CN107969367B

CN107969367B - Fry separation equipment

Info

Publication number: CN107969367B
Application number: CN201711018440.XA
Authority: CN
Inventors: 刘宏汉
Original assignee: Chongqing Yuanchuan Ecological Agriculture Development Co ltd
Current assignee: Chongqing Yuanchuan Ecological Agriculture Development Co.,Ltd.
Priority date: 2017-10-27
Filing date: 2017-10-27
Publication date: 2021-04-06
Anticipated expiration: 2037-10-27
Also published as: CN107969367A

Abstract

The invention discloses fry separating equipment, which belongs to the technical field of culture devices and comprises a box body and a separating net arranged in the middle of the box body, wherein a baffle is arranged on the surface of the box body, a supporting plate is arranged above the baffle, electromagnets are uniformly distributed on the bottom surface of the supporting plate, a sweeper is arranged in a space between the baffle and the separating net, a collecting net is arranged at the bottom of the box body, and a gas head is uniformly distributed on the bottom surface of the box body.

Description

Fry separation equipment

Technical Field

The invention belongs to the technical field of culture devices, and particularly relates to fry separating equipment.

Background

The fish gonad development stage in spring is the fish gonad development stage, the food intake is increased, when the fish develops to the sexual maturity stage and becomes parent fish, in the artificial fry breeding work, the parent fish is usually placed into a breeding pond for natural breeding after being manually paired, then the parent fish is removed, the net is pulled to collect the fry, the parent fish may prey the fry or roes in the natural breeding process, the swimming of the parent fish has certain influence on the survival rate of the fry or roes, and the traditional artificial fry breeding method needs to be further improved.

Disclosure of Invention

The invention aims to provide fry separating equipment which can hatch fish eggs through separated collection, effectively avoid the conditions of mature and dystocia of parent fish glands and clean parent fish.

The technical scheme adopted by the invention for realizing the purpose is as follows: fry separating equipment comprises a box body, a separating net arranged in the middle of the box body, a baffle plate arranged on the surface of the box body, a support plate arranged above the baffle plate, electromagnets uniformly distributed on the bottom surface of the support plate, a sweeper arranged in the space between the baffle plate and the separating net, a collecting net arranged at the bottom of the box body, a gas head uniformly distributed on the bottom surface of the box body and connected with an oxygen pump outside the box body through a gas pipe, so as to effectively ensure the oxygen content in water in the box body to ensure the spawning amount and hatching effect of parent fishes, ensure stable oxygenation, prevent bubbles generated by oxygenation from greatly influencing the position and hatching effect of the spawns, the adopted support plate is made of iron, the baffle plate is made of rubber or plastic, the baffle plate, the separating net, the collecting net and the box body are identical in internal surface area, the spawning amount of the parent fishes is effectively and directly separated onto the collecting net through the separating net, the spawning amount, the roe that collects can directly incubate on collecting the net, if the roe of collecting is too much, can remove backup pad, baffle and separation net in proper order, and then will collect the roe on the net and take out, can place the removal part back to the box and continue to collect the roe or hatch the fry.

In order to optimize the technical scheme, the following further measures are taken: the middle parts of the separating net, the collecting net and the box body are provided with springs, so that the situation that the tension of the separating net and the collecting net is lower than the middle part of the separating net and the collecting net is concave can be avoided, the electromagnets are connected with the single chip microcomputer, and the sweeper is adsorbed and moved under the condition that the single chip microcomputer controls the on-off state of each electromagnet. The sweeper includes the floating block, the floating block below is equipped with the sponge strip of two spinal branch vaulting poles and equipartition, the iron plate is connected to the floating block top, the cross-section of bracing piece is greater than the mesh of separation net, can effectively support sweeper and sweeper magnet adsorption and receive its magnetic drive, make the sweeper move in the space content of placing parent fish, utilize the sponge strip to clean or adsorb large granule pollutant in the space of placing parent fish, can clean the parent fish body surface when the sponge strip passes through or is passed through by parent fish, do benefit to and keep quality of water clean effectively to prevent parent fish infection disease during breeding, and can reach the effect that drives parent fish when the sweeper receives the magnet drive, reach the mesh of consuming the internal fat of parent fish, effectively solved the parent fish and fed not move about for a long time, internal accumulation fat is too much, postpone the mature of gonad and the problem of dystocia. The bottom of the support rod is embedded with a rolling ball. Do benefit to the sweeper and remove on the separation net surface, avoid the bracing piece to lead to the fact the damage to the separation net, interval between the gas head is 1/6~1/4 of box overall length, the air current influences the roe when avoiding filling oxygen, the iron plate is equipped with wear-resistant coating with the baffle contact surface, the iron plate is adsorbed by electromagnet's magnetic force, the iron plate can lead to both surface area friction damage too big with the baffle long-term contact, iron fillings or the material that the friction falls or fall influence the effect that roe hatching or fry collected in the box, adopt wear-resistant coating effectively to improve the smoothness of contact surface, accelerate the removal rate of sweeper and improve the antifriction effect of iron plate and baffle. The baffle, the separation net, the collection net and the bottom surface of the box body are sequentially arranged at a distance ratio of 3-5:2:1, sufficient moving space can be provided for parent fish through arrangement of the distance ratio, meanwhile, the space for collecting roes or fish fries is not easy to be too large, the roes are easy to float and disperse, and a certain distance is arranged between the gas head at the bottom and the net tool, so that influence of bubbles generated when oxygen is added on the collected roes or fish fries is avoided. Light holes are uniformly distributed on the surfaces of the supporting plate and the baffle, the distance between the supporting plate and the baffle is 2-10 cm, the magnetic force of the electromagnet can be guaranteed to act on the sweeper, and water splashed when fish moves can be prevented from splashing on the electromagnet. The mesh size of the separation net is larger than that of the collection net, so that the condition that separated roes or fry cannot be effectively collected can be avoided, the box body can be made of transparent materials, and the parent fish activity, the egg laying quantity, the hatching condition or the fry collection condition can be conveniently observed.

