ). A serine in position 12 is present in the GLP-1 peptide sequence. Therefore, it is expected to have at least compatible potency at the GLP-1R. The substitution Lys 12 Ser eliminates a positive charge which results in a pI of about 5.
- OXM357 has the structure HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK- ⁇ E-C 4 —COOH (SEQ ID NO:71). It was designed to contain D-Ser (s) at position 2, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol one Cys(cholesterol) (C 4 ) at position 32. OXM357 differs from OXM345 in having only one ⁇ -Glu while OXM345 has two ⁇ -Glu.
- OXM359 has the structure HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK- ⁇ E-C 7 —COOH (SEQ ID NO:72). It was designed to contain D-Ser (s) at position 2, a Lys 12 Ser substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 4 -cholesterol) at position 32 (C 7 ). Thus, OXM359 differs from OXM355 in having C 7 (cholesterol group with the tetraethylene glycol spacer) instead of C 4 (cholesterol without an ethylene glycol spacer).
- OXM361 has the structure HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK- ⁇ E-C 7 —COOH (SEQ ID NO:73). It was designed to contain D-Ser (s) at position 2, an Arg 18 Ala substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 4 -cholesterol) at position 32 (C 7 in the table). The Arg 18 Ala substitution eliminates a positive charge which is important for the tuning of the optimal pI value to 5.
- OXM373 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK- ⁇ E-C 4 —COOH (SEQ ID NO:74). It was designed to contain D-Ser (s) at position 2, a Ser 16 Glu substitution, one gamma-glutamic acid at position 31 as spacers between the peptide sequence, and the cholesterol, one Cys(cholesterol) at position 32 (C 4 ). The Glu at position 16 is present in the exendin-4 peptide so this substitution is expected to be at least compatible with GLP-1R activation.
- OXM374 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK- ⁇ E-C 7 —COOH (SEQ ID NO:75). It was designed to contain D-Ser (s) at position 2, a Ser 16 Glu substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 4 -cholesterol) at position 32 (C 7 ). Thus, the difference between OXM373 and 374 is due to the presence of the tetraethylene glycol spacer attached to the cholesterol group in OXM374.
- OXM380 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-C 7 —COOH (SEQ ID NO:76). It was designed to contain D-Ser (s) at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 4 -cholesterol) (C 7 ) at position 33.
- OXM380 has the same peptide sequence of OXM345 but differs in the Oxa 4 spacer linked to the cholesterol group.
- OXM381 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-C 9 —COOH (SEQ ID NO:77). It was designed to contain D-Ser (s) at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(maleimide-Oxa 12 -cholesterol) (C 9 ) at position 33.
- OXM381 has the same peptide sequence of OXM345 and OXM380 differing in the maleimide-Oxa 12 spacer linked to the cholesterol. The structure of C 9 is shown below.
- OXM383 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-C 7 —COOH (SEQ ID NO:78). It was designed to contain Aib (u) at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 4 -cholesterol) (C 7 ) at position 33. OXM383 differs from OXM380 only with respect to the amino acid at position 2.
- OXM388 has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E-C ⁇ E-C 7 —COOH (SEQ ID NO:79). It was designed to contain Acb at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 4 -cholesterol) (C 7 ) at position 33. OXM388 differs from OXM380 and 383 only with respect to the amino acid at position 2.
- OXM392 has the structure HsQGTFTSDYSKYLD E RRA K DFVQWLMNTK- ⁇ E- ⁇ E-C 10 —COOH (lactam bridge between E and K ) (SEQ ID NO:80). It was designed to contain Ser (s) at position 2, Ser 16 Glu and Gln 20 Lys substitutions wherein the Glum and Lys 20 are linked with a lactam bridge on the side chains, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 12 -cholesterol) (C 10 ) at position 33.
- the lactam bridge is between position i (16) and i+4 (20) and is meant to stabilize the alpha-helical conformation of the peptide and to stabilize the peptide against proteolytic degradation.
- the C 10 group differs from the C 9 group for the thioether bond connecting the cysteine thiol group to the Oxa 12 -cholesterol.
- C 9 there is a maleimide thioether bond while in C 10 there is an acetamide thioether.
- the structure of C 10 is shown below.
- OXM395 has the structure H ⁇ QGTFTSDYSKYLD E RRA K DFVQWLMNTK- ⁇ E- ⁇ E-C 10 —COOH (lactam bridge between E and K ) (SEQ ID NO:81). It was designed to contain Aib ( ⁇ ) at position 2, Ser 16 Glu and a Gln 20 Lys substitutions wherein the Glu 16 and Lys 20 are linked with a lactam bridge between the side chains, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 12 -cholesterol) (C 10 ) at position 33.
- the lactam bridge is between position 16(i) and 20 (i+4) and is meant to stabilize the peptide's alpha-helical conformation and to stabilize the peptide against proteolytic degradation.
- OXM398 has the structure H-Acb-QGTFTSDYSKYLD E RRA K DFVQWLMNTK- ⁇ E- ⁇ E-C 10 —COOH (lactam bridge between E and (SEQ ID NO:82). It was designed to contain Acb at position 2, Ser 16 Glu and a Gln 20 Lys substitutions wherein the Glu 16 and Lys 20 are linked with a lactam bridge between the side chains, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 12 -cholesterol) (C 10 ) at position 33.
- the lactam bridge is between position 16 (i) and 20 (i+4) and is meant to stabilize the alpha-helical conformation of the peptide and to stabilize the peptide against proteolytic degradation.
- OXM392, 395 and 398 differ only in the amino acid that is at position 2.
- OXM399 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-C 10 —COOH (SEQ ID NO:83). It was designed to contain D-Ser (s) at position 2, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 12 -cholesterol) (C 10 ) at position 33. OXM399 differs from OXM392 only in that it lacks the lactam bridge present in OXM392.
- OXM400 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-C 10 —COOH (SEQ ID NO:84). It was designed to contain Aib (a) at position 2, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 12 -cholesterol) (C 10 ) at position 33. OXM400 differs from OXM395 only in that it lacks the lactam bridge present in OXM395.
- OXM401 has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-C 10 —COOH (SEQ ID NO:85). It was designed to contain Acb at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 12 -cholesterol) (C 10 ) at position 33. OXM401 differs from OXM398 only in that it lacks the lactam bridge present in OXM398. OXM399, OXM40, and 401 differ from each other in the amino acid at position 2.
- OXM404 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-K( ⁇ E-palmitoyl)-CONH 2 (SEQ ID NO:86). It was designed to contain D-Ser (s) at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys( ⁇ E-palmitoyl) at position 33.
- the peptide in this embodiment is amidated at the C-terminus.
- OXM406 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK- ⁇ E- ⁇ E-C 10 —CONH 2 (SEQ ID NO:87). It was designed to contain D-Ser (s) at position 2, a Ser 16 Glu substitution, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 12 -cholesterol) (C 10 ) at position 33.
- the peptide in this embodiment is amidated at the C-terminus.
- OXM407 has the structure HsQGTFTSDYSKYLDSRRAK( ⁇ E-palmitoyl)DFVQWLMNTK- ⁇ E ⁇ E-CONH 2 (SEQ ID NO:88). It was designed to contain D-Ser (s) at position 2, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys( ⁇ E-palmitoyl) at position 33.
- the peptide in this embodiment is amidated at the C-terminus.
- OXM1408 has the structure HsQGTFTSDYSKYLDSRRAK( ⁇ E- ⁇ E-palmitoyl)DFVQWLMNTK- ⁇ E-CONH 2 (SEQ ID NO:89). It was designed to contain D-Ser (s) at position 2, one gamma-glutamic acid at positions 31, and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 20.
- the peptide in this embodiment is amidated at the C-terminus.
- OXM409 has the structure HsQGTFTSDK( ⁇ E- ⁇ E-palmitoyl)SKYLDSRRADEVQWLMNTK-CONH 2 (SEQ ID NO:89). It was designed to contain D-Ser (s) at position 2 and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
- OXM410 has the structure HsQGTFTSDYSKYLDERRAK( ⁇ E- ⁇ E-palmitoyl)DFVQWLMNTK-CONH 2 (SEQ ID NO:91). It was designed to contain D-Ser (s) at position 2, a Ser 16 Glu substitution, and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 20.
- the peptide in this embodiment is amidated at the C-terminus.
- OXM411 has the structure HsQGTFTSDK( ⁇ E- ⁇ E-palmitoyl)SKYLDERRAQDFVQWLMNTK-CONH 2 (SEQ ID NO:92). It was designed to contain D-Ser (s) at position 2, a Ser 16 Glu substitution and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
- OXM412 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-C 11 —COOH (SEQ ID NO:93). It was designed to contain D-Ser (s) at position 2, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 24 -cholesterol) (C 11 ) at position 33. OXM412 differs from OXM399 for the length of the Oxa spacer linked to the cholesterol group. The structure of C 11 is shown below.
- OXM413 has the structure H ⁇ DGTFTSDYSKYLDSRRAQDFVK(DOTA)WLmNTK- ⁇ E- ⁇ E-C 10 —CONH 2 (SEQ ID NO:94). It was designed as a peptide for imaging to target GLP-1R in vivo.
- the sequence contains Aib at position 2, an Asp at position 3 to give selectivity on the GLP-1R, a Lys(DOTA) at position 24, a Met(O) at position 27, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 12 -cholesterol) (C 10 ) at position 33.
- the peptide in this embodiment is amidated at the C-terminus.
- the structure of Fmoc-Lys(DOTA)-OH is shown below.
- OXM414 has the structure HsQGTFTSDK( ⁇ E-palmitoyl)SKYLDERRAQDFVQWLMNTK-E-CONH 2 (SEQ ID NO:95). It was designed to contain D-Ser (s) at position 2, two ⁇ -glutamic acids at positions 31, a Ser 16 Glu substitution and a palmitoyl group linked to the side chain amino group of a lysine [Lys(palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
- OXM415 has the structure HsQGTFTSDK(palmitoyl)SKYLDERRAQDFVQWLMNTK- ⁇ E- ⁇ E-CONH 2 (SEQ ID NO:96). It was designed to contain D-Ser (s) at position 2, one ⁇ -glutamic acid at positions 31, a Ser 16 Glu substitution and a palmitoyl group linked to one ⁇ -glutamic acid residue and to the side chain amino group of a lysine [Lys( ⁇ E-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
- OXM416 has the structure H ⁇ QGTFTSDK( ⁇ E- ⁇ E-palmitoyl)SKYLDERRAQDFVQWLMNTK-CONH 2 (SEQ ID NO:97). It was designed to contain Aib (a) at position 2, a Ser 16 Glu substitution and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
- OXM417 has the structure H-Acb-QGTFTSDK( ⁇ E- ⁇ E-palmitoyl)SKYLDERRAQDFVQWLMNTK-CONH 2 (SEQ ID NO:98). It was designed to contain Acb at position 2, a Ser 16 Glu substitution and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
- OXM418 has the structure HsQGTFTSDK( ⁇ E- ⁇ E-palmitoyl)SKYLD ⁇ RRAQDFVQWLMNTK- ⁇ E-CONH 2 (SEQ ID NO:99). It was designed to contain D-Ser (s) at position 2, one gamma-glutamic acid at positions 31, a Ser 16 Aib (a) substitution and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 10.
- the peptide in this embodiment is amidated at the C-terminus.
- OXM419 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-K( ⁇ E-palmitoyl)-CONH 2 (SEQ ID NO:100). It was designed to contain Aib (a) at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys( ⁇ E-palmitoyl) at position 33. The peptide in this embodiment is amidated at the C-terminus.
- OXM420 has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-K( ⁇ E-palmitoyl)-CONH 2 (SEQ ID NO:101). It was designed to contain Acb at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys( ⁇ E-palmitoyl) at position 33.
- the peptide in this embodiment is amidated at the C-terminus.
- OXM421 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-C 12 —COOH (SEQ ID NO:102). It was designed to contain D-Ser (s) at position 2, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa 12 -O-cholesterol) (C 12 ) at position 33.
- the Cys(Oxa 12 -O-cholesterol) differs from Cys(Oxa 12 -cholesterol) in having the cholesterol linked through an ether bond to the Oxa 12 spacer.
- the ether bond can confer more stability towards the ester bond present in the Cys(Oxa 12 -cholesterol) or C 11 group.
- the structure of Cys(oxa 12 -O-cholesterol) is shown below.
- compositions comprising a therapeutically effective amount of one or more of the OXM analogs disclosed herein for the treatment of a metabolic disorder in an individual.
- Such disorders include, but are not limited to, obesity, metabolic syndrome or syndrome X, type II diabetes, complications of diabetes such as retinopathy, hypertension, dyslipidemias, cardiovascular disease, gallstones, osteoarthritis, and certain forms of cancers.
