DK63479A - Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrer - Google Patents
Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrerInfo
- Publication number
- DK63479A DK63479A DK63479A DK63479A DK63479A DK 63479 A DK63479 A DK 63479A DK 63479 A DK63479 A DK 63479A DK 63479 A DK63479 A DK 63479A DK 63479 A DK63479 A DK 63479A
- Authority
- DK
- Denmark
- Prior art keywords
- dehydrocyclic
- preparing
- acid derivatives
- imino acid
- imino
- Prior art date
Links
- 101000740162 Homo sapiens Sodium- and chloride-dependent transporter XTRP3 Proteins 0.000 title 1
- -1 IMINO Chemical class 0.000 title 1
- 102100037189 Sodium- and chloride-dependent transporter XTRP3 Human genes 0.000 title 1
- 239000002253 acid Substances 0.000 title 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D211/00—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings
- C07D211/04—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D211/68—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member
- C07D211/72—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member with hetero atoms or with carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, directly attached to ring carbon atoms
- C07D211/78—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C327/00—Thiocarboxylic acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D207/00—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom
- C07D207/02—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D207/18—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member
- C07D207/22—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- General Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Hydrogenated Pyridines (AREA)
- Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Pyrrole Compounds (AREA)
- Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US05/878,144 US4129566A (en) | 1978-02-15 | 1978-02-15 | Derivatives of dehydrocyclicimino acids |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| DK63479A true DK63479A (da) | 1979-08-16 |
Family
ID=25371470
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DK63479A DK63479A (da) | 1978-02-15 | 1979-02-14 | Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrer |
Country Status (35)
Families Citing this family (58)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4690938A (en) * | 1979-08-14 | 1987-09-01 | University Of Miami | Anti-hypertensive agents |
| ZA794723B (en) * | 1978-09-11 | 1980-08-27 | Univ Miami | Anti-hypertensive agents |
| US4690937A (en) * | 1979-08-14 | 1987-09-01 | University Of Miami | Anti-hypertensive agents |
| US4698355A (en) * | 1979-08-14 | 1987-10-06 | University Of Miami | Anti-hypertensive agents |
| US4698356A (en) * | 1979-08-14 | 1987-10-06 | University Of Miami | Anti-hypertensive agents |
| US4695577A (en) * | 1979-08-14 | 1987-09-22 | University Of Miami | Anti-hypertensive agents |
| US4690940A (en) * | 1979-08-14 | 1987-09-01 | University Of Miami | Anti-hypertensive agents |
| US4690939A (en) * | 1979-08-14 | 1987-09-01 | University Of Miami | Anti-hypertensive agents |
| US4198515A (en) * | 1978-12-08 | 1980-04-15 | E. R. Squibb & Sons, Inc. | Mercaptoacyl derivatives of 4,5-dihydro-1H-pyrrole-2-carboxylic acids and 1,4,5,6-tetrahydropyridine-2-carboxylic acids |
| US4217458A (en) * | 1978-12-08 | 1980-08-12 | E. R. Squibb & Sons, Inc. | Acylmercaptoacyl derivatives of 4,5-dihydro-1H-pyrrole-2-carboxylic acids and 1,4,5,6-tetrahydropyridine-2-carboxylic acids |
| US4220791A (en) * | 1979-03-08 | 1980-09-02 | E. R. Squibb & Sons, Inc. | Mercaptoacylpyrazolidinone carboxylic acid derivatives |
| US4211786A (en) * | 1979-03-08 | 1980-07-08 | E. R. Squibb & Sons, Inc. | Mercaptoacyldihydropyrazole carboxylic acid derivatives |
| FR2455585A1 (fr) * | 1979-05-04 | 1980-11-28 | Ono Pharmaceutical Co | Derives d'oxoaminoacides, procede de fabrication et composition pharmaceutique |