Compared with the prior art, the invention has the beneficial effects that: 1) the spawning number of the fish is visually observed, the spawning number of the fish is well protected through the separation net, and the collected spawning can be directly hatched on the collection net; 2) the cleaning device can clean the body surface of the parent fish, is beneficial to keeping water clean and effectively preventing the parent fish from being infected and diseased during breeding, can achieve the effect of driving the parent fish to swim when the cleaner is driven by an electromagnet, achieves the purpose of consuming the fat accumulated in the parent fish body, and effectively solves the problems that the parent fish is not swim after being fed for a long time, the fat accumulated in the body is excessive, and the gonad maturity and dystocia are delayed; 3) adopt wear-resisting coating effectively to improve the smoothness of contact surface for the moving speed of sweeper just improves the antifriction effect of iron plate and baffle.

Drawings

FIG. 1 is a schematic view of the efficient and convenient seedling collection device of the present invention;

fig. 2 is a schematic view of the sweeper.

Description of reference numerals: 1, a baffle plate; 2, separating the net; 3, collecting a net; 4, air head; 5, a box body; 6, a gas conveying pipe; 7 an oxygen pump; 8, a singlechip; 9 a support plate; 10 an electromagnet; 11a sweeper; 11a wear resistant coating; 11b iron blocks; 11c a floating block; 11d sponge strips; 11e a support bar; 12 spring.

Detailed Description

The following detailed description, taken in conjunction with the examples and the accompanying drawings, makes progress:

example 1:

as shown in fig. 1 and 2, the fry separating device comprises a box body 5, a separating net 2 arranged in the middle of the box body 5, a baffle 1 arranged on the surface of the box body 5, a supporting plate 9 arranged above the baffle 1, an electromagnet 10 uniformly distributed on the bottom surface of the supporting plate 9, a sweeper 11 arranged in the space between the baffle 1 and the separating net 2, a collecting net 3 arranged at the bottom of the box body 5, an air head 4 uniformly distributed on the bottom surface of the box body 5, the supporting plate 9 adopted is made of iron material, the baffle 1 is made of rubber or plastic material, the baffle 1, the separating net 2, the collecting net 3 and the box body 5 have the same internal surface area, the separating net 2 effectively separates the eggs or the fries produced by parent fishes to the collecting net 3, the egg laying amount of the fishes can be visually observed, the eggs or the fries can be well protected by the separating net 2, the collected eggs can be directly hatched on the collecting net 3, if the collected eggs are, the supporting plate 9, the baffle 1 and the separating net 2 can be removed in sequence, then the fish eggs on the collecting net 3 can be taken out, and the removed part can be arranged back to the box body 5 to continuously collect the fish eggs or hatch the fry. The air head 4 is connected with the oxygen pump 7 outside the box body 5 through the air delivery pipe 6, so that the spawning amount and the hatching effect of the parent fish are effectively guaranteed by the oxygen content in the water in the box body 5, the oxygenation is stable, and the position and the hatching effect of the roe are greatly influenced by bubbles generated by the oxygenation.