- the obesity-related disorders herein are associated with, caused by, or result from obesity.
- “Obesity” is a condition in which there is an excess of body fat. The operational definition of obesity is based on the Body Mass Index (BMI), calculated as body weight per height in meters squared (kg/m2). “Obesity” refers to a condition whereby an otherwise healthy subject has a Body Mass Index (BMI) greater than or equal to 30 kg/m2, or a condition whereby a subject with at least one co-morbidity has BMI greater than or equal to 27 kg/m2.
- An “obese subject” is an otherwise healthy subject with a Body Mass Index (BMI) greater than or equal to 30 kg/m2 or a subject with at least one co-morbidity with a BMI greater than or equal to 27 kg/m2.
- a “subject at risk for obesity” is an otherwise healthy subject with a BMI of 25 kg/m2 to less than 30 kg/m2 or a subject with at least one co-morbidity with a BMI of 25 kg/m2 to less than 27 kg/m2.
- “obesity” refers to a condition whereby a subject with at least one obesity-induced or obesity-related co-morbidity that requires weight reduction or that would be improved by weight reduction, has a BMI greater than or equal to 25 kg/m2.
- an “obese subject” refers to a subject with at least one obesity-induced or obesity-related co-morbidity that requires weight reduction or that would be improved by weight reduction, with a BMI greater than or equal to 25 kg/m2.
- a “subject at risk of obesity” is a subject with a BMI of greater than 23 kg/m2 to less than 25 kg/m2.
- obesity is meant to encompass all of the above definitions of obesity.
- Obesity-induced or obesity-related co-morbidities include, but are not limited to, diabetes, non-insulin dependent diabetes mellitus-type 2, impaired glucose tolerance, impaired fasting glucose, insulin resistance syndrome, dyslipidemia, hypertension, hyperuricacidemia, gout, coronary artery disease, myocardial infarction, angina pectoris, sleep apnea syndrome, Pickwickian syndrome, fatty liver; cerebral infarction, cerebral thrombosis, transient ischemic attack, orthopedic disorders, arthritis deformans, lumbodynia, emmeniopathy, and infertility.
- co-morbidities include: hypertension, hyperlipidemia, dyslipidemia, glucose intolerance, cardiovascular disease, sleep apnea, diabetes mellitus, and other obesity-related conditions.
- Treatment refers to the administration of the compounds of the present invention to reduce or maintain the body weight of an obese subject.
- One outcome of treatment may be reducing the body weight of an obese subject relative to that subject's body weight immediately before the administration of the compounds of the present invention.
- Another outcome of treatment may be preventing body weight regain of body weight previously lost as a result of diet, exercise, or pharmacotherapy.
- Another outcome of treatment may be decreasing the occurrence of and/or the severity of obesity-related diseases.
- the treatment may suitably result in a reduction in food or calorie intake by the subject, including a reduction in total food intake, or a reduction of intake of specific components of the diet such as carbohydrates or fats; and/or the inhibition of nutrient absorption; and/or the inhibition of the reduction of metabolic rate; and in weight reduction in patients in need thereof.
- the treatment may also result in an alteration of metabolic rate, such as an increase in metabolic rate, rather than or in addition to an inhibition of the reduction of metabolic rate; and/or in minimization of the metabolic resistance that normally results from weight loss.
- Prevention refers to the administration of the compounds of the present invention to reduce or maintain the body weight of a subject at risk of obesity.
- One outcome of prevention may be reducing the body weight of a subject at risk of obesity relative to that subject's body weight immediately before the administration of the compounds of the present invention.
- Another outcome of prevention may be preventing body weight regain of body weight previously lost as a result of diet, exercise, or pharmacotherapy.
- Another outcome of prevention may be preventing obesity from occurring if the treatment is administered prior to the onset of obesity in a subject at risk of obesity.
- Another outcome of prevention may be decreasing the occurrence and/or severity of obesity-related disorders if the treatment is administered prior to the onset of obesity in a subject at risk of obesity.
- Such treatment may prevent the occurrence, progression or severity of obesity-related disorders, such as, but not limited to, arteriosclerosis, Type II diabetes, polycystic ovarian disease, cardiovascular diseases, osteoarthritis, dermatological disorders, hypertension, insulin resistance, hypercholesterolemia, hypertriglyceridemia, and cholelithiasis.
- the obesity-related disorders herein are associated with, caused by, or result from obesity.
- obesity-related disorders include overeating and bulimia, hypertension, diabetes, elevated plasma insulin concentrations and insulin resistance, dyslipidemias, hyperlipidemia, endometrial, breast, prostate and colon cancer, osteoarthritis, obstructive sleep apnea, cholelithiasis, gallstones, heart disease, abnormal heart rhythms and arrythmias, myocardial infarction, congestive heart failure, coronary heart disease, sudden death, stroke, polycystic ovarian disease, craniopharyngioma, the Prader-Willi Syndrome, Frohlich's syndrome, GE-deficient subjects, normal variant short stature, Turner's syndrome, and other pathological conditions showing reduced metabolic activity or a decrease in resting energy expenditure as a percentage of total fat-free mass, e.g, children with acute lymphoblastic leukemia.
- obesity-related disorders are metabolic syndrome, also known as syndrome X, insulin resistance syndrome, sexual and reproductive dysfunction, such as infertility, hypogonadism in males and hirsutism in females, gastrointestinal motility disorders, such as obesity-related gastro-esophageal reflux, respiratory disorders, such as obesity-hypoventilation syndrome (Pickwickian syndrome), cardiovascular disorders, inflammation, such as systemic inflammation of the vasculature, arteriosclerosis, hypercholesterolemia, hyperuricaemia, lower back pain, gallbladder disease, gout, and kidney cancer.
- the compounds of the present invention are also useful for reducing the risk of secondary outcomes of obesity, such as reducing the risk of left ventricular hypertrophy.
- diabetes includes both insulin-dependent diabetes mellitus (IDDM, also known as type I diabetes) and non-insulin-dependent diabetes mellitus (NIDDM, also known as Type II diabetes).
- IDDM insulin-dependent diabetes mellitus
- NIDDM non-insulin-dependent diabetes mellitus
- Type I diabetes or insulin-dependent diabetes
- Type II diabetes is the result of an absolute deficiency of insulin, the hormone which regulates glucose utilization.
- Type II diabetes, or insulin-independent diabetes i.e., non-insulin-dependent diabetes mellitus
- Most of the Type II diabetics are also obese.
- the compounds of the present invention are useful for treating both Type I and Type II diabetes.
- the compounds are especially effective for treating Type II diabetes.
- the compounds of the present invention are also useful for treating and/or preventing gestational diabetes mellitus.
- U.S. Pat. No. 6,852,690 which is incorporated herein in its entirety, discloses methods for enhancing metabolism of nutrients comprising administering to a non-diabetic patient a formulation comprising a nutritively effective amount of one or more nutrients or any combination thereof and one or more insulinotropic peptides.
- the OXM peptide analogs disclosed herein are insulinotropic and can be administered to patients with a disturbed glucose metabolism such as insulin resistance but no overt diabetes, as well as patients who for any reason cannot receive nutrition through the alimentary canal.
- Such patients include surgery patients, comatose patients, patients in shock, patients with gastrointestinal disease, patients with digestive hormone disease, and the like.
- obese patients atherosclerotic patients, vascular disease patients, patients with gestational diabetes, patients with liver disease such as liver cirrhosis, patients with acromegaly, patients with glucorticoid excess such as cortisol treatment or Cushings disease, patients with activated counterregulatory hormones such as would occur after trauma, accidents and surgery and the like
- patients with hypertriglyceridemia and patients with chronic pancreatitis can be readily and suitably nourished according to the invention without subjecting the patient to hypo- or hyperglycemia.
- the administration to such a patient aims to provide a therapy to as rapidly as possible deliver the nutritional and caloric requirements to the patient while maintaining his plasma glucose below the so-called renal threshold of about 160 to 180 milligrams per deciliter of glucose in the blood.
- renal threshold of about 160 to 180 milligrams per deciliter of glucose in the blood.
- normal patients not having glucose levels just below the renal threshold can also be treated according to the invention as described above, patients with disturbed glucose metabolism such as hyperglycemic patients whose plasma glucose level is just above the renal threshold also find the therapy suitable for their condition.
- such patients who have a degree of hyperglycemia below the renal threshold at intermittent intervals can receive a combination treatment of nutrients plus insulinotropic peptides according to any of the following regimens.
- Normal patients not suffering from such hyperglycemia can also be treated using the peptide analogs disclosed herein.
- compositions may be used in a pharmaceutical composition when combined with a pharmaceutically acceptable carrier.
- Such compositions comprise a therapeutically-effective amount of one or more of the OXM analogs disclosed herein and a pharmaceutically acceptable carrier.
- Such a composition may also be comprised of (in addition to the OXM analog disclosed herein and a carrier) diluents, fillers, salts, buffers, stabilizers, solubilizers, and other materials well known in the art.
- Compositions comprising the OXM analogs disclosed herein can be administered, if desired, in the form of salts provided the salts are pharmaceutically acceptable. Salts may be prepared using standard procedures known to those skilled in the art of synthetic organic chemistry.
- compositions comprising formula I are also useful for treating or preventing obesity and obesity-related disorders in cats and dogs.
- mamal includes companion animals such as cats and dogs.
- salts derived from inorganic bases include aluminum, ammonium, calcium, copper, ferric, ferrous, lithium, magnesium, manganic salts, manganous, potassium, sodium, zinc, and the like. Particularly preferred are the ammonium, calcium, magnesium, potassium, and sodium salts.
- Salts derived from pharmaceutically acceptable organic non-toxic bases include salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, and basic ion exchange resins, such as arginine, betaine, caffeine, choline, N,N′-dibenzylethylenediamine, diethylamine, 2-diethylaminoethanol, 2-dimethylaminoethanol, ethanolamine, ethylenediamine, N-ethyl-morpholine, N-ethylpiperidine, glutamine, glucosamine, histidine, hydrabamine, isopropylamine, lysine, methylglucamine, morpholine, piperazine, piperidine, polyamine resins, procaine, purines, theobromine, triethylamine, trimethylamine, tripropylamine, tromethamine, and the like.
- basic ion exchange resins such as arg
- pharmaceutically acceptable salt further includes all acceptable salts such as acetate, lactobionate, benzenesulfonate, laurate, benzoate, malate, bicarbonate, maleate, bisulfate, mandelate, bitartrate, mesylate, borate, methylbromide, bromide, methylnitrate, calcium edetate, methylsulfate, camsylate, mutate, carbonate, napsylate, chloride, nitrate, clavulanate, N-methylglucamine, citrate, ammonium salt, dihydrochloride, oleate, edetate, oxalate, edisylate, pamoate (embonate), estolate, palmitate, esylate, pantothenate, fumarate, phosphate/diphosphate, gluceptate, polygalacturonate, gluconate, salicylate, glutamate, stearate, glycolly
- the term “pharmaceutically acceptable” means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredient(s), approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopoeia or other generally recognized pharmacopoeia for use in animals and, more particularly, in humans.
- carrier refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered and includes, but is not limited to such sterile liquids as water and oils. The characteristics of the carrier will depend on the route of administration.
- OXM analogs disclosed herein may be in multimers (for example, heterodimers or homodimers) or complexes with itself or other peptides.
- pharmaceutical compositions of the invention may comprise one or more OXM analogs disclosed herein in such multimeric or complexed form.
- the term “therapeutically effective amount” means the total amount of each active component of the pharmaceutical composition or method that is sufficient to show a meaningful patient benefit, i.e., treatment, healing, prevention or amelioration of the relevant medical condition, or an increase in rate of treatment, healing, prevention or amelioration of such conditions.
- a meaningful patient benefit i.e., treatment, healing, prevention or amelioration of the relevant medical condition, or an increase in rate of treatment, healing, prevention or amelioration of such conditions.
- the term refers to that ingredient alone.
- the term refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially, or simultaneously.
- the pharmacological composition can comprise one or more OXM analogs disclosed herein; one or more OXM analogs disclosed herein and one or more other agents for treating a metabolic disorder; or the pharmacological composition comprising the one or more OXM analogs disclosed herein can be used concurrently with a pharmacological composition comprising an agent for treating a metabolic disorder.
- Such disorders include, but are not limited to, obesity, metabolic syndrome or syndrome X, type II diabetes, complications of diabetes, hypertension, dyslipidemias, cardiovascular disease, gallstones, osteoarthritis, and certain forms of cancers.
- the agent includes, but are not limited to, cannabinoid (CB1) receptor antagonists, glucagon like peptide 1 (GLP-1) receptor agonists, lipase inhibitors, leptin, tetrahydrolipstatin, 2-4-dinitrophenol, acarbose, sibutramine, phentamine, fat absorption blockers, simvastatin, mevastatin, ezetimibe, atorvastatin, sitagliptin, metformin, orlistat, Qnexa, topiramate, naltrexone, bupriopion, phentermine, losartan, losartan with hydrochlorothiazide, and the like.