| US4234489A (en) * | 1979-06-25 | 1980-11-18 | E. R. Squibb & Sons, Inc. | Pyroglutamic acid derivatives and analogs |
| US4221912A (en) * | 1979-08-22 | 1980-09-09 | E. R. Squibb & Sons, Inc. | Dithio derivatives of 4,5-dihydro-1H-pyrrole-2-carboxylic acids and 1,4,5,6-tetrahydropyridine-2-carboxylic acids |
| US4221804A (en) * | 1979-09-27 | 1980-09-09 | Rovnyak George C | Mercaptoacyldihydropyrazole carboxylic acid derivatives |
| US4291040A (en) * | 1979-10-22 | 1981-09-22 | E. R. Squibb & Sons, Inc. | Mercaptoacyl derivatives of 4-disubstituted prolines and 4-substituted dehydroprolines |
| US4356182A (en) * | 1979-10-22 | 1982-10-26 | E. R. Squibb & Sons, Inc. | Mercaptoacyl derivatives of 4-disubstituted prolines |
| US4266065A (en) * | 1980-04-14 | 1981-05-05 | E. R. Squibb & Sons, Inc. | Mercaptoacyldihydropyrazole carboxylic acid derivatives |
| US4284561A (en) * | 1979-12-03 | 1981-08-18 | E. R. Squibb & Sons, Inc. | Hydroxamic acid derivatives of mercaptoacyl amino acids |
| US4308392A (en) * | 1979-12-03 | 1981-12-29 | E. R. Squibb & Sons, Inc. | Hydroxamic acid derivatives of mercaptoacyl amino acids |
| IE50839B1 (en) * | 1980-02-26 | 1986-07-23 | Wyeth John & Brother Ltd | Novel processes for preparing proline derivatives and analogous compounds |
| US4734420A (en) * | 1980-03-05 | 1988-03-29 | University Of Miami | Anti-hypertensive agents |
| US4690936A (en) * | 1980-03-05 | 1987-09-01 | University Of Miami | Anti-hypertensive agents |
| US4692458A (en) * | 1980-03-05 | 1987-09-08 | University Of Miami | Anti-hypertensive agents |
| US4350704A (en) * | 1980-10-06 | 1982-09-21 | Warner-Lambert Company | Substituted acyl derivatives of octahydro-1H-indole-2-carboxylic acids |
| US4284624A (en) * | 1980-05-02 | 1981-08-18 | E. R. Squibb & Sons, Inc. | Mixed disulfides |
| US4310461A (en) * | 1980-06-23 | 1982-01-12 | E. R. Squibb & Sons, Inc. | Imido, amido and amino derivatives of mercaptoacyl prolines and pipecolic acids |
| US4344949A (en) * | 1980-10-03 | 1982-08-17 | Warner-Lambert Company | Substituted acyl derivatives of 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acids |
| US4456761A (en) * | 1981-02-02 | 1984-06-26 | E. R. Squibb & Sons, Inc. | 4-Substituted dehydroprolines |
| US4499287A (en) * | 1981-02-02 | 1985-02-12 | E. R. Squibb & Sons, Inc. | Certain-4-hydroxy-proline derivatives |
| US4532342A (en) * | 1981-02-20 | 1985-07-30 | Warner-Lambert Company | N-substituted amino acids as intermediates in the preparation of acyl derivatives of 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acids |
| US4416831A (en) * | 1981-04-27 | 1983-11-22 | E. R. Squibb & Sons, Inc. | Amino and substituted amino phosphinylalkanoyl compounds |
| US4374131A (en) * | 1981-04-27 | 1983-02-15 | E. R. Squibb & Sons, Inc. | Amino and substituted amino phosphinyl-alkanoyl compounds |
| US4416833A (en) * | 1981-05-04 | 1983-11-22 | E. R. Squibb & Sons, Inc. | Substituted carbonyl phosphinyl-alkanoyl compounds |
| US4381297A (en) * | 1981-05-04 | 1983-04-26 | E. R. Squibb & Sons, Inc. | Substituted carbonyl phosphinyl-alkanoyl compounds |
| US4432971A (en) * | 1981-08-03 | 1984-02-21 | E. R. Squibb & Sons, Inc. | Phosphonamidate compounds |
| US4503043A (en) * | 1981-12-07 | 1985-03-05 | Warner-Lambert Company | Substituted acyl derivatives of octahydro-1H-isoindole-1-carboxylic acids |
| US4555506A (en) * | 1981-12-24 | 1985-11-26 | E. R. Squibb & Sons, Inc. | Phosphorus containing compounds and use as hypotensives |
| US4560680A (en) * | 1982-03-15 | 1985-12-24 | E. R. Squibb & Sons, Inc. | Aminoalkyl and related substituted phosphinic acid angiotensin converting enzyme inhibitors |
| US4452791A (en) * | 1982-03-15 | 1984-06-05 | E. R. Squibb & Sons, Inc. | Aminoalkyl and related substituted phosphinic acid angiotensin converting enzyme inhibitors |
