DK63479A - Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrer - Google Patents
Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrerInfo
- Publication number
- DK63479A DK63479A DK63479A DK63479A DK63479A DK 63479 A DK63479 A DK 63479A DK 63479 A DK63479 A DK 63479A DK 63479 A DK63479 A DK 63479A DK 63479 A DK63479 A DK 63479A
- Authority
- DK
- Denmark
- Prior art keywords
- dehydrocyclic
- preparing
- acid derivatives
- imino acid
- imino
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D211/00—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings
- C07D211/04—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D211/68—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member
- C07D211/72—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member with hetero atoms or with carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, directly attached to ring carbon atoms
- C07D211/78—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C327/00—Thiocarboxylic acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D207/00—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom
- C07D207/02—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D207/18—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member
- C07D207/22—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US05/878,144 US4129566A (en) | 1978-02-15 | 1978-02-15 | Derivatives of dehydrocyclicimino acids |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| DK63479A true DK63479A (da) | 1979-08-16 |
Family
ID=25371470
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DK63479A DK63479A (da) | 1978-02-15 | 1979-02-14 | Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrer |
Country Status (35)
| Country | Link |
|---|---|
| US (3) | US4129566A (da) |
| JP (1) | JPS54125683A (da) |
| AR (1) | AR222481A1 (da) |
| AT (1) | AT375919B (da) |
| AU (1) | AU520475B2 (da) |
| BE (1) | BE874202A (da) |
| CA (1) | CA1124725A (da) |
| CH (1) | CH636608A5 (da) |
| CS (1) | CS213370B2 (da) |
| DD (1) | DD141670A5 (da) |
| DE (1) | DE2904823A1 (da) |
| DK (1) | DK63479A (da) |
| EG (1) | EG13875A (da) |
| ES (1) | ES477695A1 (da) |
| FI (1) | FI67369C (da) |
| FR (1) | FR2417500A1 (da) |
| GB (1) | GB2014573B (da) |
| GR (1) | GR74445B (da) |
| HK (1) | HK35882A (da) |
| HU (1) | HU178115B (da) |
| IE (1) | IE48072B1 (da) |
| IL (1) | IL56606A0 (da) |
| IN (1) | IN151091B (da) |
| IT (1) | IT1113713B (da) |
| LU (1) | LU80925A1 (da) |
| NL (1) | NL7901197A (da) |
| NO (1) | NO153054C (da) |
| NZ (1) | NZ189574A (da) |
| PH (1) | PH14730A (da) |
| PL (1) | PL116509B1 (da) |
| PT (1) | PT69224A (da) |
| RO (1) | RO76614A (da) |
| SU (1) | SU860697A1 (da) |
| YU (1) | YU36379A (da) |
| ZA (1) | ZA79483B (da) |
Families Citing this family (58)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4690937A (en) * | 1979-08-14 | 1987-09-01 | University Of Miami | Anti-hypertensive agents |
| US4690938A (en) * | 1979-08-14 | 1987-09-01 | University Of Miami | Anti-hypertensive agents |
| US4690940A (en) * | 1979-08-14 | 1987-09-01 | University Of Miami | Anti-hypertensive agents |
| ZA794723B (en) * | 1978-09-11 | 1980-08-27 | Univ Miami | Anti-hypertensive agents |
