CN107980668A - Efficient easily fry collection device - Google Patents
Efficient easily fry collection device Download PDFInfo
- Publication number
- CN107980668A CN107980668A CN201711018447.1A CN201711018447A CN107980668A CN 107980668 A CN107980668 A CN 107980668A CN 201711018447 A CN201711018447 A CN 201711018447A CN 107980668 A CN107980668 A CN 107980668A
- Authority
- CN
- China
- Prior art keywords
- collection device
- babinet
- baffle
- efficient easily
- fish
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 241001417527 Pempheridae Species 0.000 claims abstract description 27
- 238000009826 distribution Methods 0.000 claims abstract description 4
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 claims description 41
- 229910052742 iron Inorganic materials 0.000 claims description 20
- 238000000576 coating method Methods 0.000 claims description 15
- 239000011248 coating agent Substances 0.000 claims description 14
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 claims description 9
- 229910052760 oxygen Inorganic materials 0.000 claims description 9
- 239000001301 oxygen Substances 0.000 claims description 9
- 239000007789 gas Substances 0.000 claims description 6
- 210000004907 gland Anatomy 0.000 abstract description 5
- 230000000694 effects Effects 0.000 description 23
- 241000251468 Actinopterygii Species 0.000 description 15
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 11
- 239000000463 material Substances 0.000 description 10
- 230000012447 hatching Effects 0.000 description 7
- 239000003795 chemical substances by application Substances 0.000 description 6
- 238000009825 accumulation Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 230000017448 oviposition Effects 0.000 description 5
- 230000009286 beneficial effect Effects 0.000 description 4
- 238000004140 cleaning Methods 0.000 description 4
- 238000000034 method Methods 0.000 description 4
- 238000006213 oxygenation reaction Methods 0.000 description 4
- 239000003973 paint Substances 0.000 description 4
- 241000252230 Ctenopharyngodon idella Species 0.000 description 3
- 102000002322 Egg Proteins Human genes 0.000 description 3
- 108010000912 Egg Proteins Proteins 0.000 description 3
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 3
- 238000009395 breeding Methods 0.000 description 3
- 230000001488 breeding effect Effects 0.000 description 3
- 235000013305 food Nutrition 0.000 description 3
- 210000004681 ovum Anatomy 0.000 description 3
- 230000001568 sexual effect Effects 0.000 description 3
- 238000001179 sorption measurement Methods 0.000 description 3
- WZCQRUWWHSTZEM-UHFFFAOYSA-N 1,3-phenylenediamine Chemical compound NC1=CC=CC(N)=C1 WZCQRUWWHSTZEM-UHFFFAOYSA-N 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- GWEVSGVZZGPLCZ-UHFFFAOYSA-N Titan oxide Chemical compound O=[Ti]=O GWEVSGVZZGPLCZ-UHFFFAOYSA-N 0.000 description 2
- 235000013339 cereals Nutrition 0.000 description 2
- 230000003750 conditioning effect Effects 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 230000005611 electricity Effects 0.000 description 2
- 239000003344 environmental pollutant Substances 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 229940018564 m-phenylenediamine Drugs 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 230000035800 maturation Effects 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000032696 parturition Effects 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 231100000719 pollutant Toxicity 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 239000004925 Acrylic resin Substances 0.000 description 1
- 229920000178 Acrylic resin Polymers 0.000 description 1
- PGNNQOJOEGFAOR-KWQFWETISA-N Ala-Tyr-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CC=C(O)C=C1 PGNNQOJOEGFAOR-KWQFWETISA-N 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- WZJLBUPPZRZNTO-CIUDSAMLSA-N Cys-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CS)N WZJLBUPPZRZNTO-CIUDSAMLSA-N 0.000 description 1
- IWVNIQXKTIQXCT-SRVKXCTJSA-N Cys-Tyr-Asn Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CS)N)O IWVNIQXKTIQXCT-SRVKXCTJSA-N 0.000 description 1
- JIZRUFJGHPIYPS-SRVKXCTJSA-N Cys-Tyr-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CS)N)O JIZRUFJGHPIYPS-SRVKXCTJSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- OSCLNNWLKKIQJM-WDSKDSINSA-N Gln-Ser-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(O)=O OSCLNNWLKKIQJM-WDSKDSINSA-N 0.000 description 1
- PTIIBFKSLCYQBO-NHCYSSNCSA-N Gly-Lys-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)CN PTIIBFKSLCYQBO-NHCYSSNCSA-N 0.000 description 1
