DK137990C - Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive 1-arylpropyl-(2)-piperazinderivater eller syreadditionssalte deraf - Google Patents
Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive 1-arylpropyl-(2)-piperazinderivater eller syreadditionssalte derafInfo
- Publication number
- DK137990C DK137990C DK373271A DK373271A DK137990C DK 137990 C DK137990 C DK 137990C DK 373271 A DK373271 A DK 373271A DK 373271 A DK373271 A DK 373271A DK 137990 C DK137990 C DK 137990C
- Authority
- DK
- Denmark
- Prior art keywords
- arylpropyl
- racemic
- preparation
- optically active
- piperazine derivatives
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D295/00—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms
- C07D295/02—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms containing only hydrogen and carbon atoms in addition to the ring hetero elements
- C07D295/027—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms containing only hydrogen and carbon atoms in addition to the ring hetero elements containing only one hetero ring
- C07D295/03—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms containing only hydrogen and carbon atoms in addition to the ring hetero elements containing only one hetero ring with the ring nitrogen atoms directly attached to acyclic carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D311/00—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings
- C07D311/02—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings ortho- or peri-condensed with carbocyclic rings or ring systems
- C07D311/04—Benzo[b]pyrans, not hydrogenated in the carbocyclic ring
- C07D311/58—Benzo[b]pyrans, not hydrogenated in the carbocyclic ring other than with oxygen or sulphur atoms in position 2 or 4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D317/00—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms
- C07D317/08—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3
- C07D317/44—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3 ortho- or peri-condensed with carbocyclic rings or ring systems
- C07D317/46—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3 ortho- or peri-condensed with carbocyclic rings or ring systems condensed with one six-membered ring
- C07D317/48—Methylenedioxybenzenes or hydrogenated methylenedioxybenzenes, unsubstituted on the hetero ring
- C07D317/50—Methylenedioxybenzenes or hydrogenated methylenedioxybenzenes, unsubstituted on the hetero ring with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to atoms of the carbocyclic ring
- C07D317/56—Radicals substituted by sulfur atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D317/00—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms
- C07D317/08—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3
- C07D317/44—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3 ortho- or peri-condensed with carbocyclic rings or ring systems
- C07D317/46—Heterocyclic compounds containing five-membered rings having two oxygen atoms as the only ring hetero atoms having the hetero atoms in positions 1 and 3 ortho- or peri-condensed with carbocyclic rings or ring systems condensed with one six-membered ring
- C07D317/48—Methylenedioxybenzenes or hydrogenated methylenedioxybenzenes, unsubstituted on the hetero ring
- C07D317/50—Methylenedioxybenzenes or hydrogenated methylenedioxybenzenes, unsubstituted on the hetero ring with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to atoms of the carbocyclic ring
- C07D317/58—Radicals substituted by nitrogen atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D319/00—Heterocyclic compounds containing six-membered rings having two oxygen atoms as the only ring hetero atoms
- C07D319/10—1,4-Dioxanes; Hydrogenated 1,4-dioxanes
- C07D319/14—1,4-Dioxanes; Hydrogenated 1,4-dioxanes condensed with carbocyclic rings or ring systems
