CN107788229A - A kind of purposes of plant-based bacteriostat - Google Patents
A kind of purposes of plant-based bacteriostat Download PDFInfo
- Publication number
- CN107788229A CN107788229A CN201710626153.0A CN201710626153A CN107788229A CN 107788229 A CN107788229 A CN 107788229A CN 201710626153 A CN201710626153 A CN 201710626153A CN 107788229 A CN107788229 A CN 107788229A
- Authority
- CN
- China
- Prior art keywords
- parts
- plant
- weight
- based bacteriostat
- extraction
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/20—Inorganic substances, e.g. oligoelements
- A23K20/28—Silicates, e.g. perlites, zeolites or bentonites
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K10/00—Animal feeding-stuffs
- A23K10/30—Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K10/00—Animal feeding-stuffs
- A23K10/30—Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms
- A23K10/37—Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms from waste material
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/105—Aliphatic or alicyclic compounds
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/142—Amino acids; Derivatives thereof
- A23K20/147—Polymeric derivatives, e.g. peptides or proteins
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L3/00—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs
- A23L3/34—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals
- A23L3/3454—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals in the form of liquids or solids
- A23L3/3463—Organic compounds; Microorganisms; Enzymes
- A23L3/3472—Compounds of undetermined constitution obtained from animals or plants
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/70—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in livestock or poultry
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
- Y02P60/00—Technologies relating to agriculture, livestock or agroalimentary industries
- Y02P60/80—Food processing, e.g. use of renewable energies or variable speed drives in handling, conveying or stacking
- Y02P60/87—Re-use of by-products of food processing for fodder production
Abstract
The present invention provides a kind of purposes of plant-based bacteriostat, as feed anticorrosion agent and the application of livestock and poultry disease-resistant substance and growth promoter, suitable for each stage of its feeding, is had the beneficial effect that in feed according to 0.7 ~ 4.3 ‰ weight than addition：This plant-based bacteriostat can be used for the addition of each stage animal and fowl fodder；The composition comprehensive and reasonable of this plant-based bacteriostat, fungistatic effect is obvious, and antibacterial is directed to flora with wider；The stability of this plant-based bacteriostat is good, action and efficacy length；Preparation process of the present invention is simple and quick, can effectively extract ingredient in raw material, improves the utilization rate of raw material；This plant-based bacteriostat is added as feed, can effectively be extended the feed shelf-life, can also be improved the resistance against diseases of livestock and poultry, and can shorten the livestock and poultry cultivation cycle.
Description
Technical field
The invention belongs to antimicrobial technology field, and in particular to a kind of purposes of plant-based bacteriostat.
Background technology
Preservative is that rotten medicine is prevented by killing or suppressing microbial growth.Typically refer to natural or synthetic
Chemical composition, it is rotten caused by microorganism growth or chemical change to postpone for adding food, medicine, pigment, biological sample etc.
Lose.Preservative typically refers to the medicine for preventing skin of living body or mucous membrane from rotting, without referring to be used for lifeless object as outside
The thing medicine of section's apparatus sterilizing, the latter are referred to as disinfectant.
Plant extracts is a kind of composition that extraction purification comes out out of plant, includes flavones, polyphenol, alkaloid, wood
A variety of chemical compositions such as fat element, terpene and quinones, complicated component, chemical property is active, and often with similar same of a large amount of properties
It is the form of mixtures presence of thing, Extracts from Plant Recourses not only resists infringement of the herbivores to plant, while also prevents
Microorganism is infected, including improves the tolerance and protection injury to various pathogenic bacteria.In addition to plant pathogen, plant
Polyphenol can produce obvious inhibitory action to the microorganism in animal body and in other environment, to including fungi, bacterium, yeast
And the microorganism including virus etc. has resistance of wide spectrum.
In recent years, the research report of natural bacteriostatic material is a lot, and wherein the plant of good antimicrobial effect can be used as bateriostatics
The potential alternate source of matter, so as to be provided with the application value of research and economic value.The function of these antibacterial plants is a lot, such as plants
Air ambient can be purified by planting camphor tree etc.；Leaf of Diospyros kaki L.f not only has bacteriostasis, and can also releive gastrospasm, and nutrient health can
To develop as new tea beverage；Separately having has the Panongchus citri of bacteriostasis in the waste material after the processing such as tangerine peel and horseshoe skin, can
For the buffy layer in antibacterial, antitumaous effect horseshoe skin, at home and abroad there is more research.Natural antiseptic agent is not only to people
Body health is harmless, but also has certain nutritive value, and with going deep into for research, the natural antimicrobial substance being revealed is increasingly
It is more.According to the source of natural antiseptic agent, three classes are classified as, are extracted in natural plants, from the natural antiseptic agent of animal, come
Come from the natural antiseptic agent of microbiology class.Invention relates generally to the natural antimicrobial substance from plant.