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 1
- LBCAQRFTWMMWRR-CIUDSAMLSA-N His-Cys-Ser Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(O)=O LBCAQRFTWMMWRR-CIUDSAMLSA-N 0.000 description 1
- KLSUAWUZBMAZCL-RHYQMDGZSA-N Leu-Thr-Pro Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(O)=O KLSUAWUZBMAZCL-RHYQMDGZSA-N 0.000 description 1
- 241000209082 Lolium Species 0.000 description 1
- 241000143233 Mytilus coruscus Species 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- BPQQTUXANYXVAA-UHFFFAOYSA-N Orthosilicate Chemical compound [O-][Si]([O-])([O-])[O-] BPQQTUXANYXVAA-UHFFFAOYSA-N 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- ALHULIGNEXGFRM-QWRGUYRKSA-N Phe-Cys-Gly Chemical compound OC(=O)CNC(=O)[C@H](CS)NC(=O)[C@@H](N)CC1=CC=CC=C1 ALHULIGNEXGFRM-QWRGUYRKSA-N 0.000 description 1
- PSBJZLMFFTULDX-IXOXFDKPSA-N Phe-Cys-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CC1=CC=CC=C1)N)O PSBJZLMFFTULDX-IXOXFDKPSA-N 0.000 description 1
- 239000004952 Polyamide Substances 0.000 description 1
- OSFZCEQJLWCIBG-BZSNNMDCSA-N Ser-Tyr-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O OSFZCEQJLWCIBG-BZSNNMDCSA-N 0.000 description 1
- PNEYBMLMFCGWSK-UHFFFAOYSA-N aluminium oxide Inorganic materials [O-2].[O-2].[O-2].[Al+3].[Al+3] PNEYBMLMFCGWSK-UHFFFAOYSA-N 0.000 description 1
- 150000001413 amino acids Chemical group 0.000 description 1
- 230000003373 anti-fouling effect Effects 0.000 description 1
- 238000009360 aquaculture Methods 0.000 description 1
- 244000144974 aquaculture Species 0.000 description 1
- 239000000440 bentonite Substances 0.000 description 1
- 229910000278 bentonite Inorganic materials 0.000 description 1
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 229910003460 diamond Inorganic materials 0.000 description 1
- 239000010432 diamond Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 108010081551 glycylphenylalanine Proteins 0.000 description 1
- 230000026109 gonad development Effects 0.000 description 1
- 238000009434 installation Methods 0.000 description 1
- 108010027338 isoleucylcysteine Proteins 0.000 description 1
- 108010038320 lysylphenylalanine Proteins 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 230000000474 nursing effect Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 229920002647 polyamide Polymers 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 108010029020 prolylglycine Proteins 0.000 description 1
- 230000000384 rearing effect Effects 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 238000009738 saturating Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 239000004408 titanium dioxide Substances 0.000 description 1
- 239000012780 transparent material Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K61/00—Culture of aquatic animals
- A01K61/10—Culture of aquatic animals of fish
- A01K61/17—Hatching, e.g. incubators
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K61/00—Culture of aquatic animals
- A01K61/10—Culture of aquatic animals of fish
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K63/00—Receptacles for live fish, e.g. aquaria; Terraria
- A01K63/04—Arrangements for treating water specially adapted to receptacles for live fish
- A01K63/042—Introducing gases into the water, e.g. aerators, air pumps
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K69/00—Stationary catching devices
- A01K69/02—Fixed nets without traps
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/80—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in fisheries management
- Y02A40/81—Aquaculture, e.g. of fish
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Environmental Sciences (AREA)
- Animal Husbandry (AREA)
- Biodiversity & Conservation Biology (AREA)
- Marine Sciences & Fisheries (AREA)
- Zoology (AREA)
- Farming Of Fish And Shellfish (AREA)
Abstract
The present invention discloses a kind of efficient easily fry collection device, belong to cultivation apparatus technical field, efficient easily fry collection device, including babinet, the separate mesh being placed in the middle part of babinet, tank surface is equipped with baffle, support plate is equipped with above baffle, support plate bottom surface is evenly distributed with electromagnet, sweeper is laid in the space of baffle and separate mesh, the bottom of box is equipped with collecting net, the equal air distribution head of tank floor, the fry collection device of the present invention collects fish-egg using separate type to be hatched, and parent population gland maturity and the situation of difficult labour is effectively avoided to occur, device inner clean cleans.