The preferred ratio of the distances between the baffle 1, the separating net 2, the collecting net 3 and the bottom surface of the box body 5 is 3:2:1, sufficient moving space can be provided for parent fish by setting the distance ratio, meanwhile, the space for collecting roes or fry is not easy to be too large, otherwise, the roes are easy to float and disperse, and a certain distance is arranged between the gas head 4 at the bottom and the net tool, so that the influence of bubbles generated when oxygen is added on the collected roes or fry is avoided. Light holes are uniformly distributed on the surfaces of the supporting plate 9 and the baffle plate 1, the distance between the supporting plate 9 and the baffle plate 1 is preferably 5cm, the magnetic force of the electromagnet 10 can be ensured to act on the sweeper 11, and water splashed when fish moves can be prevented from splashing on the electromagnet 10. The mesh size of the separation net 2 is larger than that of the collection net 3, so that the condition that separated fish eggs or fish fries cannot be effectively collected can be avoided, and the box body 5 can be made of transparent materials, so that the activity, the egg laying amount, the hatching condition or the fish fry collecting condition of parent fishes can be observed conveniently.

The electromagnets 10 are all connected with the single chip microcomputer 8, the sweeper 11 is adsorbed and moved by controlling the power-on and power-off conditions of the electromagnets 10 through the single chip microcomputer, and a rolling ball is embedded at the bottom of the supporting rod 11 e. The distance between the air heads 4 is preferably 1/6 of the total length of the box body 5, so that the influence of air flow on fish eggs during oxygen filling is avoided, and the bottom of the support rod 11e is embedded with a rolling ball.

The middle parts of the separation net 2, the collection net 3 and the box body 5 are provided with springs 12, so that the situation that the middle parts of the separation net 2 and the collection net 3 are concave when the tension passes through the lower part can be avoided, the electromagnets are connected with the single chip microcomputer, and the sweeper is adsorbed and moved under the condition that the single chip microcomputer controls the on-off condition of each electromagnet.

Example 2:

as shown in fig. 1 and 2, the cleaner 11 includes a floating block 11c, two support rods 11e and sponge strips 11d uniformly distributed are arranged below the floating block 11c, an iron block 11b is connected above the floating block 11c, the cross section of the support rods 11e is larger than the mesh of the separation net 2, the cleaner 11 can be effectively supported, the magnet 10 of the cleaner 11 can adsorb and be driven by the magnetic force of the magnet, the cleaner 11 can move in the space for placing the parent fish, the sponge strips 11d can be used for cleaning or adsorbing large-particle pollutants in the space for placing the parent fish, when the sponge strips 11d pass through or are passed by the parent fish, the body surface of the parent fish can be cleaned, the water quality can be kept clean, the parent fish can be effectively prevented from being infected and diseased during the breeding period, the cleaner 11 can achieve the effect of driving the parent fish when being driven by the magnet 10, the purpose of consuming the fat accumulated in the swimming parent fish can be achieved, the problem that the parent fish cannot, excessive fat accumulation in the body and delay gonad maturation and dystocia. Iron plate 11b is equipped with wear-resistant coating 11a with 1 contact surface of baffle, iron plate 11b receives electromagnet 10's magnetic force to adsorb, iron plate 11b and baffle 1 long-term contact can lead to both surface area friction damage too big, the iron fillings or the material that the friction falls or fall the box 5 in influence the effect that roe hatching or fry collected, adopt wear-resistant coating 11a to effectively improve the smoothness of contact surface, accelerate sweeper 11's moving speed and improve iron plate 11b and baffle 1's antifriction effect.

The on-off condition of each electro-magnet 10 of singlechip 8 control, by left-most electro-magnet 10 to right-most electro-magnet 10 circular telegram in proper order, electro-magnet adsorbs sweeper 11 after left-most electro-magnet 10 circular telegram, singlechip 8 disconnection left-most electro-magnet 10's electric current 1 second back, electro-magnet 10 to left-most electro-magnet 10 right side circular telegram simultaneously, it adsorbs sweeper 11, cut off the power supply after 1 second, until cutting off the power supply to last side electro-magnet 10, realized that sweeper 11 is moved to the right side by box 5 left side, sweeper 11 cleans the parent fish body surface and drives the parent fish motion and still further sweeps the roe that parent fish produced off the separation net 2, make the roe reach collection net 3 surfaces fast.

Example 3:

the wear-resistant coating 11a is formed by coating wear-resistant paint on the surface of the iron block 11b and then curing the wear-resistant paint, and the wear-resistant paint comprises the following components in parts by weight: 32 parts of polyester modified acrylic resin, 7 parts of titanium dioxide, 12 parts of iron powder, 6 parts of fluoroolefin resin, 6 parts of superfine aluminum silicate, 0.04 part of L- (+) -2, 3-dihydroxypropionic acid, 0.001 part of L- (-) -2, 3-dihydroxypropionic acid, 0.03 part of regulator, 10 parts of bentonite, 17 parts of curing agent, 34 parts of graphite powder, 22 parts of toluene and 7 parts of water, wherein the curing agent is a mixture of a polyamide curing agent and a m-phenylenediamine curing agent, carbon dioxide gas is introduced into the wear-resistant coating for 20min in the preparation process, and the wear-resistant coating is prepared in an oscillator containing diamond. The prepared wear-resistant coating can be naturally cured at normal temperature for 10-15h after being coated with the iron block 11b, the Ra value of the formed wear-resistant coating 11a is 0.2, the cross-linking reaction of the coating components and oxygen can be accelerated by the L- (+) -2, 3-dihydroxypropionic acid and the L- (-) -2, 3-dihydroxypropionic acid in a special proportion, the effect of quick curing is realized, and the antifouling effect of the coating is further improved, and the regulator added in the coating is active polypeptide, the amino acid sequence of the active polypeptide is QSGFCTSYYCSKFCGTAYGCYNLTPGKICYCLHCSS, the bonding stability of each component of the coating can be adjusted, the material activity and the anisotropy of each component are improved, the formed wear-resistant coating 11a has good compactness and wear resistance, and smooth, the frictional resistance of the cleaner 11 in contact with the barrier 1 is small, and the moving speed of the cleaner 11 when driven by the electromagnet 10 is high.