| US4698356A (en) * | 1979-08-14 | 1987-10-06 | University Of Miami | Anti-hypertensive agents |
| US4698355A (en) * | 1979-08-14 | 1987-10-06 | University Of Miami | Anti-hypertensive agents |
| US4695577A (en) * | 1979-08-14 | 1987-09-22 | University Of Miami | Anti-hypertensive agents |
| US4690939A (en) * | 1979-08-14 | 1987-09-01 | University Of Miami | Anti-hypertensive agents |
| US4198515A (en) * | 1978-12-08 | 1980-04-15 | E. R. Squibb & Sons, Inc. | Mercaptoacyl derivatives of 4,5-dihydro-1H-pyrrole-2-carboxylic acids and 1,4,5,6-tetrahydropyridine-2-carboxylic acids |
| US4217458A (en) * | 1978-12-08 | 1980-08-12 | E. R. Squibb & Sons, Inc. | Acylmercaptoacyl derivatives of 4,5-dihydro-1H-pyrrole-2-carboxylic acids and 1,4,5,6-tetrahydropyridine-2-carboxylic acids |
| US4220791A (en) * | 1979-03-08 | 1980-09-02 | E. R. Squibb & Sons, Inc. | Mercaptoacylpyrazolidinone carboxylic acid derivatives |
| US4211786A (en) * | 1979-03-08 | 1980-07-08 | E. R. Squibb & Sons, Inc. | Mercaptoacyldihydropyrazole carboxylic acid derivatives |
| FR2455585A1 (fr) * | 1979-05-04 | 1980-11-28 | Ono Pharmaceutical Co | Derives d'oxoaminoacides, procede de fabrication et composition pharmaceutique |
| US4234489A (en) * | 1979-06-25 | 1980-11-18 | E. R. Squibb & Sons, Inc. | Pyroglutamic acid derivatives and analogs |
| US4221912A (en) * | 1979-08-22 | 1980-09-09 | E. R. Squibb & Sons, Inc. | Dithio derivatives of 4,5-dihydro-1H-pyrrole-2-carboxylic acids and 1,4,5,6-tetrahydropyridine-2-carboxylic acids |
| US4221804A (en) * | 1979-09-27 | 1980-09-09 | Rovnyak George C | Mercaptoacyldihydropyrazole carboxylic acid derivatives |
| US4291040A (en) * | 1979-10-22 | 1981-09-22 | E. R. Squibb & Sons, Inc. | Mercaptoacyl derivatives of 4-disubstituted prolines and 4-substituted dehydroprolines |
| US4356182A (en) * | 1979-10-22 | 1982-10-26 | E. R. Squibb & Sons, Inc. | Mercaptoacyl derivatives of 4-disubstituted prolines |
| US4266065A (en) * | 1980-04-14 | 1981-05-05 | E. R. Squibb & Sons, Inc. | Mercaptoacyldihydropyrazole carboxylic acid derivatives |
| US4308392A (en) * | 1979-12-03 | 1981-12-29 | E. R. Squibb & Sons, Inc. | Hydroxamic acid derivatives of mercaptoacyl amino acids |
| US4284561A (en) * | 1979-12-03 | 1981-08-18 | E. R. Squibb & Sons, Inc. | Hydroxamic acid derivatives of mercaptoacyl amino acids |
| IE50839B1 (en) * | 1980-02-26 | 1986-07-23 | Wyeth John & Brother Ltd | Novel processes for preparing proline derivatives and analogous compounds |
| US4692458A (en) * | 1980-03-05 | 1987-09-08 | University Of Miami | Anti-hypertensive agents |
| US4690936A (en) * | 1980-03-05 | 1987-09-01 | University Of Miami | Anti-hypertensive agents |
| US4734420A (en) * | 1980-03-05 | 1988-03-29 | University Of Miami | Anti-hypertensive agents |
| US4350704A (en) * | 1980-10-06 | 1982-09-21 | Warner-Lambert Company | Substituted acyl derivatives of octahydro-1H-indole-2-carboxylic acids |
| US4284624A (en) * | 1980-05-02 | 1981-08-18 | E. R. Squibb & Sons, Inc. | Mixed disulfides |
| US4310461A (en) * | 1980-06-23 | 1982-01-12 | E. R. Squibb & Sons, Inc. | Imido, amido and amino derivatives of mercaptoacyl prolines and pipecolic acids |