Description
Technical field
The invention belongs to cultivation apparatus technical field, and in particular to a kind of efficient easily fry collection device.
Background technology
Spring is the fish gonad development stage, and food ration increase, becomes parent population, artificial when fish was developed to the sexal maturity stage
In fry rearing work, natural propagation in culture pond is put into after usually parent population is manually matched, then removes parent population, fish is collected in seine
Seedling, parent population may prey on fry or fish-egg in natural cultivating process, and the travelling of parent population survives fry or fish-egg
Rate affects, and traditional Artificial Fish seeding cultivating method need further perfect.
The content of the invention
Collecting fish-egg it is an object of the invention to provide a kind of separate type can be hatched, and effectively avoid parent population gland maturity
Occur with the situation of difficult labour, a kind of clean efficient easily fry collection device of device inner clean.
The technical solution taken to achieve the above object of the present invention is：Efficient easily fry collection device, including case
Body, the separate mesh being placed in the middle part of babinet, tank surface are equipped with baffle, are equipped with support plate above baffle, support plate bottom surface is evenly distributed with
Lay sweeper in the space of electromagnet, baffle and separate mesh, the bottom of box is equipped with collecting net, the equal air distribution head of tank floor,
For the support plate used for iron material matter, the material of baffle is rubber or plastic material, baffle, separate mesh, collecting net and babinet it is interior
Portion's surface area is identical, effectively the produced fish-egg of parent population or fry is directly separated to collecting net by separate mesh, intuitively
Observe fish oviposition quantity and protect fish-egg or fry well by separate mesh, the fish-egg being collected into can be directly in collecting net
On hatched, if the fish-egg collected is excessive, support plate, baffle and separate mesh can be removed successively, and then by the fish on collecting net
Ovum takes out, and removal part can be placed back babinet and continue to collect fish-egg or hatch fry.
For optimize above-mentioned technical proposal, take further measures for：Gas head is pumped by the oxygen on the outside of appendix and babinet
Connection, the oxygen content being effectively ensured in babinet in water ensure Gunther parent fish spawning amount and hatching effect, and oxygenation is steady, prevention oxygenation production
Raw bubble large effect fish-egg position and hatching effect.Electromagnet is connected with microcontroller, is controlled by microcontroller each
The power on/off situation of electromagnet is adsorbed and moved it to sweeper.Sweeper includes floating block, and two supports are equipped with below floating block
Bar and uniformly distributed sponge strip, floating block top connection iron block, the section of supporting rod is more than the mesh of separate mesh, can effectively support cleaning
Device and sweeper magnet adsorption and by its magnetic drive, make sweeper place the space content movement of parent population, utilize sponge strip
Bulky grain pollutant is cleaned or adsorbed in space to placing parent population, can be to parent population body when sponge strip passes through or passed through by parent population
Table is cleaned, beneficial to keep water quality totally effectively prevent parent population during breeding it is infected sick, and in sweeper by electricity
Magnet can reach when driving and drive the effect that parent population moves about, and to achieve the purpose that to consume the fatty of parent population cylinder accumulation, have
The problem of effect, which solves parent population and feeds for a long time, does not move about, cylinder accumulation hyperliposis, postponement sexual gland maturation and difficult labour.Iron block and gear
Plate contact surface is equipped with wear-resistant coating, and for iron block by the magnetic-adsorption of electromagnet, iron block and baffle Long Term Contact can cause surface both
Product frictionally damage is excessive, and rubbing the iron filings fallen or material or falls in babinet and influence hatch fish roe or effect that fry is collected,
The smoothness of contact surface is effectively improved using wear-resistant coating, accelerates the translational speed of sweeper and improves the antifriction of iron block and baffle