- C07D319/16—1,4-Dioxanes; Hydrogenated 1,4-dioxanes condensed with carbocyclic rings or ring systems condensed with one six-membered ring
- C07D319/18—Ethylenedioxybenzenes, not substituted on the hetero ring
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Heterocyclic Carbon Compounds Containing A Hetero Ring Having Nitrogen And Oxygen As The Only Ring Hetero Atoms (AREA)
- Heterocyclic Compounds That Contain Two Or More Ring Oxygen Atoms (AREA)
- Plural Heterocyclic Compounds (AREA)
- Nitrogen Condensed Heterocyclic Rings (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DK510677A DK140666B (da) | 1970-07-30 | 1977-11-17 | Fremgangsmåde til fremstilling af N-(1-(3,4-methylendioxyphenyl)-propyl-(2))-N'-(alfa-naphthyl)-piperazin eller syreadditionssalte heraf. |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE2037852A DE2037852C3 (de) | 1970-07-30 | 1970-07-30 | Neue Piperazinderivate und Verfahren zu ihrer Herstellung |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| DK137990B DK137990B (da) | 1978-06-19 |
| DK137990C true DK137990C (da) | 1978-11-13 |
Family
ID=5778382
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DK373271A DK137990C (da) | 1970-07-30 | 1971-07-29 | Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive 1-arylpropyl-(2)-piperazinderivater eller syreadditionssalte deraf |
Country Status (19)
| Country | Link |
|---|---|
| US (1) | US3808212A (pl) |
| JP (1) | JPS5716989B1 (pl) |
| AT (6) | AT311985B (pl) |
| AU (1) | AU463957B2 (pl) |
| BE (1) | BE770800A (pl) |
| BG (5) | BG20369A3 (pl) |
| CH (6) | CH565167A5 (pl) |
| CS (1) | CS172929B2 (pl) |
| DE (1) | DE2037852C3 (pl) |
| DK (1) | DK137990C (pl) |
| ES (6) | ES393738A1 (pl) |
| FR (1) | FR2100972B1 (pl) |
| GB (1) | GB1344720A (pl) |
| NL (1) | NL173643C (pl) |
| PL (6) | PL84348B1 (pl) |
| RO (6) | RO60596A (pl) |
| SE (2) | SE375308B (pl) |
| SU (5) | SU437293A3 (pl) |
| YU (7) | YU34530B (pl) |
Families Citing this family (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3940396A (en) * | 1973-02-28 | 1976-02-24 | Uniroyal Inc. | 1,2,3,4,4A,5,7,7A-Octahydrothieno[3,4-b]pyrazines 6,6-dioxides |
| US3991036A (en) * | 1973-02-28 | 1976-11-09 | Uniroyal Inc. | Preparation of polyurethane using 1,2,3,4,4a,5,7,7a-Octahydrothieno[3,4-b]py |
| GB1407552A (en) * | 1973-04-02 | 1975-09-24 | Science Union & Cie | Disubstituted piperazines processes for their preparation and pharmaceutical compositions containing them |
| GB1432660A (en) * | 1973-10-30 | 1976-04-22 | Science Union & Cie | Piperazine derivatives processes for their preparation and and pharamacueitcal compositions containing them |
| US3960863A (en) * | 1974-06-25 | 1976-06-01 | Sankyo Company Limited | Pyrido[1,2-a]pyrimidinone derivatives |
| DE2604838A1 (de) * | 1976-02-07 | 1977-08-11 | Knoll Ag | Alkylendioxypiperazinderivate |
| EP0132267B1 (en) * | 1983-01-21 | 1989-01-18 | FISONS plc | Aromatic amines |
| DE3571436D1 (en) * | 1984-12-21 | 1989-08-17 | Duphar Int Res | New pharmaceutical compositions having anti-psychotic properties |
| FR2692264B1 (fr) * | 1992-06-12 | 1994-08-05 | Adir | Nouvelles piperazines 1,4-disubstituees, leur procede de preparation et les compositions pharmaceutiques les contenant. |
| FR2734819B1 (fr) * | 1995-05-31 | 1997-07-04 | Adir | Nouveaux composes de la piperazine, de la piperidine et de la 1,2,5,6-tetrahydropyridine, leur procede de preparation et les compositions pharmaceutiques les contenant |
| US6002005A (en) * | 1995-06-02 | 1999-12-14 | Neurogen Corporation | Certain 1-substituted aminomethyl imidazole and pyrrole derivatives: novel dopamine receptor subtype specific ligands |
| FR2737724B1 (fr) * | 1995-08-09 | 1997-09-05 | Synthelabo | Derives de 1-[2-(2,3-dihydro-1h-inden-1-yl)ethyl]-4- (naphtalen-1-yl) piperazine, leur preparation et leur application en therapeutique |