Such as, Chinese invention patent mandate document, Authorization Notice No. is prior art：CN100556292C, the invention are related to
A kind of plant source antimicrobials for raising and its preparation method and application.By Pulsatilla plant extracts, pomegranate rind extract, breast
The pulvis that acid and carrier are prepared, the percentage by weight of the plant source antimicrobials for raising each component of preparation are：Pulsatilla plant carries
It is 40%~50% to take thing, and pomegranate rind extract is 20~30%, lactic acid 10~20%, and carrier is 20~25%.Will it is described it
Be added in feed according to 0.5~5 ‰ weight ratio in animal and fowl fodder, formed to livestock and poultry have promote growth and diseases prevention control
The compound feed of sick effect.But the composition for the anti-bacteria agent for feeding being somebody's turn to do is not comprehensive enough, for antibacterial strain it is limited, may cause
Livestock and poultry disease resistance is ineffective.
The content of the invention
It is an object of the invention to provide one kind can be added to the extension feed shelf-life in feed, and be suitable to each stage livestock and poultry
A kind of purposes of plant-based bacteriostat with disease-resistant growth-promoting effect of feed addition.
The present invention is for the scheme taken of solution above-mentioned technical problem：
A kind of purposes of plant-based bacteriostat, as feed anticorrosion agent and the application of livestock and poultry disease-resistant substance and growth promoter, suitable for livestock and poultry
Each stage of raising, according to 0.7 ~ 4.3 ‰ weight than addition in feed.
A kind of plant-based bacteriostat, its composition and its parts by weight are：3 ~ 14 parts of myrica rubra leaf, 5 ~ 20 parts of tangerine peel, chrysanthemum indicum 3 ~ 9
Part, 6 ~ 13 parts of aloe, 11 ~ 14 parts of granatum, 6 ~ 22 parts of the root of herbaceous peony, 3 ~ 8 parts of garlic, 5 ~ 17 parts of argy wormwood, 13 ~ 21 parts of Radix Isatidis, gold
6 ~ 12 parts of honeysuckle flower, 5 ~ 16 parts of purple perilla, 4 ~ 10 parts of Herba Andrographitis, 3 ~ 9 parts of selfheal, 7 ~ 10 parts of tea seed, 5 ~ 13 parts of carrier, this plant source
The good antimicrobial effect of bacteriostatic agent, for flora scope it is wide, can effectively play feed anticorrosion effect, extend the feed shelf-life, no
Only green non-pollution, growth of animals or poultry is may additionally facilitate, improve livestock and poultry resistance against diseases.
Preferably, carrier is modified talc powder, its composition and its parts by weight are：50 ~ 70 parts of talcum powder, laurate second two
1.2 ~ 1.8 parts of alcohol ester, α, ω-bis-（Three silyloxies）The poly- methyl of poly dimethyl（Polyoxyethylene poly-oxygen propylene aether base）Siloxanes
0.4 ~ 0.8 part；
Its preparation method is：By weight, dried talcum powder material is taken, the height for being fitted into temperature-controllable is mixed in device, and is added
Enter the laurate glycol ester and α, ω-bis- of formula ratio（Three silyloxies）The poly- methyl of poly dimethyl（Polyoxyethylene polyoxypropylene
Ether）Siloxanes, it is 85 ~ 123 DEG C to control high mixed device temperature, carries out 14 ~ 30min stirring, is taken out after stirring, produce and change
Property talcum powder, the particle diameter of modified talc powder is small, specific surface area is big, with plant-based bacteriostat other compositions it is compound produce compared with
Strong interfacial interaction, can be effectively as the carrier of each component molecules, and composition is well mixed in raising plant-based bacteriostat
Degree and stability.