Wipe effect.Spacing ratio is 3-5 successively for baffle, separate mesh, collecting net and tank floor:2:1, can be parent by setting gap ratio
Fish provides enough activity space, meanwhile, the space for collecting fish-egg or fry is not easy excessive, otherwise easily leads to fish-egg floating point
Dissipate, certain spacing is set between the gas head and netting gear of bottom, to avoid bubble caused by increase oxygen to the fish-egg of collection
Or fry has an impact.Support plate and baffle surface are evenly distributed with loophole, and support plate and baffle spacing are 2 ~ 10cm, ensure electromagnet
Magnetic force can act on sweeper, the spray that splashes is splashed on electromagnet when can also prevent fish activity.Separate mesh size of mesh
More than collecting net size of mesh, it can avoid separated fish-egg or situation that fry can not effectively collect occurs, babinet can use saturating
Prepared by bright material, easy to observe parent population activity, oviposition quantity, hatching situation or fry collection situation etc..
Compared with prior art, beneficial effects of the present invention are：1）By separate mesh effectively by the produced fish-egg of parent population
Or fry is directly separated to collecting net, intuitively observe fish oviposition quantity and protected well by separate mesh fish-egg or
Fry, the fish-egg being collected into can directly be hatched on collecting net；2）Parent population body surface can be cleaned, beneficial to holding water quality
Clean effectively prevention parent population is infected sick during breeding, and can reach and drive when sweeper is by solenoid actuated
The effect that parent population moves about, to achieve the purpose that to consume the fatty of parent population cylinder accumulation, efficiently solving parent population, nursing is not swum for a long time
It is dynamic, cylinder accumulation hyperliposis, the problem of postponing sexual gland maturation and have difficult labour；3）The light of contact surface is effectively improved using wear-resistant coating
Slippery, accelerates the translational speed of sweeper and improves the rub resistance effect of iron block and baffle.
Brief description of the drawings
Fig. 1 is the schematic diagram of the efficient easily nursery collection device of the present invention；
Fig. 2 is the schematic diagram of sweeper.
Description of reference numerals：1 baffle；2 separate meshes；3 collecting nets；4 gas heads；5 babinets；6 appendixs；7 oxygen pump；8 monolithics
Machine；9 support plates；10 electromagnet；11 sweepers；11a wear-resistant coatings；11b iron blocks；11c floating blocks；11d sponge strips；11e supporting rods.
Embodiment
Make progressive be described in detail with attached drawing with reference to embodiments：
Embodiment 1：
As shown in Figure 1, 2, efficient easily fry collection device, including babinet 5, is placed in the separate mesh 2 at the middle part of babinet 5, case
5 surface of body is equipped with baffle 1, and the top of baffle 1 is equipped with support plate 9, and 9 bottom surface of support plate is evenly distributed with electromagnet 10, baffle 1 and separate mesh 2
Space in lay sweeper 11,5 bottom of babinet is equipped with collecting net 3, the equal air distribution head 4 in 5 bottom surface of babinet, the support plate 9 of use
For iron material matter, the material of baffle 1 is rubber or plastic material, baffle 1, separate mesh 2, the interior surface area of collecting net 3 and babinet 5
It is identical, effectively the produced fish-egg of parent population or fry are directly separated to collecting net 3 by separate mesh 2, intuitively observe fish
Oviposition and protects fish-egg or fry at quantity well by separate mesh 2, and the fish-egg being collected into can be directly enterprising in collecting net 3
Row hatching, if the fish-egg collected is excessive, can remove support plate 9, baffle 1 and separate mesh 2 successively, and then by the fish on collecting net 3
Ovum takes out, and removal part can be placed back babinet 5 and continue to collect fish-egg or hatch fry.Gas first 4 passes through appendix 6 and babinet 5
7 connection of oxygen pump in outside, is effectively ensured the oxygen content in babinet 5 in water and ensures Gunther parent fish spawning amount and hatching effect, oxygenation
Steadily, bubble large effect fish-egg position and the hatching effect that oxygenation produces are prevented.