| US4344949A (en) * | 1980-10-03 | 1982-08-17 | Warner-Lambert Company | Substituted acyl derivatives of 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acids |
| US4499287A (en) * | 1981-02-02 | 1985-02-12 | E. R. Squibb & Sons, Inc. | Certain-4-hydroxy-proline derivatives |
| US4456761A (en) * | 1981-02-02 | 1984-06-26 | E. R. Squibb & Sons, Inc. | 4-Substituted dehydroprolines |
| US4532342A (en) * | 1981-02-20 | 1985-07-30 | Warner-Lambert Company | N-substituted amino acids as intermediates in the preparation of acyl derivatives of 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acids |
| US4374131A (en) * | 1981-04-27 | 1983-02-15 | E. R. Squibb & Sons, Inc. | Amino and substituted amino phosphinyl-alkanoyl compounds |
| US4416831A (en) * | 1981-04-27 | 1983-11-22 | E. R. Squibb & Sons, Inc. | Amino and substituted amino phosphinylalkanoyl compounds |
| US4381297A (en) * | 1981-05-04 | 1983-04-26 | E. R. Squibb & Sons, Inc. | Substituted carbonyl phosphinyl-alkanoyl compounds |
| US4416833A (en) * | 1981-05-04 | 1983-11-22 | E. R. Squibb & Sons, Inc. | Substituted carbonyl phosphinyl-alkanoyl compounds |
| US4432971A (en) * | 1981-08-03 | 1984-02-21 | E. R. Squibb & Sons, Inc. | Phosphonamidate compounds |
| US4503043A (en) * | 1981-12-07 | 1985-03-05 | Warner-Lambert Company | Substituted acyl derivatives of octahydro-1H-isoindole-1-carboxylic acids |
| US4555506A (en) * | 1981-12-24 | 1985-11-26 | E. R. Squibb & Sons, Inc. | Phosphorus containing compounds and use as hypotensives |
| US4452791A (en) * | 1982-03-15 | 1984-06-05 | E. R. Squibb & Sons, Inc. | Aminoalkyl and related substituted phosphinic acid angiotensin converting enzyme inhibitors |
| US4560680A (en) * | 1982-03-15 | 1985-12-24 | E. R. Squibb & Sons, Inc. | Aminoalkyl and related substituted phosphinic acid angiotensin converting enzyme inhibitors |
| US4448772A (en) * | 1982-04-22 | 1984-05-15 | E. R. Squibb & Sons, Inc. | Phosphinylmethylaminocarbonyl imino acid compounds useful for treating hypertension |
| US4560681A (en) * | 1982-04-22 | 1985-12-24 | E. R. Squibb & Sons, Inc. | Phosphinylmethylaminocarbonyl imino acid compounds useful for treating hypertension |
| US4616005A (en) * | 1982-06-23 | 1986-10-07 | E. R. Squibb & Sons, Inc. | Phosphonyl hydroxyacyl amino acid derivatives as antihypertensives |
| US4703043A (en) * | 1982-06-23 | 1987-10-27 | E. R. Squibb & Sons, Inc. | Phosphonyl hydroxyacyl amino acid derivatives as antihypertensive |
| US4452790A (en) * | 1982-06-23 | 1984-06-05 | E. R. Squibb & Sons, Inc. | Phosphonyl hydroxyacyl amino acid derivatives as antihypertensives |
| US4567166A (en) * | 1982-07-14 | 1986-01-28 | E. R. Squibb & Sons, Inc. | Amino and substituted amino phosphinylalkanoyl compounds useful for treating hypertension |
| US4470973A (en) * | 1982-07-19 | 1984-09-11 | E. R. Squibb & Sons, Inc. | Substituted peptide compounds |
| US4736066A (en) * | 1982-07-19 | 1988-04-05 | E. R. Squibb & Sons, Inc. | Intermediate for substituted peptide compounds |
| US4621092A (en) * | 1982-07-22 | 1986-11-04 | E. R. Squibb & Sons, Inc. | Substituted proline compounds, composition and method of use |
| US4742067A (en) * | 1982-07-22 | 1988-05-03 | E. R. Squibb & Sons, Inc. | Acylalkylaminocarbonyl substituted amino and imino acid compounds |