Preferably, the preparation method of plant-based bacteriostat, its preparation process are：
a）Modified talc powder is prepared, it is standby；
b）By weight, tea seed is taken to be put into 14 ~ 36min of crushing in high speed disintegrator, standby, particle is straight after tea seed pulverization process
Footpath is small, can effectively improve the extraction of vegetable seed composition；
c）By weight, chrysanthemum indicum, the root of herbaceous peony, garlic, argy wormwood, Radix Isatidis, honeysuckle, purple perilla, Herba Andrographitis, selfheal is taken to wash
Only, dry, chop up, added water to submerge after adding the accelerator of 0.01 ~ 0.03 times of volume, carry out Ultrasonic Wave-Assisted Extraction, add 2
The water of ~ 5 times of volumes, extraction is decocted, decoct 34 ~ 62min every time, decocted respectively three times, merged filtering gained filtrate three times and carry out
Decoct, concentration filter liquor concentration to 0.8 ~ 1.1g/mL, obtain Chinese herbal medicine extract, standby, medicinal herb componentses first pass through extraction process,
Not only increase the utilization rate of active ingredient and the stability of composition in Chinese herbal medicine, it is thus also avoided that Chinese herbal medicine is directly added to livestock and poultry
Gastrointestinal disturbances cause to bear, so as to improve the growth promotion and disease-resistant energy of the fungistatic effect of this plant-based bacteriostat and lifting to livestock and poultry
Power；
d）By weight, myrica rubra leaf, tangerine peel, aloe, granatum is taken to clean, dry, shred, the tea seed and 3 added in step b
The distilled water of ~ 5 times of volumes, at 90 ~ 96 DEG C 6 ~ 8.5h of stirring extraction, extraction finish with filtered through gauze, take filtrate to be concentrated
It is 0.8 ~ 1.1g/mL to decoct to filter liquor concentration, obtains plant extracts, standby, the extraction process of plant extracts, improves plant
The utilization rate and action effect of composition；
e）The modified talc powder in step a is taken by weight, the plant added in Chinese herbal medicine extract and step d in step c
Extract uniformly mixes, and is put into mixer and stirs, and plant-based bacteriostat is made after drying process.
Preferably, accelerator is ethanol and active peptides, weight ratio is 1:0.2 ~ 0.4, the amino acid sequence of active peptides
It is classified as：HSHACASYYCSKHSKTACAKFCGTASCTHYLHYLCRVLHPGKLCACVNCSR, ethanol and activity are more in accelerator
The mutual cooperation of peptide, acts on cell membrane, destroys its integrality, promotes cellular content to overflow, so as to improve Chinese herbal medicine into
The recovery rate divided, can also significantly shorten extraction time, and the purity of extract is high, impurity is few, is not required to second extraction, reduces circulation
Process, bacteriostasis efficacy is improved, and save the energy needed for extraction.
Preferably, Ultrasonic Wave-Assisted Extraction water temperature is 33 ~ 42 DEG C in step c, ultrasonic power is 275 ~ 440w, the time
For 25 ~ 42min, Ultrasonic Wave-Assisted Extraction can accelerate extraction efficiency, save the energy.
Compared with prior art, beneficial effects of the present invention are:1）This plant-based bacteriostat is raised available for each stage livestock and poultry
The addition of material；2）The composition comprehensive and reasonable of this plant-based bacteriostat, fungistatic effect is obvious, and antibacterial is directed to bacterium with wider
Group；3）The stability of this plant-based bacteriostat is good, action and efficacy length；4）Preparation process of the present invention is simple and quick, can effectively extract
Ingredient in raw material, improve the utilization rate of raw material；5）This plant-based bacteriostat is added as feed, can effectively extend feed guarantor
The matter phase, the resistance against diseases of livestock and poultry can be also improved, and the livestock and poultry cultivation cycle can be shortened.
Embodiment
The present invention program is described in further detail with reference to embodiments：
Embodiment 1：
A kind of purposes of plant-based bacteriostat, as feed anticorrosion agent and the application of livestock and poultry disease-resistant substance and growth promoter, suitable for livestock and poultry
Each stage of raising, according to 0.7 ~ 4.3 ‰ weight than addition in feed.
A kind of plant-based bacteriostat, its composition and its parts by weight are：3 ~ 14 parts of myrica rubra leaf, 5 ~ 20 parts of tangerine peel, chrysanthemum indicum 3 ~ 9
Part, 6 ~ 13 parts of aloe, 11 ~ 14 parts of granatum, 6 ~ 22 parts of the root of herbaceous peony, 3 ~ 8 parts of garlic, 5 ~ 17 parts of argy wormwood, 13 ~ 21 parts of Radix Isatidis, gold
6 ~ 12 parts of honeysuckle flower, 5 ~ 16 parts of purple perilla, 4 ~ 10 parts of Herba Andrographitis, 3 ~ 9 parts of selfheal, 7 ~ 10 parts of tea seed, 5 ~ 13 parts of carrier, this plant source
The good antimicrobial effect of bacteriostatic agent, for flora scope it is wide, can effectively play feed anticorrosion effect, extend the feed shelf-life, no
Only green non-pollution, growth of animals or poultry is may additionally facilitate, improve livestock and poultry resistance against diseases.