Example 4:

the fry separating equipment of the invention is used as follows: the water temperature in the box body 5 is controlled at 10 ℃, the thrown grass carp starts to eat, the food intake increases along with the rising of the water temperature, the thrown feed mainly comprises malt, rice sprout and the like, occasionally vegetable leaves are added, 30-60 g of the feed is fed every tail every day, ryegrass, water plants and the like are used as staple food in the later period, the thrown feed amount is 2-6 percent of the weight of the grass carp, stopping feeding before spawning induction of the grass carps, replacing water in the box body 5 for 1 time every day, adopting an oxytocic to hasten spawning, wherein the injection amount is 0.03 unit/tail of each female fish, the dosage of the male fish is halved, can be mixed with normal saline for injection, the injector can be continuous quantitative injector, the injection part is dorsal fin basal muscle, the injection depth is 0.2cm, the artificial induced spawning grass carp is put back into the water tank 5, after the female fish ovulate, the fish eggs fall on the collecting net 3 to realize separation of the fish and the eggs, and the fish eggs are directly hatched to obtain the fry.

The conventional techniques in the above embodiments are known to those skilled in the art, such as oxygenation techniques, installation of nets, etc., and thus will not be described in detail herein.

The above embodiments are merely illustrative, and not restrictive, and those skilled in the art can make various changes and modifications without departing from the spirit and scope of the invention. Therefore, all equivalent technical solutions also belong to the scope of the present invention, and the protection scope of the present invention should be defined by the claims.

Sequence listing

<110> Punishes aquaculture technology Co., Ltd, Lanxi

<120> fry separating equipment

<160> 1

<170> SIPOSequenceListing 1.0

<210> 1

<211> 36

<212> PRT

<213> Artificial Synthesis (Mytilus corescuus)

<400> 1

Gln Ser Gly Phe Cys Thr Ser Tyr Tyr Cys Ser Lys Phe Cys Gly Thr

1 5 10 15

Ala Tyr Gly Cys Tyr Asn Leu Thr Pro Gly Lys Ile Cys Tyr Cys Leu

20 25 30

His Cys Ser Ser

35

Claims

1. Fry splitter, including box (5), settle separation net (2) in box (5) middle part, its characterized in that: the surface of the box body (5) is provided with a baffle (1), a supporting plate (9) is arranged above the baffle (1), electromagnets (10) are uniformly distributed on the bottom surface of the supporting plate (9), the electromagnets (10) are all connected with a single chip microcomputer (8), a sweeper (11) is placed in the space between the baffle (1) and the separating net (2), the bottom of the box body (5) is provided with a collecting net (3), gas heads (4) are uniformly distributed on the bottom surface of the box body (5), and the gas heads (4) are connected with an oxygen pump (7) on the outer side of the box body (5) through gas pipes (6); the sweeper (11) comprises a floating block (11c), two support rods (11e) and sponge strips (11d) which are uniformly distributed are arranged below the floating block (11c), an iron block (11b) is connected above the floating block (11c), and a wear-resistant coating (11a) is arranged on the contact surface of the iron block (11b) and the baffle (1); the bottom of the support rod (11e) is embedded with a rolling ball.

2. The fry separating apparatus of claim 1, wherein: springs (12) are arranged in the middle of the separation net (2), the collection net (3) and the box body (5).

3. The fry separating apparatus of claim 1, wherein: the distance between the air heads (4) is 1/6-1/4 of the total length of the box body (5).

4. The fry separating apparatus of claim 1, wherein: the baffle (1), the separation net (2), the collection net (3) and the bottom surface of the box body (5) are sequentially spaced at a ratio of 3-5:2: 1.

5. The fry separating apparatus of claim 1, wherein: backup pad (9) and baffle (1) surface equipartition light trap, backup pad (9) and baffle (1) interval are 2~10 cm.

6. The fry separating apparatus of claim 1, wherein: the mesh size of the separation net (2) is larger than that of the collection net (3).