| US4448772A (en) * | 1982-04-22 | 1984-05-15 | E. R. Squibb & Sons, Inc. | Phosphinylmethylaminocarbonyl imino acid compounds useful for treating hypertension |
| US4560681A (en) * | 1982-04-22 | 1985-12-24 | E. R. Squibb & Sons, Inc. | Phosphinylmethylaminocarbonyl imino acid compounds useful for treating hypertension |
| US4452790A (en) * | 1982-06-23 | 1984-06-05 | E. R. Squibb & Sons, Inc. | Phosphonyl hydroxyacyl amino acid derivatives as antihypertensives |
| US4703043A (en) * | 1982-06-23 | 1987-10-27 | E. R. Squibb & Sons, Inc. | Phosphonyl hydroxyacyl amino acid derivatives as antihypertensive |
| US4616005A (en) * | 1982-06-23 | 1986-10-07 | E. R. Squibb & Sons, Inc. | Phosphonyl hydroxyacyl amino acid derivatives as antihypertensives |
| US4567166A (en) * | 1982-07-14 | 1986-01-28 | E. R. Squibb & Sons, Inc. | Amino and substituted amino phosphinylalkanoyl compounds useful for treating hypertension |
| US4736066A (en) * | 1982-07-19 | 1988-04-05 | E. R. Squibb & Sons, Inc. | Intermediate for substituted peptide compounds |
| US4470973A (en) * | 1982-07-19 | 1984-09-11 | E. R. Squibb & Sons, Inc. | Substituted peptide compounds |
| US4623729A (en) | 1982-07-22 | 1986-11-18 | E. R. Squibb & Sons, Inc. | Acylalkylaminocarbonyl substituted amino and imino acid compounds |
| US4742067A (en) * | 1982-07-22 | 1988-05-03 | E. R. Squibb & Sons, Inc. | Acylalkylaminocarbonyl substituted amino and imino acid compounds |
| US4621092A (en) * | 1982-07-22 | 1986-11-04 | E. R. Squibb & Sons, Inc. | Substituted proline compounds, composition and method of use |
| US4524212A (en) * | 1982-09-27 | 1985-06-18 | E. R. Squibb & Sons, Inc. | Acyloxyketone substituted imino and amino acids |
| US4514391A (en) * | 1983-07-21 | 1985-04-30 | E. R. Squibb & Sons, Inc. | Hydroxy substituted peptide compounds |
| CA2021409A1 (en) * | 1989-08-21 | 1991-02-22 | Donald S. Karanewsky | Phosphonate substituted amino or imino acids useful as antihypertensives |
| GB9016476D0 (en) * | 1990-07-27 | 1990-09-12 | Sandoz Ltd | Improvements in or relating to organic compounds |
| KR100622332B1 (ko) * | 1999-04-01 | 2006-09-13 | 알자 코포레이션 | 폴리우레탄 약물 리저버를 함유하는 경피 약물 수송 장치 |
| JP6317455B2 (ja) * | 2014-08-29 | 2018-04-25 | 京セラ株式会社 | センサ装置およびセンシング方法 |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3531490A (en) * | 1968-09-06 | 1970-09-29 | Us Agriculture | S-beta-(4-pyridylethyl)-l-cysteine |
| US3917815A (en) * | 1969-09-04 | 1975-11-04 | Oreal | Cosmetic compositions containing N-oxypyridyl derivatives |
| US4066658A (en) * | 1975-08-11 | 1978-01-03 | Hoffmann-La Roche Inc. | Resolution of d,l-dehydroproline |
| US4105776A (en) * | 1976-06-21 | 1978-08-08 | E. R. Squibb & Sons, Inc. | Proline derivatives and related compounds |
| US4046889A (en) * | 1976-02-13 | 1977-09-06 | E. R. Squibb & Sons, Inc. | Azetidine-2-carboxylic acid derivatives |
| AU509899B2 (en) * | 1976-02-13 | 1980-05-29 | E.R. Squibb & Sons, Inc. | Proline derivatives and related compounds |
-
1978
- 1978-02-15 US US05/878,144 patent/US4129566A/en not_active Expired - Lifetime
- 1978-08-15 US US05/933,950 patent/US4154942A/en not_active Expired - Lifetime
- 1978-08-15 US US05/936,270 patent/US4156084A/en not_active Expired - Lifetime
-
1979
- 1979-01-30 CA CA320,467A patent/CA1124725A/en not_active Expired
- 1979-02-05 NZ NZ189574A patent/NZ189574A/xx unknown
- 1979-02-05 ZA ZA79483A patent/ZA79483B/xx unknown
- 1979-02-06 IN IN086/DEL/79A patent/IN151091B/en unknown
- 1979-02-07 IL IL56606A patent/IL56606A0/xx not_active IP Right Cessation
- 1979-02-07 GR GR58292A patent/GR74445B/el unknown
- 1979-02-07 AU AU44006/79A patent/AU520475B2/en not_active Ceased
- 1979-02-08 DE DE19792904823 patent/DE2904823A1/de not_active Ceased
- 1979-02-12 PH PH22186A patent/PH14730A/en unknown
- 1979-02-13 IT IT47986/79A patent/IT1113713B/it active
- 1979-02-13 HU HU79SU1010A patent/HU178115B/hu unknown
