Fry separation equipment
Technical field
The invention belongs to cultivation apparatus technical field, and in particular to a kind of fry separation equipment.
Background technology
Spring is the fish gonad development stage, and food ration increase, becomes parent population, artificial when fish was developed to the sexal maturity stage
In fry rearing work, natural propagation in culture pond is put into after usually parent population is manually matched, then removes parent population, fish is collected in seine
Seedling, parent population may prey on fry or fish-egg in natural cultivating process, and the travelling of parent population survives fry or fish-egg
Rate affects, and traditional Artificial Fish seeding cultivating method need further perfect.
The content of the invention
It is an object of the invention to provide a kind of separate type collect fish-egg can be hatched, effectively avoid parent population gland maturity and
The situation of difficult labour occurs, and to parent population clean a kind of fry separation equipment of processing.
The technical solution taken to achieve the above object of the present invention is:Fry separation equipment, including babinet, are placed in case
Separate mesh in the middle part of body, tank surface are equipped with baffle, are equipped with support plate above baffle, support plate bottom surface is evenly distributed with electromagnet, baffle
With laying sweeper in the space of separate mesh, the bottom of box is equipped with collecting net, the equal air distribution head of tank floor, and gas head passes through gas transmission
Pipe is connected with the oxygen pump on the outside of babinet, and the oxygen content being effectively ensured in babinet in water ensures that Gunther parent fish spawning amount and hatching are imitated
Fruit, oxygenation is steady, and the bubble large effect fish-egg position and hatching effect that prevention oxygenation produces, the support plate used is iron material
Matter, the material of baffle is rubber or plastic material, and baffle, separate mesh, collecting net are identical with the interior surface area of babinet, by dividing
The produced fish-egg of parent population or fry are effectively directly separated to collecting net by off-network, are intuitively observed fish oviposition quantity and are led to
To cross separate mesh and protect fish-egg or fry well, the fish-egg being collected into can directly be hatched on collecting net, if collect
Fish-egg is excessive, can remove support plate, baffle and separate mesh successively, and then the fish-egg on collecting net is taken out, and can will remove part
Babinet is placed back to continue to collect fish-egg or hatch fry.
For optimize above-mentioned technical proposal, take further measures for:Spring is equipped with the middle part of separate mesh, collecting net and babinet,
Middle part is recessed under can avoiding separate mesh, collecting net tension force excessively, and electromagnet is connected with microcontroller, and each electricity is controlled by microcontroller
The power on/off situation of magnet is adsorbed and moved it to sweeper.Sweeper includes floating block, and two supporting rods are equipped with below floating block
With uniformly distributed sponge strip, floating block top connection iron block, the section of supporting rod is more than the mesh of separate mesh, can effectively support sweeper
And sweeper magnet adsorption and by its magnetic drive, sweeper is being placed the space content movement of parent population, utilize sponge strip pair
Place and bulky grain pollutant is cleaned or adsorbed in the space of parent population, can be to parent population body surface when sponge strip passes through or passed through by parent population
Cleaned, beneficial to keep water quality totally effectively prevent parent population during breeding it is infected sick, and in sweeper by electromagnetism
Iron can reach when driving and drive the effect that parent population moves about, to achieve the purpose that to consume the fatty of parent population cylinder accumulation, effectively
The problem of solving parent population, nursing is not moved about for a long time, cylinder accumulation hyperliposis, postponement sexual gland maturation and difficult labour.Supporting rod bottom
It is embedded with rotatable ball.Moved beneficial to sweeper in separation net surface, avoid supporting rod from causing to damage to separate mesh, gas head
Between spacing be the 1/6 ~ 1/4 of babinet overall length, air-flow influences fish-egg when avoiding being oxygenated, iron block and baffle contact surface
Equipped with wear-resistant coating, for iron block by the magnetic-adsorption of electromagnet, iron block and baffle Long Term Contact can cause surface both product friction damage
Hinder excessive, rubbing the iron filings fallen or material or falls in babinet and influence hatch fish roe or effect that fry is collected, use are wear-resisting
Coating effectively improves the smoothness of contact surface, accelerates the translational speed of sweeper and improves the rub resistance effect of iron block and baffle.