| JPH09124643A (ja) * | 1995-08-14 | 1997-05-13 | Bristol Myers Squibb Co | 抗うつ作用を有する１−アリールアルキル−４−（アルコキシピリジニル）−又は４−（アルコキシピリミジニル）ピペラジン誘導体 |
| US6040448A (en) * | 1997-10-24 | 2000-03-21 | Neurogen Corporation | Certain 1-(2-naphthyl) and 1-(2-azanaphthyl)-4-(1-phenylmethyl) piperazines, dopamine receptor subtype specific ligands |
| MA41169A (fr) * | 2014-12-17 | 2017-10-24 | Acraf | Composés antibactériens à large spectre d'activité |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NL132357C (pl) * | 1966-09-03 |
-
1970
- 1970-07-30 DE DE2037852A patent/DE2037852C3/de not_active Expired
-
1971
- 1971-06-23 RO RO69217A patent/RO60596A/ro unknown
- 1971-06-23 RO RO67429A patent/RO59997A/ro unknown
- 1971-06-23 RO RO69219A patent/RO60597A/ro unknown
- 1971-06-23 RO RO69222A patent/RO60599A/ro unknown
- 1971-06-23 RO RO69220A patent/RO60598A/ro unknown
- 1971-06-23 RO RO69218A patent/RO61040A/ro unknown
- 1971-07-08 US US00160891A patent/US3808212A/en not_active Expired - Lifetime
- 1971-07-27 CH CH524175A patent/CH565167A5/xx not_active IP Right Cessation
- 1971-07-27 CH CH523975A patent/CH565781A5/xx not_active IP Right Cessation
- 1971-07-27 CH CH524075A patent/CH565166A5/xx not_active IP Right Cessation
- 1971-07-27 CH CH523875A patent/CH565165A5/xx not_active IP Right Cessation
- 1971-07-27 CH CH524275A patent/CH575412A5/xx not_active IP Right Cessation
- 1971-07-27 CH CH1106871A patent/CH565780A5/xx not_active IP Right Cessation
- 1971-07-28 SU SU1815877A patent/SU437293A3/ru active
- 1971-07-28 CS CS5538A patent/CS172929B2/cs unknown
- 1971-07-28 BG BG021484A patent/BG20369A3/xx unknown
- 1971-07-28 SU SU1815881A patent/SU437292A3/ru active
- 1971-07-28 BG BG018177A patent/BG21029A3/xx unknown
- 1971-07-28 BG BG021488A patent/BG20370A3/xx unknown
- 1971-07-28 SU SU1815879A patent/SU440840A3/ru active
- 1971-07-28 BG BG21487A patent/BG19598A3/xx unknown
- 1971-07-28 SU SU1815880A patent/SU437291A3/ru active
- 1971-07-28 SU SU1688445A patent/SU416945A3/ru active
- 1971-07-28 JP JP5608071A patent/JPS5716989B1/ja active Pending
- 1971-07-28 BG BG21486A patent/BG20594A3/xx unknown
- 1971-07-29 ES ES393738A patent/ES393738A1/es not_active Expired
- 1971-07-29 YU YU1986/71A patent/YU34530B/xx unknown
- 1971-07-29 AT AT1100172A patent/AT311985B/de not_active IP Right Cessation
- 1971-07-29 PL PL1971178479A patent/PL84348B1/pl unknown
- 1971-07-29 AT AT664271A patent/AT311976B/de active
- 1971-07-29 PL PL1971182554A patent/PL91965B1/pl unknown
- 1971-07-29 DK DK373271A patent/DK137990C/da active
- 1971-07-29 PL PL1971149717A patent/PL84664B1/pl unknown
- 1971-07-29 AT AT1100372A patent/AT311987B/de active
- 1971-07-29 AT AT1100272A patent/AT311986B/de not_active IP Right Cessation
- 1971-07-29 PL PL1971178478A patent/PL84349B1/pl unknown
- 1971-07-29 AT AT1100472A patent/AT311988B/de active
- 1971-07-29 GB GB3577271A patent/GB1344720A/en not_active Expired
- 1971-07-29 AT AT1100072A patent/AT311984B/de not_active IP Right Cessation
- 1971-07-29 PL PL1971178481A patent/PL84610B1/pl unknown
- 1971-07-29 SE SE7109767A patent/SE375308B/xx unknown
- 1971-07-29 AU AU31772/71A patent/AU463957B2/en not_active Expired
- 1971-07-29 PL PL1971178480A patent/PL84347B1/pl unknown
- 1971-07-30 NL NLAANVRAGE7110538,A patent/NL173643C/xx not_active IP Right Cessation
- 1971-07-30 FR FR7128074A patent/FR2100972B1/fr not_active Expired
- 1971-07-30 BE BE770800A patent/BE770800A/xx not_active IP Right Cessation
- 1971-10-21 ES ES396212A patent/ES396212A1/es not_active Expired
- 1971-10-21 ES ES396214A patent/ES396214A1/es not_active Expired
- 1971-10-21 ES ES396216A patent/ES396216A1/es not_active Expired
- 1971-10-21 ES ES396213A patent/ES396213A1/es not_active Expired
- 1971-10-21 ES ES396215A patent/ES396215A1/es not_active Expired
-
1974
- 1974-06-27 SE SE7408533A patent/SE403288B/xx unknown
-
1978
- 1978-03-13 YU YU597/78A patent/YU35248B/xx unknown