- CBD1 cannabinoid
- GLP-1 glucagon like peptide 1
- Suitable agents of use in combination with a compound of the present invention include, but are not limited to:
- anti-diabetic agents such as (1) PPAR ⁇ agonists such as glitazones (e.g. ciglitazone; darglitazone; englitazone; isaglitazone (MCC-555); pioglitazone (ACTOS); rosiglitazone (AVANDIA); troglitazone; rivoglitazone, BRL49653; CLX-0921; 5-BTZD, GW-0207, LG-100641, R483, and LY-300512, and the like and compounds disclosed in WO97/10813, 97/27857, 97/28115, 97/28137, 97/27847, 03/000685, and 03/027112 and SPPARMS (selective PPAR gamma modulators) such as T131 (Amgen), FK614 (Fujisawa), netoglitazone, and metaglidasen; (2) biguanides such as buformin; metformin
- WO 99/16758 WO 99/19313, WO 99/20614, WO 99/38850, WO 00/23415, WO 00/23417, WO 00/23445, WO 00/50414, WO 01/00579, WO 01/79150, WO 02/062799, WO 03/033481, WO 03/033450, WO 03/033453; and (14) other insulin sensitizing drugs; (15) VPAC2 receptor agonists; (16) GLK modulators, such as PSN105, RO 281675, RO 274375 and those disclosed in WO 03/015774, WO 03/000262, WO
- NS-220/R1593 Nippon Shinyaku/Roche
- ST1929 Sigma Tau
- MC3001/MC3004 MaxoCore Pharmaceuticals, gemcabene calcium, other fibric acid derivatives, such as Atromid®, Lopid®, and Tricor®, and those disclosed in U.S. Pat. No.
- FXR receptor modulators such as GW 4064 (GlaxoSmithkline), SR 103912, QRX401, LN-6691 (Lion Bioscience), and those disclosed in WO 02/064125, WO 04/045511, and the like;
- LXR receptor modulators such as GW 3965 (GlaxoSmithkline), T9013137, and XTCO179628 (X-Ceptor Therapeutics/Sanyo), and those disclosed in WO 03/031408, WO 03/063796, WO 04/072041, and the like
- lipoprotein synthesis inhibitors such as niacin
- PPAR ⁇ partial agonists such as those disclosed in WO 03/024395
- bile acid reabsorption inhibitors such as BARI 1453, SC435, PHA384640, S8921, AZD7706, and the like; and
- anti-hypertensive agents such as (1) diuretics, such as thiazides, including chlorthalidone, chlorthiazide, dichlorophenamide, hydroflumethiazide, indapamide, and hydrochlorothiazide; loop diuretics, such as bumetanide, ethacrynic acid, furosemide, and torsemide; potassium sparing agents, such as amiloride, and triamterene; and aldosterone antagonists, such as spironolactone, epirenone, and the like; (2) beta-adrenergic blockers such as acebutolol, atenolol, betaxolol, bevantolol, bisoprolol, bopindolol, carteolol, carvedilol, celiprolol, esmolol, indenolol, metaprolol, nadolol, nebivolol
- anti-obesity agents such as (1) 5HT (serotonin) transporter inhibitors, such as paroxetine, fluoxetine, fenfluramine, fluvoxamine, sertraline, and imipramine, and those disclosed in WO 03/00663, as well as serotonin/noradrenaline re uptake inhibitors such as sibutramine (MERIDIA/REDUCTIL) and dopamine uptake inhibitor/Norepenephrine uptake inhibitors such as radafaxine hydrochloride, 353162 (GlaxoSmithkline), and the like; (2) NE (norepinephrine) transporter inhibitors, such as GW 320659, despiramine, talsupram, and nomifensine; (3) CB1 (cannabinoid-1 receptor) antagonist/inverse agonists, such as rimonabant (ACCOMPLIA Sanofi Synthelabo), SR-147778 (Sanofi Synthelabo), AVE
- MCH1R melanin-concentrating hormone 1 receptor
- T-226296 Takeda
- T71 Takeda/Amgen
- AMGN-608450 AMGN-503796
- Amgen 856464
- A798 Abbott
- ATC0175/AR224349 Arena Pharmaceuticals
- GW803430 GaxoSmithkine
- NBI-1A Neurorocrine Biosciences
- NGX-1 Neurogen
- SNP-7941 Synaptic
- SNAP9847 Synaptic
- T-226293 Schering Plough
- TPI-1361-17 Saitama Medical School/University of California Irvine
- NPY1 neuropeptide Y Y1
- BMS205749, BIBP3226, J-115814, BIBO 3304, LY-357897, CP-671906, and GI-264879A and those disclosed in U.S. Pat. No.
- NPY5 neuropeptide Y Y5
- E-6999 Esteve
- GW-587081X GW-548118X
- FR 235,208 FR226928, FR 240662, FR252384
- 1229U91 GI-264879A
- CGP71683A C-75
- LY366377 LY366377, PD-160170, SR-120562A, SR-120819A, S2367 (Shionogi), JCF-104, and H409/22; and those compounds
- WO 97/19682 WO 97/20820, WO 97/20821, WO 97/20822, WO 97/20823, WO 98/27063, WO 00/107409, WO 00/185714, WO 00/185730, WO 00/64880, WO 00/68197, WO 00/69849, WO 01/09120, WO 01/14376, WO 01/85714, WO 01/85730, WO 01/07409, WO 01/02379, WO 01/02379, WO 01/23388, WO 01/23389, WO 01/44201, WO 01/62737, WO 01/62738, WO 01/09120, WO 02/20488, WO 02/22592, WO 02/48152, WO 02/49648, WO 02/051806, WO 02/094789, WO 03/009845, WO 03/014083, WO 03/0228
- leptin such as recombinant human leptin (PEG-OB, Hoffman La Roche) and recombinant methionyl human leptin (Amgen);
- leptin derivatives such as those disclosed in U.S. Pat. Nos.
- opioid antagonists such as nalmefene (Revex®), 3-methoxynaltrexone, naloxone, and naltrexone; and those disclosed in WO 00/21509; (13) orexin antagonists, such as SB-334867-A (GlaxoSmithkline); and those disclosed in WO 01/96302, 01/68609, 02/44172, 02/51232, 02/51838, 02/089800, 02/090355, 03/023561, 03/032991, 03/037847, 04/004733, 04/026866, 04/041791, 04/085403, and
- CNTF ciliary neurotrophic factors
- GI-181771 Gaxo-SmithKline
- SR146131 Sanofi Synthelabo
- butabindide butabindide
- PD170,292, PD 149164 Pfizer
- CNTF derivatives such as axokine (Regeneron); and those disclosed in WO 94/09134, WO 98/22128, and WO 99/43813
- GHS growth hormone secretagogue receptor
- GHS growth hormone secretagogue receptor
- GLP-1 glucagon-like peptide 1 agonists
- Topiramate Topimax®
- phytopharm compound 57 CP 644,673
- ACC2 acetyl-CoA carboxylase-2
- ⁇ 3 beta adrenergic receptor 3) agonists, such as rafebergron/AD9677/TAK677 (Dainippon/Takeda), CL-316,243, SB 418790, BRL-37344, L-796568, BMS-196085, BRL-35135A, CGP12177A, BTA-243, GRC1087 (Glenmark Pharmaceuticals)
- GW 427353 solabegron hydrochloride
- Trecadrine Zeneca D7114, N-5984 (Nisshin Kyorin)
- glucocorticoid receptor antagonists such as CP472555 (Pfizer), KB 3305, and those disclosed in WO 04/000869, WO 04/075864, and the like; (37) 11 ⁇ HSD-1 (11-beta hydroxy steroid dehydrogenase type 1) inhibitors, such as BVT 3498 (AMG 331), BVT 2733, 3-(1-adamantyl)-4-ethyl-5-(ethylthio)-4H-1,2,4-triazole, 3-(1-adamantyl)-5-(3,4,5-trimethoxyphenyl)-4-methyl-4H-1,2,4-triazole, 3-adamantanyl-4,5,6,7,8,9,10,11,12,3a-decahydro-1,2,4-triazolo[4,3-a][11]annulene, and those compounds disclosed in WO 01
- Specific compounds that can be used in combination with the OXM analogs disclosed herein include specific CB1 antagonists/inverse agonists include those described in WO03/077847, including: N-[3-(4-chlorophenyl)-2(S)-phenyl-1(S)-methylpropyl]-2-(4-trifluoromethyl-2-pyrimidyloxy)-2-methylpropanamide, N-[3-(4-chlorophenyl)-2-(3-cyanophenyl)-1-methylpropyl]-2-(5-trifluoromethyl-2-pyridyloxy)-2-methylpropanamide, N-[3-(4-chlorophenyl)-2-(5-chloro-3-pyridyl)-1-methylpropyl]-2-(5-tri fluoromethyl-2-pyridyloxy)-2-methylpropanamide, and pharmaceutically acceptable salts thereof; as well as those in WO05/000809, which includes the following: 3- ⁇
- NPY5 antagonists that can be used in combination with the OXM analogs disclosed herein include: 3-oxo-N-(5-phenyl-2-pyrazinyl)-spiro[isobenzofuran-1(3H), 4′-piperidine]-1′-carboxamide, 3-oxo-N-(7-trifluoromethylpyrido[3,2-b]pyridin-2-yl)spiro-[isobenzofuran-1(3H), 4′-piperidine]-1′-carboxamide, N-[5-(3-fluorophenyl)-2-pyrimidinyl]-3-oxospiro-[isobenzofuran-1(3H), 4′-piperidine]-1′-carboxamide, trans-3′-oxo-N-(5-phenyl-2-pyrimidinyl)spiro[cyclohexane-1,1′(3′H)-isobenzofuran]-4-carboxamide, trans-3
- Specific ACC-1/2 inhibitors that can be used in combination with the OXM analogs disclosed herein include: 1′-[(4,8-dimethoxyquinolin-2-yl)carbonyl]-6-(1H-tetrazol-5-yl)spiro[chroman-2,4′-piperidin]-4-one; (5- ⁇ 1′-[(4,8-dimethoxyquinolin-2-yl)carbonyl]-4-oxospiro[chroman-2,4′-piperidin]-6-yl)-2H-tetrazol-2-yl)methyl pivalate; 5- ⁇ 1′-[(8-cyclopropyl-4-methoxyquinolin-2-yl)carbonyl]-4-oxospiro[chroman-2,4′-piperidin]-6-yl ⁇ nicotinic acid; 1′-(8-methoxy-4-morpholin-4-yl-2-naphthoyl)-6-(1H-tetrazol-5
- MCH1R antagonist compounds that can be used in combination with the OXM analogs disclosed herein include: 1- ⁇ 4-[(1-ethylazetidin-3-yl)oxy]phenyl ⁇ -4-[(4-fluorobenzyl)oxy]pyridin-2(1H)-one, 4-[(4-fluorobenzyl)oxy]-1- ⁇ 4-[(1-isopropylazetidin-3-yl)oxy]phenyl ⁇ pyridin-2(1H)-one, 1-[4-(azetidin-3-yloxy)phenyl]-4-[(5-chloropyridin-2-yl)methoxy]pyridin-2(1H)-one, 4-[(5-chloropyridin-2-yl)methoxy]-1- ⁇ 4-[(1-ethylazetidin-3-yl)oxy]phenyl ⁇ pyridin-2(1H)-one, 4-[(5-chloropyridin-2
- a specific DPP-IV inhibitor that can be used in combination with the OXM analogs disclosed herein is 7-[(3R)-3-amino-4-(2,4,5-trifluorophenyl)butanoyl]-3-(trifluoromethyl)-5,6,7,8-tetrahydro-1,2,4-triazolo[4,3-a]pyrazine, or a pharmaceutically acceptable salt thereof.