Spacing ratio is preferably 3 successively for baffle 1, separate mesh 2, collecting net 3 and 5 bottom surface of babinet:2:1, by setting spacing
Than enough activity spaces can be provided for parent population, meanwhile, the space for collecting fish-egg or fry is not easy excessive, otherwise easily leads to fish-egg
Floating is scattered, and certain spacing is set between the gas first 4 and netting gear of bottom, to avoid bubble caused by increase oxygen to collecting
Fish-egg or fry have an impact.Support plate 9 and 1 surface of baffle are evenly distributed with loophole, and support plate 9 is preferably with 1 spacing of baffle
5cm, ensureing the magnetic force of electromagnet 10 can act on sweeper 11, and the spray that can also prevent to splash during fish activity splashes electromagnet
On 10.2 size of mesh of separate mesh is more than 3 size of mesh of collecting net, can avoid separated fish-egg or fry can not effectively collect
Situation occurs, and babinet 5 can use transparent material to prepare, and is received easy to observe parent population activity, oviposition quantity, hatching situation or fry
Collection situation etc..
Electromagnet 10 is connected with microcontroller 8, and the power on/off situation of each electromagnet 10 is controlled to cleaning by microcontroller
Device 11 is adsorbed and moved it.
Embodiment 2：
As shown in Figure 1, 2, sweeper 11 includes floating block 11c, and two supporting rod 11e and uniformly distributed sponge are equipped with below floating block 11c
The section of connection iron block 11b, supporting rod 11e are more than the mesh of separate mesh 2 above bar 11d, floating block 11c, can effectively support cleaning
Device 11 and 11 magnet 10 of sweeper adsorb and by its magnetic drive, sweeper 11 is being placed the space content movement of parent population, profit
With cleaning or adsorbing bulky grain pollutant in spaces of the sponge strip 11d to placing parent population, when sponge strip 11d passes through or is passed through by parent population
It is out-of-date parent population body surface to be cleaned, beneficial to keep water quality totally effectively prevent parent population during breeding it is infected sick, and
And can reach the effect driven parent population and moved about when sweeper 11 is driven by electromagnet 10, to reach product in consumption parent population body
Tired fatty purpose, efficiently solves parent population and feeds for a long time and do not move about, cylinder accumulation hyperliposis, it is ripe and difficult to postpone sexual gland
The problem of production.Iron block 11b is equipped with wear-resistant coating 11a with 1 contact surface of baffle, and iron block 11b is by the magnetic-adsorption of electromagnet 10, iron block
11b and 1 Long Term Contact of baffle can cause surface both product frictionally damage excessive, and rubbing the iron filings fallen or material or falls on babinet
The effect of hatch fish roe or fry collection is influenced in 5, the smoothness of contact surface is effectively improved using wear-resistant coating 11a, is accelerated clear
Sweep the translational speed of device 11 and improve the rub resistance effect of iron block 11b and baffle 1.
Microcontroller 8 controls the energization powering-off state of each electromagnet 10, by leftmost side electromagnet 10 to rightmost side electromagnet 10
It is powered successively, electromagnet adsorbs sweeper 11 after leftmost side electromagnet 10 is powered, and microcontroller 8 disconnects the leftmost side after 1 second
The electric current of electromagnet 10, while be powered to the electromagnet 10 on the right side of leftmost side electromagnet 10, it adsorbs sweeper and breaks after 11,1 second
Electricity, until being powered down to most rear side electromagnet 10, realizes sweeper 11 and is moved from 5 leftmost side of babinet to the rightmost side, is being moved through
Sweeper 11 cleans parent population body surface and drives parent population movement and also further sweep down the produced fish-egg of parent population and divided in journey
Off-network 2, makes fish-egg quickly reach 3 surface of collecting net.