Spacing ratio is 3-5 successively for baffle, separate mesh, collecting net and tank floor:2:1, by setting gap ratio to be provided for parent population
Enough activity spaces, meanwhile, the space for collecting fish-egg or fry is not easy excessive, and it is scattered otherwise to easily lead to fish-egg floating, bottom
Gas head and netting gear between certain spacing is set, the fish-egg of collection or fry are produced to avoid bubble caused by increase oxygen
It is raw to influence.Support plate and baffle surface are evenly distributed with loophole, and support plate and baffle spacing are 2 ~ 10cm, ensure that the magnetic force of electromagnet can
Act on sweeper, the spray that can also prevent to splash during fish activity is splashed on electromagnet.Separate mesh size of mesh, which is more than, collects
Net size of mesh, can avoid separated fish-egg or situation that fry can not effectively collect occurs, and babinet can use transparent material
Prepare, easy to observe parent population activity, oviposition quantity, hatching situation or fry collection situation etc..
Compared with prior art, beneficial effects of the present invention are:1)By separate mesh effectively by the produced fish-egg of parent population
Or fry is directly separated to collecting net, intuitively observe fish oviposition quantity and protected well by separate mesh fish-egg or
Fry, the fish-egg being collected into can directly be hatched on collecting net;2)Parent population body surface can be cleaned, beneficial to holding water quality
Clean effectively prevention parent population is infected sick during breeding, and can reach and drive when sweeper is by solenoid actuated
The effect that parent population moves about, to achieve the purpose that to consume the fatty of parent population cylinder accumulation, efficiently solving parent population, nursing is not swum for a long time
It is dynamic, cylinder accumulation hyperliposis, the problem of postponing sexual gland maturation and have difficult labour;3)The light of contact surface is effectively improved using wear-resistant coating
Slippery, accelerates the translational speed of sweeper and improves the rub resistance effect of iron block and baffle.
Brief description of the drawings
Fig. 1 is the schematic diagram of the efficient easily nursery collection device of the present invention;
Fig. 2 is the schematic diagram of sweeper.
Description of reference numerals:1 baffle;2 separate meshes;3 collecting nets;4 gas heads;5 babinets;6 appendixs;7 oxygen pump;8 monolithics
Machine;9 support plates;10 electromagnet;11 sweepers;11a wear-resistant coatings;11b iron blocks;11c floating blocks;11d sponge strips;11e supporting rods;
12 springs.
Embodiment
Make progressive be described in detail with attached drawing with reference to embodiments:
Embodiment 1:
As shown in Figure 1, 2, fry separation equipment, including babinet 5, are placed in the separate mesh 2 at the middle part of babinet 5,5 surface of babinet is equipped with
Baffle 1, the top of baffle 1 are equipped with support plate 9, and 9 bottom surface of support plate is evenly distributed with electromagnet 10, and baffle 1 in the space of separate mesh 2 with placing
There is sweeper 11,5 bottom of babinet is equipped with collecting net 3, and the equal air distribution head 4 in 5 bottom surface of babinet, the support plate 9 used is iron material matter, baffle
1 material is rubber or plastic material, and baffle 1, separate mesh 2, collecting net 3 are identical with the interior surface area of babinet 5, pass through separation
The produced fish-egg of parent population or fry are effectively directly separated to collecting net 3 by net 2, are intuitively observed fish oviposition quantity and are led to
Cross separate mesh 2 and protect fish-egg or fry well, the fish-egg being collected into can directly be hatched on collecting net 3, if collecting
Fish-egg it is excessive, can remove support plate 9, baffle 1 and separate mesh 2 successively, and then the fish-egg on collecting net 3 is taken out, will can move
Continue to collect fish-egg or hatching fry except babinet 5 is partly placed back.Gas first 4 passes through appendix 6 and the oxygen pump 7 in the outside of babinet 5
Connection, is effectively ensured the oxygen content in babinet 5 in water and ensures Gunther parent fish spawning amount and hatching effect, oxygenation is steady, prevents oxygenation
The bubble large effect fish-egg position of generation and hatching effect.