- H3 (histamine H3) antagonists/inverse agonists that can be used in combination with the OXM analogs disclosed herein include: those described in WO05/077905, including: 3- ⁇ 4-[(1-cyclobutyl-4-piperidinyl)oxy]phenyl)-2-ethylpyrido[2,3-d]-pyrimidin-4(3H)-one, 3-(4-[(1-cyclobutyl-4-piperidinyl)oxy]phenyl ⁇ -2-methylpyrido[4,3-d]pyrimidin-4(3H)-one, 2-ethyl-3-(4- ⁇ 3-[(3S)-3-methylpiperidin-1-yl]propoxy ⁇ phenyl)pyrido[2,3-d]pyrimidin-4(3H)-one 2-methyl-3-(4- ⁇ 3-[(3S)-3-methylpiperidin-1-yl]propoxy ⁇ phenyl)pyrido[4,3-d]pyrimidin
- CCK1R agonists of use in combination with the OXM analogs disclosed herein include: 3-(4- ⁇ [1-(3-ethoxyphenyl)-2-(4-methylphenyl)-1H-imidazol-4-yl]carbonyl ⁇ -1-piperazinyl)-1-naphthoic acid; 3-(4- ⁇ [1-(3-ethoxyphenyl)-2-(2-fluoro-4-methylphenyl)-1H-imidazol-4-yl]carbonyl ⁇ -1-piperazinyl)-1-naphthoic acid; 3-(4- ⁇ [1-(3-ethoxyphenyl)-2-(4-fluorophenyl)-1H-imidazol-4-yl]carbonyl ⁇ -1-piperazinyl)-1-naphthoic acid; 3-(4- ⁇ [1-(3-ethoxyphenyl)-2-(2,4-difluorophenyl)-1H-
- MC4R agonists of use in combination with the OXM analogs disclosed herein include: 1) (5S)-1′- ⁇ [(3R,4R)-1-tert-butyl-3-(2,3,4-trifluorophenyl)piperidin-4-yl]carbonyl ⁇ -3-chloro-2-methyl-5-[1-methyl-1-(1-methyl-1H-1,2,4-triazol-5-yl)ethyl]-5H-spiro[furo[3,4-b]pyridine-7,4′-piperidine]; 2) (5R)-1′- ⁇ [(3R,4R)-1-tert-butyl-3-(2,3,4-trifluorophenyl)-piperidin-4-yl]carbonyl ⁇ -3-chloro-2-methyl-5-[1-methyl-1-(1-methyl-1H-1,2,4-thiazol-5-yl)ethyl]-5H-spiro[furo[3,4-b]pyridine-7,4′
- GLP-1 incretin hormone glucagon-like peptide 1
- Methods of administrating the pharmacological compositions comprising the one or more OXM analogs disclosed herein to an individual include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.
- the compositions can be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (for example, oral mucosa, rectal and intestinal mucosa, and the like), ocular, and the like and can be administered together with other biologically-active agents. Administration can be systemic or local.
- Intraventricular injection may be facilitated by an intraventricular catheter attached to a reservoir (for example, an Ommaya reservoir).
- Pulmonary administration may also be employed by use of an inhaler or nebulizer, and formulation with an aerosolizing agent. It may also be desirable to administer the one or more OXM analogs disclosed herein locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, by injection, by means of a catheter, by means of a suppository, or by means of an implant.
- the OXM analogs disclosed herein may be delivered in a vesicle, in particular a liposome.
- a liposome the OXM analogs disclosed herein are combined, in addition to other pharmaceutically acceptable carriers, with amphipathic agents such as lipids which exist in aggregated form as micelles, insoluble monolayers, liquid crystals, or lamellar layers in aqueous solution.
- Suitable lipids for liposomal formulation include, without limitation, monoglycerides, diglycerides, sulfatides, lysolecithin, phospholipids, saponin, bile acids, and the like. Preparation of such liposomal formulations is within the level of skill in the art, as disclosed, for example, in U.S. Pat. No. 4,837,028 and U.S. Pat. No. 4,737,323.
- the OXM analogs disclosed herein can be delivered in a controlled release system including, but not limited to: a delivery pump (See, for example, Saudek, et al., New Engl. J. Med.
- the controlled release system can be placed in proximity of the therapeutic target (for example, the brain), thus requiring only a fraction of the systemic dose. See, for example, Goodson, In: Medical Applications of Controlled Release, 1984. (CRC Press, Bocca Raton, Fla.).
- compositions comprising one or more of the OXM analogs disclosed herein which will be effective in the treatment of a particular disorder or condition will depend on the nature of the disorder or condition, and may be determined by standard clinical techniques by those of average skill within the art. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges.
- dose to be employed in the formulation will also depend on the route of administration, and the overall seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances, Ultimately, the attending physician will decide the amount of the composition with which to treat each individual patient. Initially, the attending physician will administer low doses of the composition and observe the patient's response.
- the daily dose range lie within the range of from about 0.001 mg to about 100 mg per kg body weight of a mammal, preferably 0.01 mg to about 50 mg per kg, and most preferably 0.1 to 10 mg per kg, in single or divided doses. On the other hand, it may be necessary to use dosages outside these limits in some cases.
- suitable dosage ranges for intravenous administration of the compositions comprising the one or more OXM analogs disclosed herein are generally about 5-500 micrograms ( ⁇ g) of active compound per kilogram (Kg) body weight.
- Suitable dosage ranges for intranasal administration are generally about 0.01 pg/kg body weight to 1 mg/kg body weight. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems. Suppositories generally contain active ingredient in the range of 0.5% to 10% by weight; oral formulations preferably contain 10% to 95% active ingredient. Ultimately the attending physician will decide on the appropriate duration of therapy using compositions comprising the one or more OXM analogs disclosed herein of the present invention. Dosage will also vary according to the age, weight and response of the individual patient.
- a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions and OXM analogs disclosed herein.
- Optionally associated with such container(s) may be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
- Oxyntomodulin (OXM) analogs were essentially as follows.
- the OXM analogs shown in Table 2 below were synthesized by solid phase using Fmoc/t-Bu chemistry on a peptide multisynthesizer APEX 396 (Advanced Chemtech) using a 40-well reaction block. Each peptide was synthesized in a single well.
- peptide amides For peptide amides, 0.1 g of an aminomethylated polystirene LL (100-200 mesh, 0.41 mmol/g) (Novabiochem) resin derivatized with a modified Rink linker p-[(R,S)- ⁇ -[9H-Fluoren-9-yl-methoxyformamido]-2,4-dimethoxybenzyl]-phenoxyacetic acid (Rink, H., 1987 , Tetrahedron Lett. 28:3787-3789; Bernatowicz, M. S. et al., 1989 , Tetrahedron Lett. 30:4645-4667) was used.
- All the amino acids were dissolved at a 0.5 M concentration in a solution of 0.5M HOBt (Hydroxybenzotriazole) in DMF.
- the acylation reactions were performed for 45 minutes with six-fold excess of activated amino acid over the resin free amino groups.
- the amino acids were activated with equimolar amounts of HBTU (2-(1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate) and a two-fold molar excess of DIEA (N,N-diisopropylethylamine).
- the peptides were synthesized by solid phase using Fmoc/t-Bu chemistry on a Pioneer Peptide Synthesizer (Applied Biosystems).
- the side chain protecting groups were: OMpe (O-3-Methyl-pent-3-yl) for Asp; tert-butyl for Glu, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys, Gln, and H; and, tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl for Arg.
- OMpe O-3-Methyl-pent-3-yl
- tert-butyl for Glu, Ser, D-Ser, Thr and Tyr
- trityl for Asn, Cys, Gln, and H
- tert-butoxy-carbonyl for Lys, Trp
- 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl for Arg.
- Lysine-Palmitoyl was manually acylated by reaction with equimolar amounts of HBTU (2-(1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate) and a 2-fold molar excess of DIEA (N,N-diisopropylethylamine).
- HBTU 2-(1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate
- DIEA N,N-diisopropylethylamine
- the dry peptide-resins were individually treated with 20 mL of the cleavage mixture, 88% trifluoroacetic acid (TFA), 5% phenol, 2% triisopropylsilane and 5% water (Sole, N. A. and G. Barany, 1992 , J. Org, Chem. 57:5399-5403) for 1.5 hours at room temperature. Each resin was filtered and the solution was added to cold methyl-t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice. Final pellets were dried, resuspended in H 2 O, 20% acetonitrile, and lyophilized.
- the crude peptides were purified by reverse-phase HPLC using preparative Waters RCM Delta-PakTM C ⁇ 4 cartridges (40 ⁇ 200 mm, 15 ⁇ m) and using as eluents (A) 0.1% TFA in water and (B) 0.1% TFA in acetonitrile.
- the following gradient of eluent B was used: 20%-20% over five minutes and 20%-35% over 20 minutes for the OXM229 (the peptide thiolated precursor of OXM36 and OXM115), OXM29 (the thiolated precursor of OXM70 and OXM216), OXM208 (the peptide thiolated precursor of OXM212), and OXM209 (the peptide thiolated precursor of OXM213).
- peptides OXM110 and 177 the following gradient of eluent B was used: 32%-32% over five minutes and 32%-42% over 20 minutes flow rate 80 mL/min.
- Analytical HPLC was performed on a Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 ⁇ 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45 C.°, using H 2 O, 0.1% TFA (A) and CH 3 CN, 0.1% TFA (B) as solvents and the following linear gradient: 20%-20% B (in five minutes)-35% B (in 20 minutes)-80% B (in two minutes), flow 1 mL/min.
- the purified peptide was characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- Oxyntomodulin (OXM) cholesterylated analogs OXM36, OXM70, OXM115, OXM212, OXM213, and OXM216 was as follows.
- the reactions were run under conditions that permit the formation of a thioether bond.
- the cholesterylaled OXM peptides were then isolated using reverse-phase HPLC and characterized on a Micromass LCZ platform.
- the analogs OXM36, 70, 212, and 213 were synthesized from the thiol containing OXM peptide precursor OXM229, OXM208, and 209, respectively, by reaction with the bromo derivative, cholest-5-en-3-yl bromoacetate having the structure
- peptide precursor were dissolved in one mL of DMSO (conc. 30 mg/mL) and a one molar excess of cholest-5-en-3-yl bromoacetate dissolved in THF (conc. 20 mg/mL) was added. Then 1% by volume of DIPEA (N,N-diisopropyl-ethylamine) was added to the mixture; after 30 minutes of incubation, the peptide solution was purified by RP-HPLC and characterized on a Micromass LCZ platform.
- DIPEA N,N-diisopropyl-ethylamine
- the peptides OXM115 and 216 were synthesized from the thiol containing OXM peptide precursor OXM229 and OXM29 to produce analogs by reaction with the bromo derivative, cholest-5-en-3-yl]-bromo-2-oxo-6,9,12,15-tetraoxa-3-azaoctadecan-18-oate
- peptide precursor were dissolved in 1 mL of DMSO (conc. 30 mg/mL) and a one molar excess of cholest-5-en-3-yl]-bromo-2-oxo-6,9,12,15-tetraoxa-3-azaoctadecan-18-oate dissolved in THF (conc. 20 mg/mL) was added. Then 3% by volume of DIPEA (N,N-diisopropyl-ethylamine) was added to the mixture; after 30 minutes of incubation, the peptide solution was purified by RP-HPLC and characterized on a Micromass LCZ platform.
- DIPEA N,N-diisopropyl-ethylamine
- PEGylation reactions were run under conditions permitting thioester bond formation.
- the PEGylated OXM peptide was then isolated using reverse-phase HPLC or ion exchange chromatography and size exclusion chromatography (SEC).
- SEC size exclusion chromatography
- PEGylated OXM analogs were characterized using RP-HPLC, HPLC-SEC and MALDI-Tof Mass Spectrometry.
- OXM33, 34, 35, 36 and 54 peptides were synthesized from the thiol-containing OXM peptide precursor OXM229 to produce analogs with PEG covalently attached via a thioether bond.
- control peptide OXM54 was prepared by incubating the thiol containing peptide precursor with 10 eq. of iodoacetamide in 0.1 M TrisHCl pH 7.5, 6M guanidinium chloride. After 30 minutes incubation the peptide was purified by RP-HPLC and characterized by electrospray mass spectrometry.
- OXM peptide analogs that that display full agonistic activity on the GLP-1 and the Glucagon receptors and shown in Table 2 were synthesized as follows.
- the peptides OXM290, 291, 292, 293 and 294 that are precursors of OXM301, OXM302, OXM303, OXM304 and OXM305 were synthesized by solid phase using Fmoc/t-Bu chemistry on a peptide multisynthesizer Simphony Protein Technologies Inc.
- peptide amides For peptide amides, 0.5 g of a resin Aminomethylated polystirene LL (100-200 mesh, 0.41 mmol/g) (Novabiochem) resin derivatized with a modified Rink linker p-[(R,S)- ⁇ -[9H-Fluoren-9-yl-methoxyformamido]-2,4-dimethoxybenzyl]-phenoxyacetic acid (Rink, Tetrahedron Lett. 28:3787-3789 (1987); Bematowiez et al., Tetrahedron Lett. 30:4645-4667 (1989)) was used.
- All the amino acids were dissolved at a 0.5 M concentration in a solution of 0.5 M HOBt (Hydroxybenzotriazole) in DMF.
- the acylation reactions were performed for 60 minutes with 8-fold excess of activated amino acid over the resin free amino groups.
- the amino acids were activated with equimolar amounts of HBTU (2-(1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate), solution 0.5 M in DMF, and a 2-fold molar excess of DIEA (N,N-diisopropylethylamine), solution 2 M in NMP.