Embodiment 3：
Wear-resistant coating 11a forms wear-resistant coating 11a by wear-resistant paint in iron block 11b surfaces coating solidify afterwards, wear-resistant paint by with
Lower component and parts by weight composition：32 parts of polyester modification acrylic resin, 7 parts of titanium dioxide, 12 parts of iron powder, 6 parts of superfine alumina silicate, L-
（+）0.04 part of -2,3- dihydroxypropionic acids, L-（-）0.001 part of -2,3- dihydroxypropionic acids, 0.03 part of conditioning agent, 10 parts of bentonite,
17 parts of curing agent, 34 parts of graphite powder, 22 parts of toluene, 7 parts of water, curing agent are the mixed of polyamide curing agent and m-phenylene diamine (MPD) curing agent
Compound, wear-resistant paint is passed through carbon dioxide 20min in preparation process, and is made in the oscillator containing diamond
It is standby.Prepare gained wear-resistant paint after iron block 11b is coated room temperature 10-15h can spontaneous curing, the wear-resistant coating 11a of formation
Ra values be 0.2, the L- of special proportioning（+）- 2,3- dihydroxypropionic acids and L-（-）- 2,3- dihydroxypropionic acids can accelerate coating group
Divide the cross-linking reaction with oxygen, realize quick-setting effect but also further improve the anti-fouling effect of coating, and apply
The conditioning agent added in material is active peptides, and the amino acid sequence of active peptides is
QSGFCTSYYCSKFCGTAYGCYNLTPGKICYCLHCSS, the combination stability of its adjustable coating each component, and improve each
The species activity and anisotropic of component, make the wear-resistant coating 11a compactness to be formed good, wear-resisting and smooth, sweeper 11 and gear
The frictional resistance that plate 1 contacts is small, and translational speed during sweeper 11 is driven using electromagnet 10.
Embodiment 4：
The use of the fry collection device efficiently edited of the present invention：Water temperature control is at 10 degrees Celsius in babinet 5, the grass carp of dispensing
Start to ingest, food ration increases as water temperature raises, and feeds feed based on malt, rice sprout etc., adds dish leaf once in a while, per tail
30-60 grams is fed daily, and the later stage, feeding volume was the 2% ~ 6% of fish body weight, is stopped before grass carp is hastened parturition with rye grass, water plant etc. for staple food
Only feed, the water in babinet 5 is replaced 1 time daily, hastened parturition using ocyodinic, injection volume for raun per tail 0.03 unit/
Tail, milter dosage halve, and injection can be blent with physiological saline, and continuous quantitative injection syringe may be selected in syringe, and injection site is
Dorsal fin base portion muscle, injection depth 0.2cm, the complete grass carp of artificial induced spawning are put back in water tank 5, and after raun ovulates, fish-egg falls
Fish, ovum separation are realized on to collecting net 3, and fish-egg is directly hatched, you can obtains fry.
The prior art of routine techniques dawn known to those skilled in the art in above-described embodiment, for example, bleeding technique,
The prior arts such as the installation of net, therefore be not described in detail herein.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, can also make a variety of changes and modification.Therefore, it is all equivalent
Technical solution fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
Sequence table
<110>Lanxi City Pu Run Si aquaculture technologies Co., Ltd
<120>Efficient easily fry collection device
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 36
<212> PRT
<213>Artificial synthesized (Mytilus coruscus)
<400> 1
Gln Ser Gly Phe Cys Thr Ser Tyr Tyr Cys Ser Lys Phe Cys Gly Thr
1 5 10 15
Ala Tyr Gly Cys Tyr Asn Leu Thr Pro Gly Lys Ile Cys Tyr Cys Leu
20 25 30
His Cys Ser Ser
35
Claims (8)
1. efficient easily fry collection device, including babinet（5）, it is placed in babinet（5）The separate mesh at middle part（2）, its feature
It is：The babinet（5）Surface is equipped with baffle（1）, the baffle（1）Top is equipped with support plate（9）, the support plate（9）Bottom
Face is evenly distributed with electromagnet（10）, the baffle（1）With separate mesh（2）Space in lay sweeper（11）, the babinet（5）Bottom
Portion is equipped with collecting net（3）, the babinet（5）The equal air distribution head in bottom surface（4）.