| US4623729A (en) | 1982-07-22 | 1986-11-18 | E. R. Squibb & Sons, Inc. | Acylalkylaminocarbonyl substituted amino and imino acid compounds |
| US4524212A (en) * | 1982-09-27 | 1985-06-18 | E. R. Squibb & Sons, Inc. | Acyloxyketone substituted imino and amino acids |
| US4514391A (en) * | 1983-07-21 | 1985-04-30 | E. R. Squibb & Sons, Inc. | Hydroxy substituted peptide compounds |
| CA2021409A1 (en) * | 1989-08-21 | 1991-02-22 | Donald S. Karanewsky | Phosphonate substituted amino or imino acids useful as antihypertensives |
| GB9016476D0 (en) * | 1990-07-27 | 1990-09-12 | Sandoz Ltd | Improvements in or relating to organic compounds |
| WO2000059483A2 (en) * | 1999-04-01 | 2000-10-12 | Alza Corporation | Transdermal drug delivery devices comprising a polyurethane drug reservoir |
| EP3187869B1 (en) * | 2014-08-29 | 2023-03-08 | Kyocera Corporation | Sensor device and sensing method |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3531490A (en) * | 1968-09-06 | 1970-09-29 | Us Agriculture | S-beta-(4-pyridylethyl)-l-cysteine |
| US3917815A (en) * | 1969-09-04 | 1975-11-04 | Oreal | Cosmetic compositions containing N-oxypyridyl derivatives |
| US4066658A (en) * | 1975-08-11 | 1978-01-03 | Hoffmann-La Roche Inc. | Resolution of d,l-dehydroproline |
| US4105776A (en) * | 1976-06-21 | 1978-08-08 | E. R. Squibb & Sons, Inc. | Proline derivatives and related compounds |
| AU509899B2 (en) * | 1976-02-13 | 1980-05-29 | E.R. Squibb & Sons, Inc. | Proline derivatives and related compounds |
| US4046889A (en) * | 1976-02-13 | 1977-09-06 | E. R. Squibb & Sons, Inc. | Azetidine-2-carboxylic acid derivatives |
-
1978
- 1978-02-15 US US05/878,144 patent/US4129566A/en not_active Expired - Lifetime
- 1978-08-15 US US05/933,950 patent/US4154942A/en not_active Expired - Lifetime
- 1978-08-15 US US05/936,270 patent/US4156084A/en not_active Expired - Lifetime
-
1979
- 1979-01-30 CA CA320,467A patent/CA1124725A/en not_active Expired
- 1979-02-05 ZA ZA79483A patent/ZA79483B/xx unknown
- 1979-02-05 NZ NZ189574A patent/NZ189574A/xx unknown
- 1979-02-06 IN IN086/DEL/79A patent/IN151091B/en unknown
- 1979-02-07 GR GR58292A patent/GR74445B/el unknown
- 1979-02-07 IL IL56606A patent/IL56606A0/xx not_active IP Right Cessation
- 1979-02-07 AU AU44006/79A patent/AU520475B2/en not_active Ceased
- 1979-02-08 DE DE19792904823 patent/DE2904823A1/de not_active Ceased
- 1979-02-12 PH PH22186A patent/PH14730A/en unknown
- 1979-02-13 IT IT47986/79A patent/IT1113713B/it active
- 1979-02-13 HU HU79SU1010A patent/HU178115B/hu unknown
- 1979-02-13 CS CS79964A patent/CS213370B2/cs unknown
- 1979-02-14 ES ES477695A patent/ES477695A1/es not_active Expired
- 1979-02-14 IE IE292/79A patent/IE48072B1/en not_active IP Right Cessation
- 1979-02-14 CH CH142079A patent/CH636608A5/fr not_active IP Right Cessation
- 1979-02-14 AR AR275511A patent/AR222481A1/es active
- 1979-02-14 SU SU792729300A patent/SU860697A1/ru active
- 1979-02-14 DK DK63479A patent/DK63479A/da not_active Application Discontinuation
- 1979-02-14 PT PT7969224A patent/PT69224A/pt unknown
- 1979-02-14 NO NO790495A patent/NO153054C/no unknown
- 1979-02-14 EG EG95/79A patent/EG13875A/xx active