- HBTU 2-(1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate
- DIEA N,N-diisopropylethylamine
- the side chain protecting groups were: OMpe (O-3-Methyl-pent-3-yl) for Asp; tert-butyl for Glu, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys, Gln and H; tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl for Arg; Boc-His(Trt)-OH was used in the synthesis.
- the dry peptide-resins were individually treated with 25 mL of the cleavage mixture, 82.5% trifluoroacetic acid (TFA), 5% phenol, 5% thioanisole, 2.5% Ethandithiole, and 5% water for 1.5 hours at room temperature. Each resin was filtered and the volume of the solution was reduced then added to cold methyl-t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice. Final pellets were dried, resuspended in H 2 O, 20% acetonitrile, and lyophilized.
- TFA trifluoroacetic acid
- the crude peptides were purified by reverse-phase HPLC using preparative Waters RCM Delta-PakTM C ⁇ 4 cartridges (40 ⁇ 200 mm, 15 ⁇ m) and using as eluents (A) 0.1% TFA in water and (B) 0.1% TFA in acetonitrile.
- the following gradient of eluent B was used: 22%-22% over 5 min and 22%-32% over 20 min for OXM301 precursor, 22%-22% over 5 min and 22%-35% over 20 min for OXM302 precursor, 25%-25% over 5 min and 25%-40% over 20 min for OXM303 precursor, 25%-25% over 5 min and 25%-35% over 20 min for OXM304 precursor and OXM305 precursor, flow rate 80 mL/min, wavelength 214 nm.
- Analytical HPLC was performed on a Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 ⁇ 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45° C., using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents and the following linear gradient: 25%-25% B (in 5 min)-40% B (in 20 min)-80% B (in 2 minutes), flow 1 mL/min.
- the purified peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- the final peptides were characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 ⁇ 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45° C., using H 2 O, 0.1% TFA (A) and CH 3 CN, 0.1% TFA (B) as solvents and the following linear gradient: 40%-40% B (in 5 min)-70% B (in 20 min)-80% B (in 2 min), flow 1 in mL/min.
- the peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- OXM237-OXM308 and OXM345-OXM414 were synthesized by solid phase using Fmoc/t-Bu chemistry on a peptide multisynthesizer Simphony Protein Technologies Inc.
- the amino acids were activated with equimolar amounts of HBTU (2-(1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate), solution 0.5 M in DMF, and a 2-fold molar excess of DIEA (N,N-diisopropylethylamine), solution 2M in NMP.
- HBTU 2-(1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate
- DIEA N,N-diisopropylethylamine
- the side chain protecting groups were: Ompe (O-3-Methyl-pent-3-yl) for Asp; tert-butyl for Gln, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys, Gln and H; tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl for Arg; Boc-His(Trt)-OH was used in the synthesis.
- Glu16 and Lys20 were incorporated as Glu(Oall) and Lys(Alloc).
- the resins were dried, the protecting groups of Glu(Oall) and Lys(Alloc) were removed and the lactam bridge was formed by incubating the resin with 5 molar excess of HBTU and 10 molar excess of DIPEA.
- lipidated peptides such as OXM404, 407, 408, 410, 411, 414, 415, 416, 417, 418, 419, 420 the lysine to be derivatized on the side chain was incorporated as Lys(Alloc).
- Alloc protecting group was removed and the synthesis was completed by condensation of the ⁇ -carboxyglutamic acid residues and the palmitic acid using HBTU and DIPEA as activators.
- the dry peptide-resins were individually treated with 25 mL of the cleavage mixture, 82.5% trifluoroacetic acid (TFA), 5% phenol, 5% thioanisole, 2.5% ethandithiole and 5% water for 1.5 hours at room temperature. Each resin was filtered and the volume of the solution was reduced then added to cold methyl-t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice. Final pellets were dried, resuspended in H 2 O, 20% acetonitrile, and lyophilized.
- TFA trifluoroacetic acid
- the crude peptides were purified by reverse-phase HPLC using preparative Waters RCM Delta-PakTM C 4 cartridges (40 ⁇ 200 mm, 15 ⁇ m) and using as eluents (A) 0.1% TFA in water and (B) 0.1% TFA in acetonitrile.
- Analytical HPLC was performed on a Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 ⁇ 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45° C., using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
- the purified peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- the peptide OXM238 was synthesized from a thiol containing OXM peptide precursor to produce derivatives with the acetamide covalently attached via the thioethers group of the cysteine residue at the C-terminus.
- derivatization of the precursor 50 mg of peptide precursor were dissolved in Tris HCl buffer 0.25 M, EDTA 2 mM, Urea 6M pH 8.3 (conc. 30 mg/mL) and a 10 molar excess of iodoacetamide dissolved in DMSO (conc. 30 mg/mL) was added. After 30 minutes the reaction is complete. The solution is acidified with acetic acid and purified on preparative HPLC.
- Synthesis of C 4 conjugates was as follows.
- the peptides OXM345, OXM355, OXM357, OXM373 were synthesized from the thiol containing OXM peptide precursors respectively to produce derivatives with the cholesterol group covalently attached via the thioethers group of the cysteine at the C-terminus.
- derivatization of the precursor 40 mg of peptide precursor were dissolved in DMSO (conc. 30 mg/mL) and a 2.1 molar excess of cholest-5-en-3-yl 1-bromo-2-oxo-6,9,12,15-tetraoxa-3-azaoctadecan-18-oate dissolved in THF (conc.
- the final peptides were characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 ⁇ 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45° C., using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
- the peptides were characterized by electrospray mass spectrometry on a Micromass.
- the final peptides were characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 ⁇ 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45° C., using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
- the peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- Synthesis of C 9 conjugates was as follows.
- the peptide OXM381 was synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxa12-cholesterol covalently attached via the maleimide thioether bond to the cysteine residue at the C-terminus.
- derivatization of the precursor 25 mg of peptide precursor were dissolved in DMSO (conc.
- Synthesis of C 10 conjugates was as follows.
- the peptides OXM392, 395, 398, 399, 400, and 401 were synthesized from the thiol containing OXM peptide precursors to produce derivatives with the Oxa12-cholesterol covalently attached via a thioether bond to the cysteine residue at the C-terminus.
- derivatization of the precursor 25 mg of peptide precursor were dissolved in DMSO (conc.
- the final peptide was characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 ⁇ 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45° C., using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
- the peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- Synthesis of C 11 conjugates was as follows.
- the peptides OXM412 was synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxa24-cholesterol covalently attached via a thioether bond to the cysteine residue at the C-terminus.
- derivatization of the precursor 25 mg of peptide precursor were dissolved in DMSO (conc.
- DIPEA N,N-diisopropyl-ethylamine
- the final peptide was characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 ⁇ 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45° C., using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
- the peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- Synthesis of C 12 conjugates was as follows.
- the peptides OXM421 was synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxa12-O-cholesterol covalently attached via a thioether bond to the cysteine residue at the C-terminus.
- derivatization of the precursor 25 mg of peptide precursor were dissolved in DMSO (conc.
- the final peptide was characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 ⁇ 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45° C., using H 2 O, 0.1% TEA (A) and CH3CN, 0.1% TFA (B) as solvents.
- the peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- Table 3 shows the structures for the native OXM and OXM analogs that are disclosed herein.
- OXM Peptide Analogs SEQ ID NO. Name Structure 1 OXM HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNNIA (native) 2 OXM8 HS E GTFTSDYSKYLDSRRAQDFVQWLMNTKRNNIA (Q3E) 3 OXM9 HS D GTFTSDYSKYLDSRRAQDFVQWLMNTKRNNIA (Q3D) 4 OXM29 H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNNIA C -CONH 2 5 OXM33 H s QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNNIA C 1 -CONH 2 6 OXM34 H s QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNNIA C 2 -CONH 2 7 OXM35 H s QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNNIA C 3
- C 9 S- ⁇ 1-[46-(cholest-5-en-3-yloxy)-3,43,46-trioxo-7,10,13,16,19,22,25,28,31,34,37,40-dodecaoxa-4,44-diazahexatetracont-1-yl]-2,5-dioxopyrrolidin-3-yl ⁇ -L-cysteine or Cys (mal-oxa 12 -cholesterol)
- C 10 S-[42-(cholest-5-en-3-yloxy)-2,42-dioxo-6,9,12,15,18,21,24,27,30,33,36,39-dodecaoxa-3-azadotetracont-1-yl]-L-cysteine or Cys (oxa1 2 -cholesterol)
- C 11 S-[78-(cholest-5-en-3-yloxy)-2,78-dioxo- 6,9,12,
- GLP-1R/GCGR co-agonists to reduce body weight and food intake and improve glycemic control is demonstrated.
- CHO cells stably expressing mouse or human GLP-1R or GCGR were grown in Iscove's Modified Dulbecco's Medium (IMDM), 10% FBS, 1 mM L-glutamine, penicillin-streptomycin (100 ⁇ /mL) and 750 ⁇ g G418/mL for three-four days before harvesting using Enzymefree Dissociation Media (EFDM, Specialty Media).
- IMDM Iscove's Modified Dulbecco's Medium
- FBS FBS
- 1 mM L-glutamine penicillin-streptomycin
- EFDM Enzymefree Dissociation Media
- OXM and OXM-Q3E were diluted in assay buffer and were incubated with cells in the absence or presence of 10% mouse plasma, respectively, for 30 min at room temperature.
- the assay was terminated with the addition of the LANCE kit Detection buffer as per the manufacturer's instructions.
- the plates were held an additional hour at room temperature, then increasing cAMP levels were detected by a decrease in TR-FRET signal as measured in an EnVision counter (PerkinElmer) in comparison to a standard curve of cAMP as per the manufacturer's instructions. Data were analyzed using the linear and nonlinear regression analysis software, GraphPad Prism.
- Percent inhibition values for each treatment were generated from the AUC data normalized to the saline-challenged controls. Areas under the curve (AUC) for glucose (AUC glucose) was calculated using the trapezoidal method. Statistics. Statistical analysis was done using unpaired 2-tailed Student's t test. P values ⁇ 0.05 were reported as significant.
- 31 P NMR spectroscopy was performed initially to examine the ATP and inorganic phosphate (Pi) levels to assess hepatic viability.
- a 13 C NMR-visible pool of glycogen was then created by the addition of the gluconeogenic substrate [2- 13 C] Pyruvate and ammonium chloride ( ⁇ 7 mM and 1 mM, respectively) to the perfusate, and the amount of 13 C glycogen contained in the liver was monitored in real time via the C1 resonance of the glucosyl units in glycogen.
- GDIS Glucose dependent insulin secretion
- Insulin was measured in aliquots of the incubation buffer by enzymelinked immunosorbent assay with a commercial kit (ALPCO diagnostics, Windham, N.H.). Animal study protocols were reviewed and approved by the Merck Research Laboratories Institutional Animal Care and Use Committee in Rahway, N.J.
- 13 C-NMR spectroscopy was used to non-invasively monitor glycogen and glucose levels in response to acute treatment with novel oxyntomodulin analogs in real time.
- Mice expressing human GCGR were anesthetized (Nembutal IP, 50 mg/kg) at approximately the middle of the dark cycle.
- the portal vein was then cannulated and tied off and the liver was excised.
- the liver was then placed into a 20 mm NMR tube and the initial Krebs solution was exchanged for a Krebs-BSA perfusate, which was recirculated.
- 31 P NMR spectroscopy was performed initially to examine the ATP and inorganic phosphate (Pi) levels in the liver which can be used to assess hepatic viability.
- a 13 C NMR-visible pool of glycogen was then created by the addition of the gluconeogenic substrate [2- 13 C] Pyruvate NH 4 Cl and the amount of glycogen contained in the liver was monitored in real time via the C1 resonance of the glucosyl units in glycogen. After approximately 45 minutes, OXM or an OXM peptide analog was infused and the subsequent response of glycogen levels was used to assess human GCGR activation. The area of the C1 resonance of the glucosyl units in glycogen is plotted over time in FIG. 1 for livers that received either the OXM peptide analogs, 50 pM glucagon, or media.
- native OXM induces glycogenolysis in a dose dependent fashion and induces full glycogenolysis at 1.5 nM and has an approximate EC 50 of 0.5 nM, in comparison, OXM-Q3E induced only about 58% at 300 nM, consistent with its poor GCGR agonist potency.
- mice Given the ability of OXM to stimulate a robust glycogenolysis response, we further examined the in vivo GCGR receptor occupancy of OXM and OXM-Q3E in a competition assay in wild-type mice.