Spacing ratio is preferably 3 successively for baffle 1, separate mesh 2, collecting net 3 and 5 bottom surface of babinet:2:1, by setting spacing
Than enough activity spaces can be provided for parent population, meanwhile, the space for collecting fish-egg or fry is not easy excessive, otherwise easily leads to fish-egg
Floating is scattered, and certain spacing is set between the gas first 4 and netting gear of bottom, to avoid bubble caused by increase oxygen to collecting
Fish-egg or fry have an impact.Support plate 9 and 1 surface of baffle are evenly distributed with loophole, and support plate 9 is preferably with 1 spacing of baffle
5cm, ensureing the magnetic force of electromagnet 10 can act on sweeper 11, and the spray that can also prevent to splash during fish activity splashes electromagnet
On 10.2 size of mesh of separate mesh is more than 3 size of mesh of collecting net, can avoid separated fish-egg or fry can not effectively collect
Situation occurs, and babinet 5 can use transparent material to prepare, and is received easy to observe parent population activity, oviposition quantity, hatching situation or fry
Collection situation etc..
Electromagnet 10 is connected with microcontroller 8, and the power on/off situation of each electromagnet 10 is controlled to cleaning by microcontroller
Device 11 is adsorbed and moved it, and supporting rod 11e bottoms are embedded with rotatable ball.Spacing between gas first 4 is preferably babinet 5
The 1/6 of overall length, air-flow influences fish-egg when avoiding being oxygenated, and supporting rod 11e bottoms are embedded with rotatable ball.
Separate mesh 2, collecting net 3 and the middle part of babinet 5 are equipped with spring 12, in can avoiding separate mesh 2,3 tension force of collecting net excessively time
Subordinate is recessed, and electromagnet is connected with microcontroller, and the power on/off situation for controlling each electromagnet by microcontroller adsorbs sweeper
And move it.
Embodiment 2:
As shown in Figure 1, 2, sweeper 11 includes floating block 11c, and two supporting rod 11e and uniformly distributed sponge are equipped with below floating block 11c
The section of connection iron block 11b, supporting rod 11e are more than the mesh of separate mesh 2 above bar 11d, floating block 11c, can effectively support cleaning
Device 11 and 11 magnet 10 of sweeper adsorb and by its magnetic drive, sweeper 11 is being placed the space content movement of parent population, profit
With cleaning or adsorbing bulky grain pollutant in spaces of the sponge strip 11d to placing parent population, when sponge strip 11d passes through or is passed through by parent population
It is out-of-date parent population body surface to be cleaned, beneficial to keep water quality totally effectively prevent parent population during breeding it is infected sick, and
And can reach the effect driven parent population and moved about when sweeper 11 is driven by electromagnet 10, to reach product in consumption parent population body
Tired fatty purpose, efficiently solves parent population and feeds for a long time and do not move about, cylinder accumulation hyperliposis, it is ripe and difficult to postpone sexual gland
The problem of production.Iron block 11b is equipped with wear-resistant coating 11a with 1 contact surface of baffle, and iron block 11b is by the magnetic-adsorption of electromagnet 10, iron block
11b and 1 Long Term Contact of baffle can cause surface both product frictionally damage excessive, and rubbing the iron filings fallen or material or falls on babinet
The effect of hatch fish roe or fry collection is influenced in 5, the smoothness of contact surface is effectively improved using wear-resistant coating 11a, is accelerated clear
Sweep the translational speed of device 11 and improve the rub resistance effect of iron block 11b and baffle 1.
Microcontroller 8 controls the energization powering-off state of each electromagnet 10, by leftmost side electromagnet 10 to rightmost side electromagnet 10
It is powered successively, electromagnet adsorbs sweeper 11 after leftmost side electromagnet 10 is powered, and microcontroller 8 disconnects the leftmost side after 1 second
The electric current of electromagnet 10, while be powered to the electromagnet 10 on the right side of leftmost side electromagnet 10, it adsorbs sweeper and breaks after 11,1 second
Electricity, until being powered down to most rear side electromagnet 10, realizes sweeper 11 and is moved from 5 leftmost side of babinet to the rightmost side, is being moved through
Sweeper 11 cleans parent population body surface and drives parent population movement and also further sweep down the produced fish-egg of parent population and divided in journey
Off-network 2, makes fish-egg quickly reach 3 surface of collecting net.