- 1979-02-15 DD DD79211043A patent/DD141670A5/de unknown
- 1979-02-15 FR FR7903829A patent/FR2417500A1/fr active Granted
- 1979-02-15 GB GB7905336A patent/GB2014573B/en not_active Expired
- 1979-02-15 NL NL7901197A patent/NL7901197A/xx not_active Application Discontinuation
- 1979-02-15 PL PL1979213449A patent/PL116509B1/pl unknown
- 1979-02-15 RO RO7996623A patent/RO76614A/ro unknown
- 1979-02-15 FI FI790502A patent/FI67369C/fi not_active IP Right Cessation
- 1979-02-15 YU YU00363/79A patent/YU36379A/xx unknown
- 1979-02-15 BE BE0/193493A patent/BE874202A/xx not_active IP Right Cessation
- 1979-02-15 LU LU80925A patent/LU80925A1/xx unknown
- 1979-02-15 JP JP1714079A patent/JPS54125683A/ja active Granted
- 1979-02-15 AT AT0118879A patent/AT375919B/de not_active IP Right Cessation
-
1982
- 1982-08-13 HK HK358/82A patent/HK35882A/xx unknown
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DK63479A (da) | Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrer | |
| DK491780A (da) | Fremgangsmaade til fremstilling af cephalosporansyrederivater | |
| DK336783A (da) | Fremgangsmaade til fremstilling af methylendiphosphonsyrederivater | |
| DK160679A (da) | Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid | |
| DK251079A (da) | Fremgangsmaade til fremstilling af phenylpiperazinderivater | |
| DK520679A (da) | Fremgangsmaade til fremstilling af 3-quinolincarboxulsyrederivater | |
| DK158670C (da) | Fremgangsmaade til fremstilling af 6beta-halogensubstituerede penicillansyrederivater | |
| DK357782A (da) | Fremgangsmaade til fremstilling af tetrahydrofurancarboxylsyrederivater | |
| DK99980A (da) | Fremgangsmaade til fremstilling af mercaptoacyldihydropyrazolcarboxylsyrederivater | |
| DK554481A (da) | Fremgangsmaade til fremstilling af cephalosporansyrederivater | |
| DK232080A (da) | Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater | |
| DK344679A (da) | Fremgangsmaade til fremstilling af arylglyoxylsyrer | |
| DK152752C (da) | Fremgangsmaade til fremstilling af l-sulpirid | |
| DK300781A (da) | Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater | |
| DK160312C (da) | Fremgangsmaade til fremstilling af derivater af 7-aminothiazolylacetamidocephalosporansyre | |
| DK154554C (da) | Fremgangsmaade til fremstilling af alfa-methyl-carbazol-2-eddikesyrederivater | |
| DK444279A (da) | Fremgangsmaade til fremstilling af 6-hydroxymethyl-2-(beta-aminoethylthio)-1-carbadethiapen-2-em-3-carboxylsyre | |
| DK36379A (da) | Fremgangsmaade til fremstilling af n-ethylethylendiamin | |
| DK143107C (da) | Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin | |
| DK154880A (da) | Fremgangsmaade til fremstilling af derivater af 6beta-amidinopenicillansyre | |
| DK147420C (da) | Fremgangsmaade til fremstilling af acylcyanider | |
| DK195979A (da) | Fremgangsmaade til fremstilling af d-homosteroider | |
| PL208226A1 (pl) | Sposob wytwarzania nowych pochodnych kwasu trojfluorometylofenoksy-fenoksykrotonowego | |
| DK160494C (da) | Fremgangsmaade til fremstilling af 5-bromtetrazolyl-1-eddikesyre | |
| DK276080A (da) | Fremgangsmaade til fremstilling af penicillansyrederivater |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AHB | Application shelved due to non-payment |