- Three cohorts of mice were dosed with either vehicle (total counts), vehicle and cold glucagon (non-specific binding), or OXM-Q3E subcutaneously. About 15 minutes post dose, 125 I-glucagon was administered intra-venously and about 15 minutes later, the liver was collected and total radioactivity assayed. As shown in FIG. 2 , glucagon (GCG) at 1.5 mpk gave 84% GCGR occupancy, 3 mpk OXM gave 31% GCGR occupancy, and OXM-Q3E gave 0% GCGR occupancy.
- vehicle total counts
- vehicle and cold glucagon non-specific binding
- OXM-Q3E subcutaneously.
- 125 I-glucagon was administered intra-venously and about 15 minutes later, the liver was collected
- OXM, OXM-Q3E Using the matched peptides, OXM, OXM-Q3E, we investigated both acute and chronic pharmacological effects of co-agonism of both receptors in a chronic hyperglycemic clamp and a chronic food intake (FI) and body weight (BW) study (Table 5) and in an acute intraperitoneal glucose tolerance test (IPGTT, FIG. 3 ). While both peptides effectively improved glucose tolerance, OXM-Q3E out-performed native OXM in reducing glucose excursion in both lean and diet induced obesity (DIO) mouse models.
- DIO diet induced obesity
- the native peptide proved superior at reducing food intake and body weight ( ⁇ BW: ⁇ 6% for OXM vs ⁇ 2.4% for OXM-Q3E at 5 mg/kg) in DIO mice, an effect attributed to co-agonism of the GCGR.
- native OXM did not cause increased glucose excursion.
- DIO mice (16 wk on high fat diet) were anesthetized with xylazine and ketamine and catheterized through the right internal jugular vein 3 days before the in vivo studies. 25% glucose was infused and adjusted for the duration of the experiment to maintain hyperglycemia. Due to the short half-life of the peptides (both are rapidly inactivated by dipeptidyl peptidase IV and renally cleared (Zhu et al., J. Biol. Chem. 278: 22418-23, (2003))), vehicle, OXM ( ⁇ 16 ⁇ g/kg/min) and OXM-Q3E ( ⁇ 16 ⁇ g/kg/min) were infused intravenously during the last 60 minutes of the study.
- the venous catheter was used for infusion, and blood samples were collected from the tail vein. Each animal was monitored for food intake and weight gain after surgery to ensure complete recovery.
- Hyperglycemic clamps were performed in conscious, unrestrained, catheterized mice as previously described (Pocai et al., Nature. 43: 1026-31, (2005)). Briefly, plasma glucose was measured by OneTouch glucometer every 10 minutes during the 2 hour period. Twenty-five percent glucose (D-glucose, Sigma) was infused i.v. and the rate was adjusted periodically to clamp the plasma glucose levels ( ⁇ 20 mM).
- OXM ⁇ 16 ⁇ g/kg/min
- OXM-Q3E 16 ⁇ g/kg/min
- vehicle sterile saline
- FIGS. 3A and 3B The results of the hyperglycemic clamp assay are shown in FIGS. 3A and 3B .
- Blood glucose levels were maintained at about 20 mmol/L during the clamp.
- GIR glucose infusion rate
- vehicle-treated mice GIR0-60 55 ⁇ 4 vs 6 ⁇ 2 mg/kg/min; OXM-Q3E vs vehicle; p ⁇ 0.05.
- FIG. 4 shows that both native and OXM peptide anlogs reduce glucose excursion.
- a comparison of the minimal effective dose indicates that OXM-Q3E is about 10-fold more effective at reducing glucose than native peptide (in viva EC 50 0.055 nM and 0.38 nM respectively).
- Native OXM has an in viva half-life (t 1/2 ) of about 8 to 12 minutes in humans, unsuitable for sustained pharmacological therapy. Therefore, we investigated the addition of bulky substituents to the peptide to reduce renal clearance.
- FIG. 5A shows ex vivo measurement of glycogenolysis in perfused liver in the presence of OXM70, OXM110, OXM177, OXM115, and OXM216.
- FIG. 5B shows GGCR occupancy following subcutaneous (s.c.) or intravenous (i.v.) administration of the OXM70, OXM110, OXM177, OXM115, and OXM216 compared to native OXM in a competition assay in wild-type mice.
- FIG. 6 summarizes the acute in vivo efficacy of OXM70 on reducing food intake and body weight in established DIO mice.
- FIG. 7 summarizes the acute in vivo efficacy of OXM110 and OXM177 on reducing food intake and body weight in established DIO mice.
- FIG. 8 summarizes the acute in vivo efficacy of OXM216, OXM115, and OXM177 on reducing food intake and body weight in established DIO mice.
- FIGS. 9A and 9B chronic treatment with the lipidated analogs significantly reduced body weight and food intake in a dose dependent manner throughout the duration of the study.
- FIG. 9C shows the basal glucose over the time period of the study in response to the various peptides.
- the total cycle time was set for 20 minutes, consisting of a reference reading with a 70 second settling time and a 10 second measure period as well as 60 second settle time and 10 second measure time for each of the 16 cages. Results shown in FIGS. 14A and B show that administration of OXM115 dose dependently increased the acute metabolic rate in DIO mice.
- FIG. 15 summarizes the acute in vivo efficacy of OXM303, OXM304, and OXM305 on reducing food intake and body weight in established DIO mice and shows OXM305 as being particularly efficacious at reducing food intake and reducing body weight.
- FIG. 16 summarizes the acute in vivo efficacy of OXM395, OXM399, OXM400, and OXM401 on reducing food intake and body weight in established DIO mice.
- OXM401 is a 0/+ control peptide having the sequence HAibEGTFTSDYSKYLDSRRAQDFVQWLmNTK- ⁇ E ⁇ E-C(Oxa 12 Chol) (SEQ ID NO:99).
- This example shows that lipidated peptides with a pI above 7 based on the OXM sequence stimulate mast cell degranulation while lipidated peptides with a pI of about 5 appears not to stimulate mast degranulation.
- LAD2 cells 50,000 cells/well, 96-well plate
- the degranulation of LAD2 cells was determined by quantification of the ⁇ -hexosaminidase released into the supernatants and in cell lysates after hydrolysis of 4-methylumbelliferyl-N-acetyl- ⁇ -D-glucosaminide. Results are expressed as percentage of ⁇ -hexosaminidase release, calculated as percent of total content.
- Table 1 summarizes the degranulation potency (EC 50 ) of OXM analogues in LAD2 cells. The results suggest that to reduce the likelihood of stimulating degranulation of mast cells, the pI for lipidated based analogues should be around 5.
- OXM >10 OXM115 0.01-0.04 OXM238 1.5 OXM303 0.1 OXM305 0.1 OXM392 0.3 OXM399 0.3 OXM400 >10 OXM401 >10 OXM404 >10 OXM408 >10 OXM409 >10 OXM410 >10 OXM411 >10
- This example presents tables showing the in vitro potencies of various peptide analogs at the human GLP-1 receptor (hGLP-1R) and the human glucagon receptor (hGCGR).
- the in vitro potencies shown in Table 10 or Table 11 were determined from the results of assays that were similar to either the cell-based cAMP assays described herein above (Table 10) or the cell-based cAMP assays described in International Published Application No. WO2008101017, which is incorporated herein in its entirety, in particular the cell-based cAMP assays described therein (Table 11).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Diabetes (AREA)
- Endocrinology (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Hematology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Obesity (AREA)
- Child & Adolescent Psychology (AREA)
- Emergency Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
- Physical Water Treatments (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US13/202,524 US20120165503A1 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
PCT/US2009/034448 WO2010096052A1 (en) | 2009-02-19 | 2009-02-19 | Oxyntomodulin analogs |
USPCTUS2009034448 | 2009-02-19 | ||
PCT/US2009/068678 WO2010096142A1 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
US13/202,524 US20120165503A1 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
Publications (1)
Publication Number | Publication Date |
---|---|
US20120165503A1 true US20120165503A1 (en) | 2012-06-28 |
Family
ID=42634127
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/202,524 Abandoned US20120165503A1 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
US14/686,760 Expired - Fee Related US9593155B2 (en) | 2009-02-19 | 2015-04-14 | Oxyntomodulin analogs |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/686,760 Expired - Fee Related US9593155B2 (en) | 2009-02-19 | 2015-04-14 | Oxyntomodulin analogs |
Country Status (23)
Cited By (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20120329708A1 (en) * | 2011-06-22 | 2012-12-27 | Indiana University Research And Technology Corporation | Glucagon/glp-1 receptor co-agonists |
WO2014049610A2 (en) | 2012-09-26 | 2014-04-03 | Cadila Healthcare Limited | Peptides as gip, glp-1 and glucagon receptors triple-agonist |
US8969294B2 (en) | 2008-06-17 | 2015-03-03 | Istituto Di Recerche Di Biologia Molecolare P. Angeletti S.R.L. | Glucagon/GLP-1 receptor co-agonists |
EP2916860A4 (en) * | 2012-11-06 | 2016-06-22 | Hanmi Pharm Ind Co Ltd | COMPOSITION FOR THE TREATMENT OF DIABETES OR OBESITAS-CONDITIONING DIABETES WITH AN OXYNTOMODULIN ANALOG |
WO2017074798A3 (en) * | 2015-10-27 | 2017-05-26 | Merck Sharp & Dohme Corp. | Long-acting co-agonists of the glucagon and glp-1 receptors |
US9724420B2 (en) | 2012-11-06 | 2017-08-08 | Hanmi Pharm. Co., Ltd. | Liquid formulation of protein conjugate comprising an oxyntomodulin derivative covalently linked to a non-peptidyl polymer to an immunoglobulin FC region |
US9765131B2 (en) | 2011-06-10 | 2017-09-19 | Hanmi Science Co., Ltd. | Oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same |
US9790263B2 (en) | 2009-06-16 | 2017-10-17 | Indiana University Research And Technology Corporation | GIP receptor-active glucagon compounds |
US9901621B2 (en) | 2012-07-25 | 2018-02-27 | Hanmi Pharm. Co., Ltd. | Composition for treating hyperlipidemia comprising oxyntomodulin derivative |
US10233230B2 (en) | 2014-09-16 | 2019-03-19 | Hanmi Pharm. Co., Ltd. | Use of a long acting GLP-1/glucagon receptor dual agonist for the treatment of non-alcoholic fatty liver disease |
US10513550B2 (en) | 2014-12-30 | 2019-12-24 | Hanmi Pharm Co., Ltd | Glucagon derivatives |
US10696725B2 (en) | 2015-06-30 | 2020-06-30 | Hanmi Pharm. Co., Ltd. | Glucagon derivative and a composition comprising a long acting conjugate of the same |
US10981967B2 (en) | 2015-12-31 | 2021-04-20 | Hanmi Pharm. Co., Ltd. | Long-acting conjugate of triple glucagon/GLP-1/GIP receptor agonist |
US11135271B2 (en) | 2014-12-30 | 2021-10-05 | Hanmi Pharm. Co., Ltd. | Glucagon derivatives with improved stability |