2. efficient easily fry collection device according to claim 1, it is characterised in that：The gas head（4）By defeated
Tracheae（6）With babinet（5）The oxygen pump in outside（7）Connection.
3. efficient easily fry collection device according to claim 1, it is characterised in that：The electromagnet（10）With
Microcontroller（8）Connection.
4. efficient easily fry collection device according to claim 1, it is characterised in that：The sweeper（11）Including
Floating block（11c）, the floating block（11c）Lower section is equipped with two supporting rods（11e）With uniformly distributed sponge strip（11d）, the floating block
（11c）Top connects iron block（11b）.
5. efficient easily fry collection device according to claim 4, it is characterised in that：The iron block（11b）With gear
Plate（1）Contact surface is equipped with wear-resistant coating（11a）.
6. efficient easily fry collection device according to claim 1, it is characterised in that：The baffle（1）, separate mesh
（2）, collecting net（3）And babinet（5）Spacing ratio is 3-5 successively for bottom surface:2:1.
7. efficient easily fry collection device according to claim 1, it is characterised in that：The support plate（9）And gear
Plate（1）Surface is evenly distributed with loophole, the support plate（9）With baffle（1）Spacing is 2 ~ 10cm.
8. efficient easily fry collection device according to claim 1, it is characterised in that：The separate mesh（2）Mesh
Size is more than collecting net（3）Size of mesh.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711018447.1A CN107980668B (en) | 2017-10-27 | 2017-10-27 | Efficient and convenient fry collecting device |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711018447.1A CN107980668B (en) | 2017-10-27 | 2017-10-27 | Efficient and convenient fry collecting device |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN107980668A true CN107980668A (en) | 2018-05-04 |
| CN107980668B CN107980668B (en) | 2021-08-06 |
Family
ID=62030524
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201711018447.1A Active CN107980668B (en) | 2017-10-27 | 2017-10-27 | Efficient and convenient fry collecting device |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107980668B (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110663645A (en) * | 2019-11-21 | 2020-01-10 | 湖南富高农业科技开发有限公司 | Tadpole is bred and uses hatching apparatus |
| CN113439693A (en) * | 2021-07-06 | 2021-09-28 | 中国水产科学研究院珠江水产研究所 | Multifunctional fish culture device |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001000077A1 (en) * | 1999-06-24 | 2001-01-04 | Frank Schlosser | Autonomous cleaning device that can be movably disposed on a wall of an object to be cleaned |
| US20070107665A1 (en) * | 2005-11-12 | 2007-05-17 | Duard Enoch | Multifunction aquarium cleaning device |
| CN203505324U (en) * | 2013-07-23 | 2014-04-02 | 于东宁 | Automatic fish tank inner wall cleaning device |
| CN206284144U (en) * | 2016-12-14 | 2017-06-30 | 李东 | A kind of partition type automated cleaning crawl |
| CN107094694A (en) * | 2017-06-26 | 2017-08-29 | 安徽省马鞍山市第七中学 | A kind of clean aquarium of intelligent self-cleaning |
| CN107278995A (en) * | 2017-07-01 | 2017-10-24 | 宁波市鄞州区渔业技术管理服务站（宁波市鄞州区海洋与渔业环境监测站、鄞州区海洋资源综合管理中心） | A kind of simple hatchery of loach |
-
2017
- 2017-10-27 CN CN201711018447.1A patent/CN107980668B/en active Active
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001000077A1 (en) * | 1999-06-24 | 2001-01-04 | Frank Schlosser | Autonomous cleaning device that can be movably disposed on a wall of an object to be cleaned |