Embodiment 3:
Wear-resistant coating 11a forms wear-resistant coating 11a by wear-resistant paint in iron block 11b surfaces coating solidify afterwards, wear-resistant paint by with
Lower component and parts by weight composition:It is 32 parts of polyester modification acrylic resin, 7 parts of titanium dioxide, 12 parts of iron powder, 6 parts of fluoroolefins resin, super
Thin 6 parts of alumina silicate, L-(+)0.04 part of -2,3- dihydroxypropionic acids, L-(-)0.001 part of -2,3- dihydroxypropionic acids, conditioning agent 0.03
Part, 10 parts of bentonite, 17 parts of curing agent, 34 parts of graphite powder, 22 parts of toluene, 7 parts of water, curing agent are polyamide curing agent and isophthalic
The mixture of diamine curing agent, wear-resistant paint is passed through carbon dioxide 20min in preparation process, and is containing diamond
Oscillator in prepare.Prepare gained wear-resistant paint after iron block 11b is coated room temperature 10-15h can spontaneous curing, formation
The Ra values of wear-resistant coating 11a are 0.2, the L- of special proportioning(+)- 2,3- dihydroxypropionic acids and L-(-)- 2,3- dihydroxypropionic acids can
Accelerate coating composition and the cross-linking reaction of oxygen, realize quick-setting effect but also further improve the antifouling effect of coating
Fruit, and the conditioning agent added in coating is active peptides, and the amino acid sequence of active peptides is
QSGFCTSYYCSKFCGTAYGCYNLTPGKICYCLHCSS, the combination stability of its adjustable coating each component, and improve each
The species activity and anisotropic of component, make the wear-resistant coating 11a compactness to be formed good, wear-resisting and smooth, sweeper 11 and gear
The frictional resistance that plate 1 contacts is small, and translational speed during sweeper 11 is driven using electromagnet 10.
Embodiment 4:
The use of the fry separation equipment of the present invention:At 10 degrees Celsius, the grass carp of dispensing starts to ingest for water temperature control in babinet 5,
Food ration increases as water temperature raises, and feeds feed based on malt, rice sprout etc., adds dish leaf once in a while, feeds 30- daily per tail
60 grams, the later stage, feeding volume was the 2% ~ 6% of fish body weight, stops feeding before grass carp is hastened parturition, case with rye grass, water plant etc. for staple food
Water in body 5 is replaced 1 time daily, hastened parturition using ocyodinic, injection volume is raun per 0.03 unit of tail/tail, milter dosage
Halve, injection can be blent with physiological saline, continuous quantitative injection syringe may be selected in syringe, and injection site is dorsal fin base portion flesh
Meat, injection depth 0.2cm, the complete grass carp of artificial induced spawning are put back in water tank 5, and after raun ovulates, fish-egg is fallen on collecting net 3
Realize fish, ovum separation, and fish-egg is directly hatched, you can obtain fry.
The prior art of routine techniques dawn known to those skilled in the art in above-described embodiment, for example, bleeding technique,
The prior arts such as the installation of net, therefore be not described in detail herein.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, can also make a variety of changes and modification.Therefore, it is all equivalent
Technical solution fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
Sequence table
<110>Lanxi City Pu Run Si aquaculture technologies Co., Ltd
<120>Fry separation equipment
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 36
<212> PRT
<213>Artificial synthesized (Mytilus coruscus)
<400> 1
Gln Ser Gly Phe Cys Thr Ser Tyr Tyr Cys Ser Lys Phe Cys Gly Thr
1 5 10 15
Ala Tyr Gly Cys Tyr Asn Leu Thr Pro Gly Lys Ile Cys Tyr Cys Leu
20 25 30
His Cys Ser Ser
35