US11142559B2 (en) | 2016-06-29 | 2021-10-12 | Hanmi Pharm. Co., Ltd. | Glucagon derivative, conjugate thereof, composition comprising same, and therapeutic use thereof |
US11872283B2 (en) | 2011-06-17 | 2024-01-16 | Hanmi Science Co., Ltd | Conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof |
Families Citing this family (82)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8338368B2 (en) | 2005-11-07 | 2012-12-25 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting physiological solubility and stability |
CA2674354A1 (en) | 2007-01-05 | 2008-07-17 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting enhanced solubility in physiological ph buffers |
EA017849B1 (ru) | 2007-02-15 | 2013-03-29 | Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн | Соагонисты глюкагоновых/glp-1-рецепторов |
WO2009058734A1 (en) | 2007-10-30 | 2009-05-07 | Indiana University Research And Technology Corporation | Compounds exhibiting glucagon antagonist and glp-1 agonist activity |
ES2509883T3 (es) | 2007-10-30 | 2014-10-20 | Indiana University Research And Technology Corporation | Antagonistas de glucagón |
EP2300035B1 (en) | 2008-06-17 | 2015-08-12 | Indiana University Research and Technology Corporation | Gip-based mixed agonists for treatment of metabolic disorders and obesity |
WO2009155257A1 (en) | 2008-06-17 | 2009-12-23 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting enhanced solubility and stability physiological ph buffers |
CN102325539A (zh) | 2008-12-19 | 2012-01-18 | 印第安纳大学研究及科技有限公司 | 基于酰胺的胰高血糖素超家族肽前药 |
WO2010096052A1 (en) | 2009-02-19 | 2010-08-26 | Merck Sharp & Dohme Corp. | Oxyntomodulin analogs |
CA2767792A1 (en) | 2009-07-13 | 2011-01-20 | Zealand Pharma A/S | Acylated glucagon analogues |
US8703701B2 (en) | 2009-12-18 | 2014-04-22 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
AR079344A1 (es) | 2009-12-22 | 2012-01-18 | Lilly Co Eli | Analogo peptidico de oxintomodulina, composicion farmaceutica que lo comprende y uso para preparar un medicamento util para tratar diabetes no insulinodependiente y/u obesidad |
AR079345A1 (es) | 2009-12-22 | 2012-01-18 | Lilly Co Eli | Analogo peptidico de oxintomodulina |
IN2012DN06437A (enrdf_load_html_response) | 2010-01-27 | 2015-10-09 | Univ Indiana Res & Tech Corp | |
EP2563808B1 (en) | 2010-04-27 | 2016-12-07 | Zealand Pharma A/S | Peptide conjugates of glp-1 receptor agonists and gastrin and their use |
CA2797089A1 (en) | 2010-05-13 | 2011-11-17 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting g protein-coupled receptor activity |
JP6121323B2 (ja) | 2010-05-13 | 2017-05-10 | インディアナ ユニバーシティー リサーチ アンド テクノロジー コーポレーションIndiana University Research And Technology Corporation | 核内ホルモン受容体の活性を示すグルカゴンスーパーファミリーのペプチド |
MX2012014576A (es) | 2010-06-24 | 2013-02-21 | Univ Indiana Res & Tech Corp | Profarmacos de peptido de la superfamilia de glucagon basado en amida. |
JP6086067B2 (ja) | 2010-12-22 | 2017-03-01 | インディアナ ユニヴァーシティ リサーチ アンド テクノロジー コーポレイション | Gipレセプター活性を示すグルカゴンアナローグ |
WO2012150503A2 (en) * | 2011-05-03 | 2012-11-08 | Zealand Pharma A/S | Glu-glp-1 dual agonist signaling-selective compounds |
EP2707713A2 (en) * | 2011-05-10 | 2014-03-19 | Zealand Pharma A/S | Glu-glp-1 dual agonist signaling-selective compounds |
BR112013032717A2 (pt) | 2011-06-22 | 2017-01-24 | Univ Indiana Res & Tech Corp | coagonistas do receptor de glucagon/glp-1 |
JP6396211B2 (ja) | 2011-07-04 | 2018-09-26 | インペリアル・イノベイションズ・リミテッド | 新規化合物及び摂食行動に対するそれらの効果 |
US9259477B2 (en) | 2011-11-03 | 2016-02-16 | Zealand Pharma A/S | GLP-1 receptor agonist peptide gastrin conjugates |
MX2014003579A (es) * | 2011-11-17 | 2015-04-10 | Univ Indiana Res & Tech Corp | Peptidos de la superfamilia de glucagon que presentan actividad del receptor de glucocorticoide. |
EA201590011A1 (ru) | 2012-06-14 | 2015-05-29 | Санофи | Пептидные аналоги эксендина-4 |
AR091477A1 (es) | 2012-06-21 | 2015-02-04 | Univ Indiana Res & Tech Corp | Analogos de glucagon que presentan actividad de receptor de gip |
EP2875043B1 (en) | 2012-07-23 | 2016-12-21 | Zealand Pharma A/S | Glucagon analogues |
TWI608013B (zh) | 2012-09-17 | 2017-12-11 | 西蘭製藥公司 | 升糖素類似物 |
UA116217C2 (uk) | 2012-10-09 | 2018-02-26 | Санофі | Пептидна сполука як подвійний агоніст рецепторів glp1-1 та глюкагону |
EP2935318A1 (en) * | 2012-12-19 | 2015-10-28 | Novo Nordisk A/S | Novel glp-1 receptor agonists with cholesterol efflux activity |
CA2895875A1 (en) | 2012-12-21 | 2014-06-26 | Sanofi | Exendin-4 derivatives |
HK1219477A1 (zh) | 2013-03-21 | 2017-04-07 | Sanofi-Aventis Deutschland Gmbh | 合成含有乙内酰脲的肽产物 |
HUE033371T2 (en) | 2013-03-21 | 2017-11-28 | Sanofi Aventis Deutschland | Process for the preparation of peptide products containing a ring imide |
AR095986A1 (es) | 2013-04-03 | 2015-11-25 | Sanofi Sa | Proteínas modificadas que regulan glucosa en sangre con perfil alterado de actividad farmacológica y preparación de las mismas |
US10286078B2 (en) | 2013-09-13 | 2019-05-14 | The California Institute For Biomedical Research | Modified therapeutic agents and compositions thereof |
JP6538665B2 (ja) | 2013-10-17 | 2019-07-03 | ジーランド ファーマ アクティーゼルスカブ | アシル化グルカゴン類似体 |
US9988429B2 (en) | 2013-10-17 | 2018-06-05 | Zealand Pharma A/S | Glucagon analogues |
AU2014345569B2 (en) | 2013-11-06 | 2020-08-13 | Zealand Pharma A/S | GIP-GLP-1 dual agonist compounds and methods |
EA035688B1 (ru) | 2013-11-06 | 2020-07-27 | Зилэнд Фарма А/С | Соединения, которые представляют собой тройные агонисты глюкагона, glp-1 и gip |
WO2015086730A1 (en) | 2013-12-13 | 2015-06-18 | Sanofi | Non-acylated exendin-4 peptide analogues |
TW201609800A (zh) | 2013-12-13 | 2016-03-16 | 賽諾菲公司 | 做為雙重glp-1/升糖素受體促效劑之艾塞那肽-4胜肽類似物 |
TW201609799A (zh) | 2013-12-13 | 2016-03-16 | 賽諾菲公司 | 雙重glp-1/gip受體促效劑 |
EP3080150B1 (en) | 2013-12-13 | 2018-08-01 | Sanofi | Exendin-4 peptide analogues as dual glp-1/gip receptor agonists |
WO2015086733A1 (en) | 2013-12-13 | 2015-06-18 | Sanofi | Dual glp-1/glucagon receptor agonists |
EP4212180A1 (en) | 2013-12-18 | 2023-07-19 | The Scripps Research Institute | Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof |
EP3107560A1 (en) * | 2014-02-18 | 2016-12-28 | Novo Nordisk A/S | Stable glucagon analogues and use for treatment of hypoglycaemia |
TW201625668A (zh) | 2014-04-07 | 2016-07-16 | 賽諾菲公司 | 作為胜肽性雙重glp-1/昇糖素受體激動劑之艾塞那肽-4衍生物 |
TW201625669A (zh) | 2014-04-07 | 2016-07-16 | 賽諾菲公司 | 衍生自艾塞那肽-4(Exendin-4)之肽類雙重GLP-1/升糖素受體促效劑 |
TW201625670A (zh) | 2014-04-07 | 2016-07-16 | 賽諾菲公司 | 衍生自exendin-4之雙重glp-1/升糖素受體促效劑 |
US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
CN104926934B (zh) * | 2014-09-23 | 2016-11-09 | 蒋先兴 | 胃泌酸调节素类似物 |
TW201625672A (zh) | 2014-10-24 | 2016-07-16 | 默沙東藥廠 | 升糖素及glp-1受體之共促效劑 |
AU2015340586B2 (en) | 2014-10-29 | 2020-04-30 | Zealand Pharma A/S | GIP agonist compounds and methods |
AU2016247499B2 (en) | 2015-04-16 | 2020-09-03 | Zealand Pharma A/S | Acylated glucagon analogue |
AR105319A1 (es) | 2015-06-05 | 2017-09-27 | Sanofi Sa | Profármacos que comprenden un conjugado agonista dual de glp-1 / glucagón conector ácido hialurónico |
WO2016198628A1 (en) | 2015-06-12 | 2016-12-15 | Sanofi | Non-acylated exendin-4 derivatives as dual glp-1/glucagon receptor agonists |
WO2016198624A1 (en) | 2015-06-12 | 2016-12-15 | Sanofi | Exendin-4 derivatives as trigonal glp-1/glucagon/gip receptor agonists |
AR105284A1 (es) | 2015-07-10 | 2017-09-20 | Sanofi Sa | Derivados de exendina-4 como agonistas peptídicos duales específicos de los receptores de glp-1 / glucagón |
EP3359191A4 (en) | 2015-10-05 | 2019-05-29 | Merck Sharp & Dohme Corp. | ANTIBODY PEPTIDE CONJUGATES WITH AGONISTEACTIVITY ON GLUCAGON RECEPTORS AND GLUCAGON-LIKE PEPTIDE-1 |
EP3359194A4 (en) | 2015-10-06 | 2019-04-24 | Merck Sharp & Dohme Corp. | ANTIBODY-ACTIVE CONJUGATE FOR ANTI-INFLAMMATORY APPLICATIONS |
EP3394091A4 (en) * | 2015-12-09 | 2019-12-18 | Merck Sharp & Dohme Corp. | CO-AGONISTS OF GLUCAGON AND GLP-1 RECEPTORS |
EP3407916B1 (en) | 2016-01-29 | 2023-12-20 | Merck Sharp & Dohme LLC | Phosphonate linkers and their use to facilitate cellular retention of compounds |
AR110299A1 (es) | 2016-12-02 | 2019-03-13 | Sanofi Sa | Conjugados que comprenden un agonista dual de glp-1 / glucagón, un conector y ácido hialurónico |
AU2017371516C1 (en) | 2016-12-09 | 2021-09-02 | Zealand Pharma A/S | Acylated GLP-1/GLP-2 dual agonists |
CN108299553B (zh) * | 2017-01-13 | 2021-07-16 | 博瑞生物医药(苏州)股份有限公司 | 胃泌酸调节素修饰物 |
CN106986924A (zh) * | 2017-03-23 | 2017-07-28 | 中国药科大学 | 胃泌酸调节素(oxm)类似物及其应用 |
CA3073011C (en) * | 2017-08-16 | 2023-06-13 | Dong-A St Co., Ltd. | Acylated oxyntomodulin peptide analog |
EP3700550A4 (en) | 2017-09-25 | 2022-02-23 | Merck Sharp & Dohme Corp. | LONG-ACTING GLUCAGON AND GLP-1 RECEPTOR CO-AGONISTS |
CN109836504B (zh) * | 2017-11-24 | 2022-08-02 | 浙江道尔生物科技有限公司 | 一种治疗代谢疾病的多结构域活性蛋白 |
CN115304666B (zh) * | 2017-11-24 | 2025-09-19 | 浙江道尔生物科技有限公司 | 一种治疗代谢疾病的胰高血糖素类似物 |
CN111171135B (zh) * | 2018-11-12 | 2023-04-07 | 天津药物研究院有限公司 | 具有双重受体激动作用的胰高血糖素衍生肽及其用途 |
MX2021007444A (es) | 2018-12-21 | 2021-08-05 | Jiangsu Hengrui Medicine Co | Proteina biespecifica. |
US11471512B2 (en) | 2019-03-01 | 2022-10-18 | Merck Sharp & Dohme Llc | Pharmaceutical compositions of a peptide |
CN110684082B (zh) * | 2019-10-08 | 2021-12-10 | 江苏诺泰澳赛诺生物制药股份有限公司 | Gip和glp-1双激动多肽化合物及药学上可接受的盐与用途 |
EP3842061A1 (en) | 2019-12-23 | 2021-06-30 | Merck Sharp & Dohme Corp. | Stapled triazole co-agonists of the glucagon and glp-1 receptors |
EP3842060A1 (en) | 2019-12-23 | 2021-06-30 | Merck Sharp & Dohme Corp. | Stapled lactam co-agonists of the glucagon and glp-1 receptors |
EP3842449A1 (en) | 2019-12-23 | 2021-06-30 | Merck Sharp & Dohme Corp. | Stapled olefin co-agonists of the glucagon and glp-1 receptors |
US20230174608A1 (en) * | 2020-05-09 | 2023-06-08 | Tianjin Institute Of Pharmaceutical Research Co., Ltd. | Polypeptide Derivative Having Dual Receptor Agonistic Action and Use Thereof |
CN112898405B (zh) * | 2021-01-22 | 2023-02-28 | 深圳市图微安创科技开发有限公司 | 多肽化合物及其在预防或治疗糖尿病或糖尿病并发症中的应用 |
MX2023014771A (es) | 2021-06-09 | 2024-03-19 | Scripps Research Inst | Conjugados peptidicos duales gip/glp-1 de accion prolongada y metodos de uso. |
CN119930789A (zh) * | 2023-11-06 | 2025-05-06 | 成都奥达生物科技有限公司 | 一种gcg激动剂化合物 |
Family Cites Families (15)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4275152A (en) * | 1977-02-03 | 1981-06-23 | Eastman Kodak Company | Hydrolysis of protein-bound cholesterol esters |