- 1978-03-13 YU YU598/78A patent/YU34889B/xx unknown
- 1978-03-13 YU YU596/78A patent/YU34888B/xx unknown
- 1978-03-13 YU YU599/78A patent/YU34890B/xx unknown
- 1978-03-13 YU YU60078A patent/YU34891B/xx unknown
- 1978-06-12 YU YU01388/78A patent/YU138878A/xx unknown
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DK135585C (da) | Analogifremgangsmade til fremstilling af cycloheptenderivatereller syreadditionssalte deraf | |
| DK131858C (da) | Analogifremgangsmade til fremstilling af 4-amino-6-arylpyrimidin-forbindelser eller syreadditionssalte deraf | |
| DK139387C (da) | Analogifremgangsmaade til fremstilling af apovincaminsyrederivater eller syreadditionssalte deraf | |
| DK137990C (da) | Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive 1-arylpropyl-(2)-piperazinderivater eller syreadditionssalte deraf | |
| DK124081B (da) | Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive piperazinderivater eller syreadditionssalte deraf. | |
| DK132944C (da) | Analogifremgangsmade til fremstilling af 4-(4-biphenylyl)-4-oxo-smorsyrer eller estere eller salte heraf | |
| DK131778C (da) | Fremgangsmade til fremstilling af substituerede 3-hydroksymetylisokinolinderivater eller syreadditionssalte heraf | |
| DK137677C (da) | Analogifremgangsmaade til fremstilling af basisk substitueredexanthinderivater eller syreadditionssalte heraf | |
| DK137606C (da) | Analogifremgangsmaade til fremstilling af substituerede 2-phenylamino-imidazoliner-(2) eller syreadditionssalte deraf | |
| DK139582B (da) | Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive benzocycloheptaisoquinolin-forbindelser eller syreadditionssalte deraf. | |
| DK133980C (da) | Analogifremgangsmade til fremstilling af racemiske eller optisk aktive diphenylalkyllactamimidderivater eller syreadditionssalte deraf | |
| DK131857C (da) | Analogifremgangsmade til fremstilling af 4-hydroxymethyl-1-phthalazonderivater eller syreadditionssalte deraf | |
| DK142984C (da) | Analogifremgangsmaade til fremstilling af benzobicycloalkanaminer eller farmaceutisk acceptable syreadditionssalte deraf | |
| DK139517C (da) | Analogifremgangsmaade til fremstilling af substituerede thiazol-2-carboxamider eller syreadditionssalte deraf | |
| DK133555C (da) | Analogifremgangsmade til fremstilling af racemiske eller optisk aktive n-thienylmethyl-heterocycliske forbindelser eller syreadditionssalte deraf | |
| DK130958B (da) | Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive 1-phenoxy-2-hydroxy-3-hydroxyalkylaminopropaner eller fysiologisk tålelige syreadditionssalte heraf. | |
| DK132627C (da) | Analogifremgangsmade til fremstilling af kromanderivater eller syreadditionssalte deraf | |
| DK133149B (da) | Analogifremgangsmade til fremstilling af et guanidinphenylurinstofderivat eller syreadditionssalte deraf | |
| DK132551C (da) | Analogifremgangsmade til fremstilling af racemiske eller optisk aktive carbamoylalkoxyphenoxyisopropanolaminderivater eller syreadditionssalte deraf | |
| DK135941C (da) | Analogifremgangsmaade til fremstilling af 1-cyclopropyl-1-phenyl-3-amino-1-propanoler eller syreaddittionssalte deraf | |
| DK133005C (da) | Analogifremgangsmade til fremstilling af racemisk eller optisk aktiv 1-cyclohexenyl-glycinamidopenicillansyre eller -cephalosporansyrer eller salte deraf | |
| DK135942C (da) | Analogifremgangsmade til fremstilling af racemiske eller optisk aktive 1-(m-acyloxyphenyl)-1-hydroxy-2-n-alkylaminoethanereller syreadditionssalte deraf | |
| DK132755C (da) | Analogifremgangsmade til fremstilling af benzomorphanderivater eller syreadditionssalte deraf | |
| DK131727C (da) | Analogifremgangsmade til fremstilling af oxazinobenzoxaziner eller syreadditionssalte deraf | |
| DK131470B (da) | Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive thiazolino-pyrimidin-5-on derivater eller syreadditionssalte deraf. |