- 1979-02-13 CS CS79964A patent/CS213370B2/cs unknown
- 1979-02-14 NO NO790495A patent/NO153054C/no unknown
- 1979-02-14 ES ES477695A patent/ES477695A1/es not_active Expired
- 1979-02-14 IE IE292/79A patent/IE48072B1/en not_active IP Right Cessation
- 1979-02-14 CH CH142079A patent/CH636608A5/fr not_active IP Right Cessation
- 1979-02-14 EG EG95/79A patent/EG13875A/xx active
- 1979-02-14 DK DK63479A patent/DK63479A/da not_active Application Discontinuation
- 1979-02-14 SU SU792729300A patent/SU860697A1/ru active
- 1979-02-14 PT PT7969224A patent/PT69224A/pt unknown
- 1979-02-14 AR AR275511A patent/AR222481A1/es active
- 1979-02-15 AT AT0118879A patent/AT375919B/de not_active IP Right Cessation
- 1979-02-15 DD DD79211043A patent/DD141670A5/de unknown
- 1979-02-15 FR FR7903829A patent/FR2417500A1/fr active Granted
- 1979-02-15 RO RO7996623A patent/RO76614A/ro unknown
- 1979-02-15 YU YU00363/79A patent/YU36379A/xx unknown
- 1979-02-15 GB GB7905336A patent/GB2014573B/en not_active Expired
- 1979-02-15 NL NL7901197A patent/NL7901197A/xx not_active Application Discontinuation
- 1979-02-15 BE BE0/193493A patent/BE874202A/xx not_active IP Right Cessation
- 1979-02-15 LU LU80925A patent/LU80925A1/xx unknown
- 1979-02-15 PL PL1979213449A patent/PL116509B1/pl unknown
- 1979-02-15 FI FI790502A patent/FI67369C/fi not_active IP Right Cessation
- 1979-02-15 JP JP1714079A patent/JPS54125683A/ja active Granted
-
1982
- 1982-08-13 HK HK358/82A patent/HK35882A/xx unknown
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DK63479A (da) | Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrer | |
| DK491780A (da) | Fremgangsmaade til fremstilling af cephalosporansyrederivater | |
| DK336783D0 (da) | Fremgangsmade til fremstilling af methylendiphosphonsyrederivater | |
| DK160679A (da) | Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid | |
| DK251079A (da) | Fremgangsmaade til fremstilling af phenylpiperazinderivater | |
| DK520679A (da) | Fremgangsmaade til fremstilling af 3-quinolincarboxulsyrederivater | |
| DK158670C (da) | Fremgangsmaade til fremstilling af 6beta-halogensubstituerede penicillansyrederivater | |
| DK357782A (da) | Fremgangsmaade til fremstilling af tetrahydrofurancarboxylsyrederivater | |
| DK99980A (da) | Fremgangsmaade til fremstilling af mercaptoacyldihydropyrazolcarboxylsyrederivater | |
| DK554481A (da) | Fremgangsmaade til fremstilling af cephalosporansyrederivater | |
| DK152752C (da) | Fremgangsmaade til fremstilling af l-sulpirid | |
| DK232080A (da) | Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater | |
| DK344679A (da) | Fremgangsmaade til fremstilling af arylglyoxylsyrer | |
| DK300781A (da) | Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater | |
| DK160312C (da) | Fremgangsmaade til fremstilling af derivater af 7-aminothiazolylacetamidocephalosporansyre | |
| DK154554C (da) | Fremgangsmaade til fremstilling af alfa-methyl-carbazol-2-eddikesyrederivater | |
| DK444279A (da) | Fremgangsmaade til fremstilling af 6-hydroxymethyl-2-(beta-aminoethylthio)-1-carbadethiapen-2-em-3-carboxylsyre | |
| DK36379A (da) | Fremgangsmaade til fremstilling af n-ethylethylendiamin | |
| DK143107C (da) | Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin | |
| DK154880A (da) | Fremgangsmaade til fremstilling af derivater af 6beta-amidinopenicillansyre | |
| DK147420C (da) | Fremgangsmaade til fremstilling af acylcyanider | |
| DK195979A (da) | Fremgangsmaade til fremstilling af d-homosteroider | |
| PL208226A1 (pl) | Sposob wytwarzania nowych pochodnych kwasu trojfluorometylofenoksy-fenoksykrotonowego | |
| DK160494C (da) | Fremgangsmaade til fremstilling af 5-bromtetrazolyl-1-eddikesyre | |
| DK276080A (da) | Fremgangsmaade til fremstilling af penicillansyrederivater |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AHB | Application shelved due to non-payment |