US7238663B2 (en) * | 2001-08-28 | 2007-07-03 | Eli Lilly And Company | Pre-mixes of GLP-1 and basal insulin |
EP1585956A4 (en) | 2001-09-24 | 2009-10-21 | Univ Oregon Health & Science | EVALUATIONS OF NEURONS IN THE ARQUE CORE FOR THE SCREENING OF AGENTS OF MODIFICATION OF FOOD BEHAVIOR |
EP1474163A2 (en) * | 2002-01-10 | 2004-11-10 | Imperial College Innovations Limited | Modification of feeding behavior |
WO2003103572A2 (en) * | 2002-06-04 | 2003-12-18 | Eli Lilly And Company | Modified glucagon-like peptide-1 analogs |
US7364875B2 (en) * | 2003-10-30 | 2008-04-29 | Cresent Innovations, Inc. | Method for producing medical and commercial grade poly-gamma-glutamic acid of high molecular weight |
US20080318837A1 (en) * | 2003-12-26 | 2008-12-25 | Nastech Pharmaceutical Company Inc. | Pharmaceutical Formation For Increased Epithelial Permeability of Glucose-Regulating Peptide |
KR101349808B1 (ko) * | 2005-06-13 | 2014-02-13 | 임페리얼 이노베이션스 리미티드 | 섭취행동에 관한 신규 화합물들 및 이들의 효능 |
CA2638800A1 (en) | 2006-02-22 | 2007-09-07 | Merck & Co., Inc. | Oxyntomodulin derivatives |
CA2663083A1 (en) * | 2006-09-08 | 2008-03-13 | Ambrx, Inc. | Modified human plasma polypeptide or fc scaffolds and their uses |
JP5231732B2 (ja) | 2006-10-26 | 2013-07-10 | 株式会社東芝 | 冷却装置、およびこれを備えた電子機器 |
EA017849B1 (ru) * | 2007-02-15 | 2013-03-29 | Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн | Соагонисты глюкагоновых/glp-1-рецепторов |
TWI474832B (zh) | 2008-06-17 | 2015-03-01 | Univ Indiana Res & Tech Corp | 胰高血糖素/glp-1受體共同激動劑 |
CN102325539A (zh) | 2008-12-19 | 2012-01-18 | 印第安纳大学研究及科技有限公司 | 基于酰胺的胰高血糖素超家族肽前药 |
WO2010096052A1 (en) | 2009-02-19 | 2010-08-26 | Merck Sharp & Dohme Corp. | Oxyntomodulin analogs |
-
2009
- 2009-02-19 WO PCT/US2009/034448 patent/WO2010096052A1/en active Application Filing
- 2009-12-18 BR BRPI0924307A patent/BRPI0924307B8/pt not_active IP Right Cessation
- 2009-12-18 PE PE2011001525A patent/PE20120621A1/es not_active Application Discontinuation
- 2009-12-18 CN CN200980158734.XA patent/CN102573872B/zh not_active Expired - Fee Related
- 2009-12-18 EP EP09840594.7A patent/EP2398483B1/en active Active
- 2009-12-18 WO PCT/US2009/068678 patent/WO2010096142A1/en active Application Filing
- 2009-12-18 US US13/202,524 patent/US20120165503A1/en not_active Abandoned
- 2009-12-18 CA CA2754350A patent/CA2754350C/en not_active Expired - Fee Related
- 2009-12-18 AU AU2009340439A patent/AU2009340439B2/en not_active Ceased
- 2009-12-18 PT PT98405947T patent/PT2398483E/pt unknown
- 2009-12-18 JP JP2011551052A patent/JP5756961B2/ja not_active Expired - Fee Related
- 2009-12-18 HR HRP20141215AT patent/HRP20141215T1/hr unknown
- 2009-12-18 DK DK09840594.7T patent/DK2398483T3/da active
- 2009-12-18 PL PL09840594T patent/PL2398483T3/pl unknown
- 2009-12-18 KR KR1020117021805A patent/KR101634139B1/ko not_active Expired - Fee Related
- 2009-12-18 ES ES09840594.7T patent/ES2524477T3/es active Active
- 2009-12-18 RU RU2011134596/04A patent/RU2542362C2/ru active
- 2009-12-18 SI SI200931091T patent/SI2398483T1/sl unknown
- 2009-12-18 SG SG2011060183A patent/SG173791A1/en unknown
- 2009-12-18 MX MX2011008717A patent/MX2011008717A/es active IP Right Grant
-
2011
- 2011-08-17 ZA ZA2011/06051A patent/ZA201106051B/en unknown
- 2011-08-18 IL IL214729A patent/IL214729A/en active IP Right Grant
- 2011-08-19 CL CL2011002036A patent/CL2011002036A1/es unknown
-
2014
- 2014-12-18 CY CY20141101064T patent/CY1116917T1/el unknown
-
2015
- 2015-04-14 US US14/686,760 patent/US9593155B2/en not_active Expired - Fee Related
Cited By (35)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8969294B2 (en) | 2008-06-17 | 2015-03-03 | Istituto Di Recerche Di Biologia Molecolare P. Angeletti S.R.L. | Glucagon/GLP-1 receptor co-agonists |
US9790263B2 (en) | 2009-06-16 | 2017-10-17 | Indiana University Research And Technology Corporation | GIP receptor-active glucagon compounds |
US9765131B2 (en) | 2011-06-10 | 2017-09-19 | Hanmi Science Co., Ltd. | Oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same |
US10442848B2 (en) | 2011-06-10 | 2019-10-15 | Hanmi Science Co., Ltd. | Oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same |
US11872283B2 (en) | 2011-06-17 | 2024-01-16 | Hanmi Science Co., Ltd | Conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof |
US9758562B2 (en) * | 2011-06-22 | 2017-09-12 | Indiana University and Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US10174093B2 (en) | 2011-06-22 | 2019-01-08 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US10730923B2 (en) | 2011-06-22 | 2020-08-04 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US20120329708A1 (en) * | 2011-06-22 | 2012-12-27 | Indiana University Research And Technology Corporation | Glucagon/glp-1 receptor co-agonists |
US9156902B2 (en) * | 2011-06-22 | 2015-10-13 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
US20150376256A1 (en) * | 2011-06-22 | 2015-12-31 | Indiana University Research And Technology Corporation | Glucagon/glp-1 receptor co-agonists |
US9901621B2 (en) | 2012-07-25 | 2018-02-27 | Hanmi Pharm. Co., Ltd. | Composition for treating hyperlipidemia comprising oxyntomodulin derivative |
US10493132B2 (en) | 2012-07-25 | 2019-12-03 | Hanmi Pharm. Co., Ltd. | Composition for treating hyperlipidemia comprising oxyntomodulin derivative |
WO2014049610A2 (en) | 2012-09-26 | 2014-04-03 | Cadila Healthcare Limited | Peptides as gip, glp-1 and glucagon receptors triple-agonist |
EP3679944A1 (en) * | 2012-11-06 | 2020-07-15 | Hanmi Pharm. Co., Ltd. | A composition for treating diabetes comprising oxyntomodulin analog |
US11071785B2 (en) | 2012-11-06 | 2021-07-27 | Hanmi Pharm. Co., Ltd. | Liquid formulation of long-lasting protein conjugate comprising the oxyntomodulin and an immunoglobulin Fc region |
US10279041B2 (en) | 2012-11-06 | 2019-05-07 | Hanmi Pharm Co. Ltd. | Liquid formulation of long-lasting protein conjugate comprising the oxyntomodulin and an immunoglobulin fragment |
EP2916860A4 (en) * | 2012-11-06 | 2016-06-22 | Hanmi Pharm Ind Co Ltd | COMPOSITION FOR THE TREATMENT OF DIABETES OR OBESITAS-CONDITIONING DIABETES WITH AN OXYNTOMODULIN ANALOG |
US9724420B2 (en) | 2012-11-06 | 2017-08-08 | Hanmi Pharm. Co., Ltd. | Liquid formulation of protein conjugate comprising an oxyntomodulin derivative covalently linked to a non-peptidyl polymer to an immunoglobulin FC region |
US10550168B2 (en) | 2012-11-06 | 2020-02-04 | Hanmi Pharm. Co., Ltd. | Composition for treating diabetes or diabesity comprising oxyntomodulin analog |
US10435459B2 (en) | 2014-09-16 | 2019-10-08 | Hanmi Pharm. Co., Ltd. | Use of a long acting GLP-1/glucagon receptor dual agonist for the treatment of non-alcoholic fatty liver disease |
US10233230B2 (en) | 2014-09-16 | 2019-03-19 | Hanmi Pharm. Co., Ltd. | Use of a long acting GLP-1/glucagon receptor dual agonist for the treatment of non-alcoholic fatty liver disease |
US12018060B2 (en) | 2014-12-30 | 2024-06-25 | Hanmi Pharm Co., Ltd. | Glucagon derivatives |
US10513550B2 (en) | 2014-12-30 | 2019-12-24 | Hanmi Pharm Co., Ltd | Glucagon derivatives |
US11135271B2 (en) | 2014-12-30 | 2021-10-05 | Hanmi Pharm. Co., Ltd. | Glucagon derivatives with improved stability |
US11254724B2 (en) | 2014-12-30 | 2022-02-22 | Hanmi Pharm. Co., Ltd. | Glucagon derivatives |
US10696725B2 (en) | 2015-06-30 | 2020-06-30 | Hanmi Pharm. Co., Ltd. | Glucagon derivative and a composition comprising a long acting conjugate of the same |
US11261227B2 (en) | 2015-06-30 | 2022-03-01 | Hanmi Pharm. Co., Ltd. | Glucagon derivative and a composition comprising a long acting conjugate of the same |
US11667688B2 (en) | 2015-06-30 | 2023-06-06 | Hanmi Pharm. Co., Ltd. | Glucagon derivative and a composition comprising a long acting conjugate of the same |
US11492385B2 (en) | 2015-10-27 | 2022-11-08 | Merck Sharp & Dohme Llc | Long-acting co-agonists of the glucagon and GLP-1 receptors |
US10793615B2 (en) | 2015-10-27 | 2020-10-06 | Merck Sharp & Dohme Corp. | Long-acting co-agonists of the glucagon and GLP-1 receptors |
WO2017074798A3 (en) * | 2015-10-27 | 2017-05-26 | Merck Sharp & Dohme Corp. | Long-acting co-agonists of the glucagon and glp-1 receptors |
US10981967B2 (en) | 2015-12-31 | 2021-04-20 | Hanmi Pharm. Co., Ltd. | Long-acting conjugate of triple glucagon/GLP-1/GIP receptor agonist |
US11332508B2 (en) | 2015-12-31 | 2022-05-17 | Hanmi Pharm. Co., Ltd. | Triple glucagon/GLP-1/GIP receptor agonist |
US11142559B2 (en) | 2016-06-29 | 2021-10-12 | Hanmi Pharm. Co., Ltd. | Glucagon derivative, conjugate thereof, composition comprising same, and therapeutic use thereof |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9593155B2 (en) | Oxyntomodulin analogs | |
EP1999143B1 (en) | Neuromedin u receptor agonists and uses thereof | |
US20110301079A1 (en) | Neuromedin u receptor agonists and uses thereof | |
US20090104210A1 (en) | Peptide compounds for treating obesity and insulin resistance | |
WO2011005611A1 (en) | Neuromedin u receptor agonists and uses thereof | |
US11773150B2 (en) | Antibody peptide conjugates that have agonist activity at both the glucagon and glucagon-like peptide 1 receptors | |
WO2010138343A1 (en) | Neuromedin u receptor agonists | |
BRPI1001307B1 (pt) | injeção de oxigênio em bacia de flotação do processo de remoção de substâncias poluentes em cursos d'água | |
HK1165333B (en) | Oxyntomodulin analogs | |
US20100143383A1 (en) | Oxgr1 agonists for use in therapies for metabolic disorders |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: INDIANA UNIVERSITY RESEARCH AND TECHNOLOGY CORPORA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:DIMARCHI, RICHARD;WARD, BRIAN;REEL/FRAME:027806/0676 Effective date: 20120225 |
|
AS | Assignment |
Owner name: ISTITUTO DI RICERCHE DI BIOLOGIA P. ANGELETTI S.R. Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BIANCHI, ELISABETTA;INGALLINELLA, PAOLO;PESSI, ANTONELLO;AND OTHERS;SIGNING DATES FROM 20120120 TO 20120130;REEL/FRAME:027948/0413 Owner name: MERCK SHARP & DOHME CORP., NEW JERSEY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:EIERMANN, GEORGE J.;METZGER, JOSEPH J.;POCAI, ALESSANDRO;AND OTHERS;SIGNING DATES FROM 20111208 TO 20111221;REEL/FRAME:027947/0481 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO PAY ISSUE FEE |
|
AS | Assignment |
Owner name: MSD ITALIA S.R.L., ITALY Free format text: MERGER AND CHANGE OF NAME;ASSIGNORS:ISTITUTO DI RECERCHE DI BIOLOGIA MOLECOLARE P. ANGELETTI S.R.L.;MSD ITALIA S.R.L.;REEL/FRAME:038663/0032 Effective date: 20121113 |