Carrier is modified talc powder, and its composition and its parts by weight are：50 ~ 70 parts of talcum powder, laurate glycol ester 1.2 ~
1.8 parts, α, ω-bis-（Three silyloxies）The poly- methyl of poly dimethyl（Polyoxyethylene poly-oxygen propylene aether base）Siloxanes 0.4 ~ 0.8
Part；
Its preparation method is：By weight, dried talcum powder material is taken, the height for being fitted into temperature-controllable is mixed in device, and is added
Enter the laurate glycol ester and α, ω-bis- of formula ratio（Three silyloxies）The poly- methyl of poly dimethyl（Polyoxyethylene polyoxypropylene
Ether）Siloxanes, it is 85 ~ 123 DEG C to control high mixed device temperature, carries out 14 ~ 30min stirring, is taken out after stirring, produce and change
Property talcum powder, the particle diameter of modified talc powder is small, specific surface area is big, with plant-based bacteriostat other compositions it is compound produce compared with
Strong interfacial interaction, can be effectively as the carrier of each component molecules, and composition is well mixed in raising plant-based bacteriostat
Degree and stability.
The plant-based bacteriostat application disease-resistant as feed anticorrosion agent and livestock and poultry.
The preparation method of plant-based bacteriostat, its preparation process are：
a）Modified talc powder is prepared, it is standby；
b）By weight, tea seed is taken to be put into 14 ~ 36min of crushing in high speed disintegrator, standby, particle is straight after tea seed pulverization process
Footpath is small, can effectively improve the extraction of vegetable seed composition.
c）By weight, chrysanthemum indicum, the root of herbaceous peony, garlic, argy wormwood, Radix Isatidis, honeysuckle, purple perilla, Herba Andrographitis, selfheal are taken
Clean, dry, chop up, added water to submerge after adding the accelerator of 0.01 ~ 0.03 times of volume, carry out Ultrasonic Wave-Assisted Extraction, then add
Enter the water of 2 ~ 5 times of volumes, decoct extraction, decoct 34 ~ 62min every time, decoct respectively three times, merge filtering gained filtrate three times and enter
Row decocts, and concentration filter liquor concentration obtains Chinese herbal medicine extract, standby, medicinal herb componentses are first passed through at extraction to 0.8 ~ 1.1g/mL
Reason, not only increases the utilization rate of active ingredient and the stability of composition in Chinese herbal medicine, it is thus also avoided that Chinese herbal medicine directly adds pair
Livestock and poultry gastrointestinal disturbances cause to bear, so as to improve the fungistatic effect of this plant-based bacteriostat and lifting to the growth promotion of livestock and poultry and resist
Sick ability.
d）By weight, myrica rubra leaf, tangerine peel, aloe, granatum is taken to clean, dry, shred, the tea added in step b
The distilled water of seed and 3 ~ 5 times of volumes, at 90 ~ 96 DEG C 6 ~ 8.5h of stirring extraction, extraction finish with filtered through gauze, take filtrate to carry out
It is 0.8 ~ 1.1g/mL that concentration, which is decocted to filter liquor concentration, obtains plant extracts, standby, the extraction process of plant extracts, is improved
The utilization rate and action effect of plant component.
e）The modified talc powder in step a is taken by weight, is added in Chinese herbal medicine extract and step d in step c
Plant extracts uniformly mixes, and is put into mixer and stirs, and plant-based bacteriostat is made after drying process.
Accelerator is ethanol and active peptides, and weight ratio is 1:0.2 ~ 0.4, the amino acid sequence of active peptides is：
HSHACASYYCSKHSKTACAKFCGTASCTHYLHYLCRVLHPGKLCACVNCSR, ethanol and active peptides in accelerator
Cooperate, act on cell membrane, destroy its integrality, promote cellular content to overflow, so as to improve medicinal herb componentses
Recovery rate, also it can significantly shorten extraction time, and the purity of extract is high, impurity is few, is not required to second extraction, reduces circulation industrial
Sequence, bacteriostasis efficacy is improved, and save the energy needed for extraction.
Ultrasonic Wave-Assisted Extraction water temperature is 33 ~ 42 DEG C in step c, and ultrasonic power be 275 ~ 440w, the time for 25 ~
42min, Ultrasonic Wave-Assisted Extraction can accelerate extraction efficiency, save the energy.
Routine operation in the operating procedure of the present invention is well known to those skilled in the art, herein without repeating.
Embodiment 2：
A kind of purposes of plant-based bacteriostat, as feed anticorrosion agent and the application of livestock and poultry disease-resistant substance and growth promoter, suitable for livestock and poultry
Each stage of raising, according to 2.3 ‰ weight than addition in feed.
A kind of plant-based bacteriostat, when needing as feed preferably preservative, its composition and its parts by weight are：Red bayberry
12 parts of leaf, 16 parts of tangerine peel, 8 parts of chrysanthemum indicum, 10 parts of aloe, 12 parts of granatum, 10 parts of the root of herbaceous peony, 4 parts of garlic, 15 parts of argy wormwood, plate are blue
18 parts of root, 10 parts of honeysuckle, 14 parts of purple perilla, 8 parts of Herba Andrographitis, 7 parts of selfheal, 9 parts of tea seed, 6 parts of carrier, this plant-based bacteriostat
Composition comprehensive and reasonable, fungistatic effect is obvious, and with it is wider it is antibacterial be directed to flora, and stability is good, action and efficacy length, original
The utilization rate of material is high, and this plant-based bacteriostat is added as feed, can effectively extend the feed shelf-life.
Carrier is modified talc powder, and its composition and its parts by weight are：55 parts of talcum powder, 1.3 parts of laurate glycol ester, α,
ω-bis-（Three silyloxies）The poly- methyl of poly dimethyl（Polyoxyethylene poly-oxygen propylene aether base）0.5 part of siloxanes；
Its preparation method is：By weight, dried talcum powder material is taken, the height for being fitted into temperature-controllable is mixed in device, and is added
Enter the laurate glycol ester and α, ω-bis- of formula ratio（Three silyloxies）The poly- methyl of poly dimethyl（Polyoxyethylene polyoxypropylene
Ether）Siloxanes, it is 95 DEG C to control high mixed device temperature, carries out 15min stirring, is taken out after stirring, produce modified talc
Powder.
The plant-based bacteriostat application disease-resistant as feed anticorrosion agent and livestock and poultry.
The preparation method of plant-based bacteriostat, its preparation process are：
a）Modified talc powder is prepared, it is standby；
b）By weight, take tea seed to be put into high speed disintegrator and crush 18min, standby, particle diameter after tea seed pulverization process
It is small, the extraction of vegetable seed composition can be effectively improved；
c）By weight, chrysanthemum indicum, baiyao, garlic, argy wormwood, Radix Isatidis, honeysuckle, purple perilla, Herba Andrographitis, selfheal is taken to wash
Only, dry, chop up, added water to submerge after adding the accelerator of 0.02 times of volume, carry out Ultrasonic Wave-Assisted Extraction, add 3 times of bodies
Long-pending water, extraction is decocted, decocts 50min every time, decocted respectively three times, merged filtering gained filtrate three times and decocted, concentrated
Filter liquor concentration obtains Chinese herbal medicine extract to 0.9g/mL, standby；
d）By weight, myrica rubra leaf, tangerine peel, aloe, granatum is taken to clean, dry, shred, the tea seed and 4 added in step b
The distilled water of times volume, the stirring extraction 6.5h at 92 DEG C, extraction finish with filtered through gauze, take filtrate to carry out concentration and decoct to filter
Liquid concentration is 0.9g/mL, obtains plant extracts, standby；
e）The modified talc powder in step a is taken by weight, the plant added in Chinese herbal medicine extract and step d in step c
Extract uniformly mixes, and is put into mixer and stirs, and plant-based bacteriostat is made after drying process.
Accelerator is ethanol and active peptides, and weight ratio is 1:0.3, the amino acid sequence of active peptides is：
HSHACASYYCSKHSKTACAKFCGTASCTHYLHYLCRVLHPGKLCACVNCSR。
Ultrasonic Wave-Assisted Extraction water temperature is 35 DEG C, ultrasonic power 330w, time 26min in step c.
Routine operation in the operating procedure of the present invention is well known to those skilled in the art, herein without repeating.It is real
Apply example 3：
A kind of purposes of plant-based bacteriostat, as feed anticorrosion agent and the application of livestock and poultry disease-resistant substance and growth promoter, suitable for livestock and poultry
Each stage of raising, according to 1.5 ‰ weight than addition in feed.
A kind of plant-based bacteriostat, when needing as improving livestock and poultry resistance against diseases and promoting production, plant-based bacteriostat
Preparation method, its preparation process are：
a）By weight, dried 55 parts of talcum powder material is taken, the height for being fitted into temperature-controllable is mixed in device, and adds formula
1.3 parts of the laurate glycol ester and α, ω of amount-bis-（Three silyloxies）The poly- methyl of poly dimethyl（Polyoxyethylene polyoxypropylene
Ether）0.5 part of siloxanes, it is 95 DEG C to control high mixed device temperature, carries out 15min stirring, is taken out after stirring, produce modification
Talcum powder, it is standby；
b）By weight, take 7 parts of tea seed to be put into high speed disintegrator and crush 24min, it is standby；
c）By weight, take 7 parts of chrysanthemum indicum, 20 parts of the root of herbaceous peony, 8 parts of garlic, 10 parts of argy wormwood, 19 parts of Radix Isatidis, 8 parts of honeysuckle,
11 parts of purple perilla, 6 parts of Herba Andrographitis, 5 parts of selfheal are cleaned, dried, chopping up, and are added water to submerge after adding the accelerator of 0.03 times of volume,
Accelerator is ethanol and active peptides, and weight ratio is 1:~ 0.4, the amino acid sequence of active peptides is：
HSHACASYYCSKHSKTACAKFCGTASCTHYLHYLCRVLHPGKLCACVNCSR, Ultrasonic Wave-Assisted Extraction water temperature are 37 DEG C,
Ultrasonic power is 360w, carries out Ultrasonic Wave-Assisted Extraction 35min, adds the water of 4 times of volumes, decocts extraction, decocts every time
40min, decoct respectively three times, merge filtering gained filtrate three times and decocted, concentration filter liquor concentration obtains medium-height grass to 1.0g/mL
Medicament extract, it is standby；
d）By weight, take 8 parts of myrica rubra leaf, 12 parts of tangerine peel, 9 parts of aloe, 13 parts of granatum clean, dry, shredding, add step
The distilled water of tea seed and 4.5 times of volumes in rapid b, the stirring extraction 7h at 93 DEG C, extraction are finished with filtered through gauze, take filtrate to enter
It is 1.0g/mL that row concentration, which is decocted to filter liquor concentration, obtains plant extracts, standby；
e）The modified talc powder in step a is taken by weight, the plant added in Chinese herbal medicine extract and step d in step c
Extract uniformly mixes, and is put into mixer and stirs, and plant-based bacteriostat is made after drying process.
The plant-based bacteriostat application disease-resistant as feed anticorrosion agent and livestock and poultry.
The composition comprehensive and reasonable of this plant-based bacteriostat, fungistatic effect is obvious, and antibacterial is directed to flora with wider；This
The stability of plant-based bacteriostat is good, action and efficacy length；Preparation process of the present invention is simple and quick, can effectively extract contained in raw material
Composition, improve the utilization rate of raw material；This plant-based bacteriostat is added as feed, is remarkably improved the resistance against diseases of livestock and poultry, and
The livestock and poultry cultivation cycle can be shortened.
Routine operation in the operating procedure of the present invention is well known to those skilled in the art, herein without repeating.
Specific embodiment described herein is only to present invention explanation for example.The technical field of the invention
Technical staff can be made various modifications or supplement to described specific embodiment or be substituted using similar mode, but
Without departing from the present invention's or surmount scope defined in appended claims.
Sequence table
<110>Close big vast gardening research and development Co., Ltd in Pujiang County
<120>A kind of purposes of plant-based bacteriostat
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 51
<212> PRT
<213>Artificial synthesized (Mytilus coruscus)
<400> 1
His Ser His Ala Cys Ala Ser Tyr Tyr Cys Ser Lys His Ser Lys Thr
1 5 10 15
Ala Cys Ala Lys Phe Cys Gly Thr Ala Ser Cys Thr His Tyr Leu His
20 25 30
Tyr Leu Cys Arg Val Leu His Pro Gly Lys Leu Cys Ala Cys Val Asn
35 40 45
Cys Ser Arg
50
Claims (6)
- A kind of 1. purposes of plant-based bacteriostat, it is characterised in that：Described bacteriostatic agent is disease-resistant as feed anticorrosion agent and livestock and poultry The application of growth accelerator, suitable for each stage of its feeding, according to 0.7 ~ 4.3 ‰ weight than addition in feed.
- A kind of 2. purposes of plant-based bacteriostat according to claim 1, it is characterised in that：A kind of described plant source suppression Microbial inoculum composition and its parts by weight are：3 ~ 14 parts of myrica rubra leaf, 5 ~ 20 parts of tangerine peel, 3 ~ 9 parts of chrysanthemum indicum, 6 ~ 13 parts of aloe, granatum 11 ~ 14 parts, 6 ~ 22 parts of the root of herbaceous peony, 3 ~ 8 parts of garlic, 5 ~ 17 parts of argy wormwood, 13 ~ 21 parts of Radix Isatidis, 6 ~ 12 parts of honeysuckle, 5 ~ 16 parts of purple perilla, wear 4 ~ 10 parts of heart lotus, 3 ~ 9 parts of selfheal, 7 ~ 10 parts of tea seed, 5 ~ 13 parts of carrier.
- A kind of 3. plant-based bacteriostat according to claim 2, it is characterised in that the carrier is modified talc powder, its Composition and its parts by weight are：50 ~ 70 parts of talcum powder, 1.2 ~ 1.8 parts of laurate glycol ester, α, ω-bis-（Three silyloxies）It is poly- The poly- methyl of dimethyl（Polyoxyethylene poly-oxygen propylene aether base）0.4 ~ 0.8 part of siloxanes；Its preparation method is：By weight, dried talcum powder material is taken, the height for being fitted into temperature-controllable is mixed in device, and is added Enter the laurate glycol ester and α, ω-bis- of formula ratio（Three silyloxies）The poly- methyl of poly dimethyl（Polyoxyethylene polyoxypropylene Ether）Siloxanes, it is 85 ~ 123 DEG C to control high mixed device temperature, carries out 14 ~ 30min stirring, is taken out after stirring, produce and change Property talcum powder.
- A kind of 4. plant-based bacteriostat according to claim 2, it is characterised in that the preparation side of the plant-based bacteriostat Method, its preparation process are：a）Modified talc powder is prepared, it is standby；b）By weight, tea seed is taken to be put into 14 ~ 36min of crushing in high speed disintegrator, it is standby；c）By weight, chrysanthemum indicum, the root of herbaceous peony, garlic, argy wormwood, Radix Isatidis, honeysuckle, purple perilla, Herba Andrographitis, selfheal is taken to wash Only, dry, chop up, added water to submerge after adding the accelerator of 0.01 ~ 0.03 times of volume, carry out Ultrasonic Wave-Assisted Extraction, add 2 The water of ~ 5 times of volumes, extraction is decocted, decoct 34 ~ 62min every time, decocted respectively three times, merged filtering gained filtrate three times and carry out Decoct, concentration filter liquor concentration to 0.8 ~ 1.1g/mL, obtain Chinese herbal medicine extract, it is standby；d）By weight, myrica rubra leaf, tangerine peel, aloe, granatum is taken to clean, dry, shred, the tea seed and 3 added in step b The distilled water of ~ 5 times of volumes, at 90 ~ 96 DEG C 6 ~ 8.5h of stirring extraction, extraction finish with filtered through gauze, take filtrate to be concentrated It is 0.8 ~ 1.1g/mL to decoct to filter liquor concentration, obtains plant extracts, standby；e）The modified talc powder in step a is taken by weight, the plant added in Chinese herbal medicine extract and step d in step c Extract uniformly mixes, and is put into mixer and stirs, and plant-based bacteriostat is made after drying process.
- 5. the preparation method of plant-based bacteriostat according to claim 4, it is characterised in that the accelerator be ethanol and Active peptides, weight ratio are 1:0.2 ~ 0.4, the amino acid sequence of the active peptides is： HSHACASYYCSKHSKTACAKFCGTASCTHYLHYLCRVLHPGKLCACVNCSR。
- 6. the preparation method of plant-based bacteriostat according to claim 4, it is characterised in that ultrasonic wave in the step c Assisted Extraction water temperature is 33 ~ 42 DEG C, and ultrasonic power is 275 ~ 440w, and the time is 25 ~ 42min.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710626153.0A CN107788229A (en) | 2017-07-27 | 2017-07-27 | A kind of purposes of plant-based bacteriostat |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710626153.0A CN107788229A (en) | 2017-07-27 | 2017-07-27 | A kind of purposes of plant-based bacteriostat |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107788229A true CN107788229A (en) | 2018-03-13 |
Family
ID=61531089
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710626153.0A Withdrawn CN107788229A (en) | 2017-07-27 | 2017-07-27 | A kind of purposes of plant-based bacteriostat |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107788229A (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108617852A (en) * | 2018-03-28 | 2018-10-09 | 广西秀美壮乡能源环保有限公司 | One boar food insect-proof agent and preparation method thereof |
| CN109090163A (en) * | 2018-07-11 | 2018-12-28 | 王兰玺 | A kind of bacteriostatic agent and preparation method thereof of pure plant formula |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101218930A (en) * | 2007-12-12 | 2008-07-16 | 江苏省农业科学院 | Plant source antimicrobials for raising, preparation method and application thereof |
| CN102311669A (en) * | 2010-06-29 | 2012-01-11 | 中国石油天然气股份有限公司 | Modified talcpowder and preparation method thereof |
| CN106234439A (en) * | 2016-08-09 | 2016-12-21 | 北京赛特瑞科技发展有限公司 | A kind of superbacteria antibiosis and sterilization agent and its production and use |
-
2017
- 2017-07-27 CN CN201710626153.0A patent/CN107788229A/en not_active Withdrawn
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101218930A (en) * | 2007-12-12 | 2008-07-16 | 江苏省农业科学院 | Plant source antimicrobials for raising, preparation method and application thereof |
| CN102311669A (en) * | 2010-06-29 | 2012-01-11 | 中国石油天然气股份有限公司 | Modified talcpowder and preparation method thereof |
| CN106234439A (en) * | 2016-08-09 | 2016-12-21 | 北京赛特瑞科技发展有限公司 | A kind of superbacteria antibiosis and sterilization agent and its production and use |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108617852A (en) * | 2018-03-28 | 2018-10-09 | 广西秀美壮乡能源环保有限公司 | One boar food insect-proof agent and preparation method thereof |
| CN109090163A (en) * | 2018-07-11 | 2018-12-28 | 王兰玺 | A kind of bacteriostatic agent and preparation method thereof of pure plant formula |
| CN109090163B (en) * | 2018-07-11 | 2020-09-18 | 广州她她生物科技有限公司 | Bacteriostatic agent with pure plant formula and preparation method thereof |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN104365696A (en) | Chinese herbal medicinal disinfectant for breeding industry | |
| CN106818905A (en) | A kind of cultivation Chinese herbal disinfectant and preparation method thereof | |
| CN106192057A (en) | A kind of Multifunctional polyester fiber containing sea mud and preparation method thereof | |
| CN107439897A (en) | A kind of plant-based bacteriostat | |
| JP2003238343A (en) | Depressant for melanine production or cosmetic composition | |
| US20110293760A1 (en) | Method for extracting substances from soapberry fruit and seed and products made therefrom | |
| CN107788229A (en) | A kind of purposes of plant-based bacteriostat | |
| KR100847478B1 (en) | Composition for functional soap comprising gold or silver nanoparticle and extraction polymer of black nightshade as effective ingredients, and production method thereof | |
| CN107494905A (en) | A kind of preparation method of plant-based bacteriostat | |
| KR101465696B1 (en) | Antibacterial and insect resistance composition | |
| CN105123783B (en) | A kind of Crazing in grassland culicifuge | |
| CN104892146A (en) | Fertilizer applicable to application in fruit swelling period of orange trees and preparation method of fertilizer | |
| KR20030069500A (en) | The preparation of fermentation Fig-vinegar using korean drug agent and fig fruit | |
| CN108935536A (en) | A kind of natural drug and preparation method thereof inhibiting wawter bloom | |
| CN105362140A (en) | Non-cosmetics preservative composition with anticorrosion effect and application of non-cosmetics preservative composition | |
| KR100807842B1 (en) | Anti-fungal composition for deodorization | |
| JP2004018492A (en) | Histamine release inhibitor, antiallergic agent and cosmetic composition | |
| CN105534816A (en) | Natural pet shampoo | |
| JP2003095967A (en) | Anti-allergic medicine | |
| JP2003321379A (en) | Antiallergic agent | |
| JP2014001194A (en) | Plant disease treatment solution and method for producing the same | |
| CN107496207A (en) | A kind of Ramulus Cinnamomi Volatile oil with antibacterial anti-inflammatory activity and its preparation method and application | |
| CN107951813A (en) | A kind of antibacterial anti-inflammatory anti-acne repairs facial mask | |
| CN108671123A (en) | A kind of spray and its extractive technique for treating tinea pedis | |
| CN109527001A (en) | A kind of disinfectant and preparation method thereof for ward bedding |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20180313 |