| US20070107665A1 (en) * | 2005-11-12 | 2007-05-17 | Duard Enoch | Multifunction aquarium cleaning device |
| CA2654428A1 (en) * | 2005-11-12 | 2007-05-24 | Duard W. Enoch | Multifunction aquarium cleaning device |
| CN203505324U (en) * | 2013-07-23 | 2014-04-02 | 于东宁 | Automatic fish tank inner wall cleaning device |
| CN206284144U (en) * | 2016-12-14 | 2017-06-30 | 李东 | A kind of partition type automated cleaning crawl |
| CN107094694A (en) * | 2017-06-26 | 2017-08-29 | 安徽省马鞍山市第七中学 | A kind of clean aquarium of intelligent self-cleaning |
| CN107278995A (en) * | 2017-07-01 | 2017-10-24 | 宁波市鄞州区渔业技术管理服务站（宁波市鄞州区海洋与渔业环境监测站、鄞州区海洋资源综合管理中心） | A kind of simple hatchery of loach |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110663645A (en) * | 2019-11-21 | 2020-01-10 | 湖南富高农业科技开发有限公司 | Tadpole is bred and uses hatching apparatus |
| CN110663645B (en) * | 2019-11-21 | 2021-10-08 | 湖南富高农业科技开发有限公司 | Tadpole is bred and uses hatching apparatus |
| CN113439693A (en) * | 2021-07-06 | 2021-09-28 | 中国水产科学研究院珠江水产研究所 | Multifunctional fish culture device |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107980668B (en) | 2021-08-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN107969367A (en) | Fry separation equipment | |
| Charlon et al. | Rearing system for feeding fish larvae on dry diets. Trial with carp (Cyprinus carpio L.) larvae | |
| CN106900608A (en) | A kind of breeding method of big squama Barb fishes | |
| JP2001503268A (en) | How to cultivate fish using turf algae | |
| CN107980668A (en) | Efficient easily fry collection device | |
| CN102150633A (en) | Cultivation method for summer fingerling of pelteobagrus | |
| CN107755327A (en) | A kind of fishing net cleaning device used for aquiculture | |
| CN108323466A (en) | A kind of fodder thrower used for aquiculture | |
| CN114600806A (en) | Ripening promoting method for cultivating Xishi lingual parent shellfish by using pond algae | |
| WO2003007701A2 (en) | Aquaculture of marine worms | |
| Naeem et al. | Induced breeding of Labeo rohita through single application of ovaprim-C at Faisalabad Hatchery, Pakistan | |
| Kestemont et al. | Larval rearing of the gudgeon, Gobio gobio L., under optimal conditions of feeding with the rotifer, Brachionus plicatilis OF Müller | |
| CN215012715U (en) | Fry rearing system | |
| CN106106295B (en) | A kind of fugu obscurus marketable fish stereo ecological cultural method | |
| CN106561535A (en) | Method for keeping aquaculture pond clean | |
| CN205492150U (en) | Case is bred to rana nigromaculata | |
| JP2002000119A (en) | Method for culturing fish and shellfish | |
| CN109496925B (en) | Fry breeding method of schizopygmy marigold | |
| KR100461229B1 (en) | Breeding Method of an Urechis unicinctus | |
| CN104106496A (en) | Bag-type cultivation method for synchronously stocked leeches | |
| STOTT et al. | Performance of a new artificial abalone hatchery culture system in terms of settlement of larvae and growth and survival of postlarval Haliotis discus discus (Reeve) | |
| JP2001121186A (en) | Method for cleaning water utilizing bacteria as well as acquaculture method and system utilizing bacteria | |
| CN111838037A (en) | Mariculture production of growing seedlings trades water installation | |
| Manera et al. | Branchial osteogenetic neoplasm in barbel Barbus barbus plebejus | |
| Sampath et al. | Effects of density on food utilization and surfacing behaviour in the obligatory air-breathing fish Channa striatus |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant |