WO2023128051A1 - 돼지생식기호흡기증후군바이러스 유래 펩타이드를 발현하는 키메라 바이러스 및 이를 포함하는 백신 조성물 - Google Patents

돼지생식기호흡기증후군바이러스 유래 펩타이드를 발현하는 키메라 바이러스 및 이를 포함하는 백신 조성물 Download PDF

Info

Publication number
WO2023128051A1
WO2023128051A1 PCT/KR2022/001653 KR2022001653W WO2023128051A1 WO 2023128051 A1 WO2023128051 A1 WO 2023128051A1 KR 2022001653 W KR2022001653 W KR 2022001653W WO 2023128051 A1 WO2023128051 A1 WO 2023128051A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
virus
nucleic acid
acid sequence
polynucleotide
Prior art date
Application number
PCT/KR2022/001653
Other languages
English (en)
French (fr)
Inventor
차상호
강석진
유수화
현방훈
조선희
박창훈
Original Assignee
주식회사 바이오포아
대한민국(농림축산식품부 농림축산검역본부장)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020210193459A external-priority patent/KR20230102954A/ko
Priority claimed from KR1020210193458A external-priority patent/KR20230102953A/ko
Application filed by 주식회사 바이오포아, 대한민국(농림축산식품부 농림축산검역본부장) filed Critical 주식회사 바이오포아
Publication of WO2023128051A1 publication Critical patent/WO2023128051A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/66—Microorganisms or materials therefrom
    • A61K35/76—Viruses; Subviral particles; Bacteriophages
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof

Definitions

  • a chimeric virus expressing a porcine reproductive and respiratory syndrome virus (PRRSV) derived peptide (T cell epitope) and its use as a vaccine are provided.
  • the chimeric virus has excellent immune stimulating effect and is useful as a vaccine that can effectively protect by suppressing viral amplification in target cells.
  • PRRS Porcine Reproductive and Respiratory Syndrome
  • porcine circovirus infection and foot-and-mouth disease is an infectious disease that causes the greatest damage to the domestic pig farming industry.
  • PRRS causes infertility in pregnant sows, abortion, premature birth, stillbirth, reproductive disorders, and respiratory symptoms such as sneezing and fever in suckling pigs and pigs.
  • severe respiratory symptoms are caused by secondary infection such as bacteria after being infected with a virus, but when chronically infected, weight gain decreases and mortality increases without characteristic clinical symptoms.
  • the causative agent of PRRS is a PRRS virus belonging to the genus Arterivirus, family Arteriviridae, order Nidovirales.
  • PRRS virus has a positive-sense single-stranded RNA genome, and its size is about 15.4 kilobases.
  • the PRRS virus genome has 9 ORFs (Conzelmann et al., 1993; Meulenberg et al., 1993). Among them, ORF1a and ORF1b, which encode non-structural proteins (NSP), account for about 80% of the viral genome (Bautista et al., 2002; Meulenberg et al., 1993; Snijder and Meulenberg, 1998, 2001).
  • NSP1-alpha, NSP-1 beta, and NSP2 to NSP8 are known to be located in ORF1a, and NSP9 to NSP12 in ORF1b.
  • the glycosylated structural proteins GP2, GP3, GP4, and GP5, as well as non-glycosylated membrane (M) and nucleocapsid (N) proteins are encoded by ORF2-7, which accounts for the remaining 20%.
  • Minor structural proteins GP2, GP3, and GP4 form heterotrimers to act when viruses invade host cells, and major structural proteins GP5 and M form heterodimers to enhance viral infectivity.
  • PRRS viruses are highly variable due to the characteristics of RNA viruses, so there are many differences between viruses. PRRS viruses are largely divided into North American and European types. Type I (Lelystad virus, LV) representing the European type and Type II representing the Northern American strain ATCC VR2332 (genBank accession number AY150564 for the genome sequence of VR2332) (Murtaugh et al., Arch Virol. 1995; 140:1451-1460).
  • Type I Lelystad virus, LV
  • Type II representing the Northern American strain ATCC VR2332 (genBank accession number AY150564 for the genome sequence of VR2332) (Murtaugh et al., Arch Virol. 1995; 140:1451-1460).
  • the present invention provides a vaccine strain that is low in pathogenicity and high in stability, discovers peptides capable of activating cellular immunity using reverse genetics, and expresses them.
  • One example provides a chimeric virus expressing a T cell epitope loaded with a porcine reproductive and respiratory syndrome virus (PRRSV)-derived T cell epitope.
  • PRRSV porcine reproductive and respiratory syndrome virus
  • Another example provides a vaccine composition comprising the chimeric virus.
  • Another example provides a method for producing the chimeric virus.
  • the chimeric virus as a genome
  • nucleic acid sequence of ORF1a and ORF1b derived from a PRRS type II virus or a nucleic acid sequence having at least 70% sequence homology with the nucleic acid sequence while maintaining functional equivalence thereto;
  • the nucleic acid sequences (1), (2) and (3) may be arranged in the 5' ⁇ 3' direction in order.
  • nucleic acid sequences of ORF1a and ORF1b derived from the PRRS type II virus may be represented by SEQ ID NO: 1 or SEQ ID NO: 2.
  • the nucleic acid sequence encoding the porcine reproductive and respiratory syndrome virus-derived T cell epitope-EP7 may be a nucleic acid sequence encoding the amino acid of SEQ ID NO: 3, and more specifically, may be one represented by SEQ ID NO: 4.
  • the nucleic acid sequence encoding the porcine reproductive and respiratory syndrome virus-derived T cell epitope-EP8 may be a nucleic acid sequence encoding the amino acid of SEQ ID NO: 12, and more specifically, may be represented by SEQ ID NO: 10.
  • the nucleic acid sequence of the ORF2 to ORF7 regions of the BP2017-2 virus may be represented by SEQ ID NO: 5.
  • the present invention relates to a chimeric virus of porcine reproductive and respiratory syndrome (PRRS) virus that can be used as a vaccine.
  • PRRS porcine reproductive and respiratory syndrome
  • the PRRSV chimeric virus of the present invention is attenuated compared to the parent strain, so it has low pathogenicity and high stability, and remarkably enhances the immunity of pigs by enhancing the secretion of neutralizing antibodies capable of cross-immunity. Thus, it can be used as a vaccine for effective prevention and treatment of PRRS disease.
  • Attenuated virus as used herein also refers to an avirulent virus that is capable of eliciting an immune response in a target mammal without causing clinical signs of PRRS disease, and also refers to an attenuated virus infected with an attenuated virus and capable of eliciting an immune response in a target mammal. It also means that the incidence of clinical signs is reduced in animals that have not been administered, or that the severity of signs is reduced compared to "control" animals infected with a non-attenuated PRRS virus.
  • the term “reduced/reduced” means a reduction of at least 10%, preferably 25%, more preferably 50%, and most preferably 100% or more, relative to the control as defined above.
  • a "vaccine composition” may be a PRRS chimeric virus or any immunogenic fragment or fraction thereof, preferably an attenuated PRRS chimeric virus, such as the PRRS chimeric virus of the present invention above. This elicits an "immunological response" of the host as a cellular and/or antibody mediated immune response to PRRSV. It is preferred that the vaccine composition is capable of conferring prophylactic immunity against PRRSV infection and the clinical signs associated therewith.
  • immune response refers to any cell- and/or antibody-mediated immune response to a chimeric virus or vaccine administered to an animal administered with the PRRSV chimeric virus of the present invention, or a vaccine composition comprising the same.
  • an “immune response” includes, but is not limited to, one or more of the following effects: antibodies, B cells, helper T cells specifically directed against the antigen or antigens included in the composition or vaccine. , production or activation of suppressor T cells and/or cytotoxic T cells and/or ⁇ T cells.
  • the host preferably exhibits a therapeutic or prophylactic immunological response such that resistance to the new infection is improved and/or the clinical severity of the disease is reduced compared to a control group not receiving the immunogenic composition or vaccine.
  • a therapeutic or prophylactic immunological response such that resistance to the new infection is improved and/or the clinical severity of the disease is reduced compared to a control group not receiving the immunogenic composition or vaccine.
  • prophylaxis will be evidenced by a reduction in frequency or severity, including absence of, and up to, symptoms associated with the host infection described above.
  • pigs As used herein, the terms “pigs,” “pig,” and “pig” may be used interchangeably with each other in equivalent meaning.
  • vaccinate means administering a chimeric virus of PRRSV described herein or a vaccine comprising the same prior to exposure to PRRS disease.
  • prevent refers to a decrease in the incidence, severity or frequency of symptoms of PRRS as a result of administration of the PRRSV virus or vaccine composition comprising the same of the present invention.
  • a decrease in severity or frequency may be a result of comparison with an animal or group of animals not administered with the PRRSV chimeric virus of the present invention or a vaccine composition comprising the same.
  • the animal may preferably be a pig.
  • nucleic acid sequence of the present specification is described based on DNA nucleotides for convenience, and when the type of polynucleotide is RNA (eg, PRRS virus genome), all or part of thymine (Thymine, T) in the base sequence is uracil ( It means a sequence substituted with Uracil, U).
  • RNA eg, PRRS virus genome
  • Thymine, T thymine
  • U uracil
  • a polynucleotide which can be used interchangeably with “gene” or a polypeptide (which can be used interchangeably with “protein”) means “comprising or consisting of a specific nucleic acid sequence or amino acid sequence or “expressed” may mean that the polynucleotide or polypeptide essentially includes the specific nucleic acid sequence or amino acid sequence, and the extent to which the original function and / or desired function of the polynucleotide or polypeptide is maintained It can be interpreted as including (or not excluding the mutation) a “substantially equivalent sequence” in which a mutation (deletion, substitution, modification, and/or addition) is added to the specific nucleic acid sequence or amino acid sequence in .
  • a polynucleotide or polypeptide “comprises, consists of, or is represented by a particular nucleic acid sequence or amino acid sequence” means that the polynucleotide or polypeptide (i) comprises the particular nucleic acid sequence or amino acid sequence. or (ii) at least 70%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95% of the specified nucleic acid sequence or amino acid sequence.
  • identity refers to the degree of identity with a given nucleic acid sequence or amino acid sequence and can be expressed as a percentage (%).
  • algorithm BLAST according to the literature (reference: Karlin and Altschul, Pro. Natl. Acad. Sci. USA, 90, 5873, 1993) or FASTA according to Pearson (reference: Methods Enzymol ., 183, 63, 1990) can be used to determine Based on this algorithm BLAST, a program called BLASTN or BLASTX has been developed (see: http://www.ncbi.nlm.nih.gov).
  • nucleic acid sequence or base sequence refers to sequence information of bases included in nucleotides of a nucleic acid molecule (eg, oligonucleotide or polynucleotide) including two or more nucleotides (DNA or RNA) or having the base sequence It may mean a nucleic acid molecule.
  • construction means inserting a gene into a cell to recover the infectivity of the virus produced by transduction into the cell, thereby exhibiting a denaturing effect in the cell.
  • an attenuated chimeric virus mutant of porcine reproductive and respiratory syndrome virus PRRSV
  • Another example provides a polynucleotide, and the polynucleotide may constitute a genome of the chimeric virus mutant.
  • chimeric virus means that a part of the genome of porcine reproductive and respiratory syndrome virus (PRRSV) of one species is replaced (substituted) with a corresponding genome part of PRRSV of another species.
  • PRRSV porcine reproductive and respiratory syndrome virus
  • the chimeric virus is a PRRS type II virus, such as LMY parent strain (Accession No. GenBank accession no.DQ473474.1) or PRRSV, accession number KCTC 13394BP, ORF1a and ORF1b regions derived from LMY ver2 virus (NSP1 ) and the ORF2 to ORF7 regions of the BP2017-2 virus of PRRSV accession number KCTC 13393BP.
  • PRRS type II virus such as LMY parent strain (Accession No. GenBank accession no.DQ473474.1) or PRRSV, accession number KCTC 13394BP, ORF1a and ORF1b regions derived from LMY ver2 virus (NSP1 ) and
  • the chimeric virus mutant is a mutation added to the chimeric virus of PRRSV, more specifically, it may mean a mutation added to express T cell epitope-EP7 derived from PRRSV, which is an EP7 expressing chimeric virus mutant or It is named PRRSV-EP7 chimeric virus.
  • the EP7-expressing chimeric virus mutant induces interferon-gamma (IFN-gamma) by stimulating PBMCs (peripheral blood mononuclear cells) of pigs infected with PRRS virus (type I and/or type II), and amplifies the virus in target cells.
  • IFN-gamma interferon-gamma
  • PBMCs peripheral blood mononuclear cells
  • PRRS virus type I and/or type II
  • T cell epitope-EP7 is part of the amino acid sequence of the membrane protein of PRRSV, and when stimulating PBMC isolated from pigs infected with PRRSV, interferon gamma is induced, and when inoculated into pigs infected with PRRSV, high levels in PBMC It was confirmed that the interferon gamma was induced.
  • the chimeric virus mutant is a mutation added to the chimeric virus of PRRSV, and more specifically, may mean a mutation added to express T cell epitope-EP8 derived from PRRSV, which is an EP8 expressing chimeric virus mutant or It is named PRRSV-EP8 chimeric virus.
  • the EP8-expressing chimeric virus mutant induces interferon-gamma (IFN-gamma) by stimulating PBMCs (peripheral blood mononuclear cells) of pigs infected with PRRS virus (type I and/or type II), and amplifies the virus in target cells.
  • IFN-gamma interferon-gamma
  • PBMCs peripheral blood mononuclear cells
  • PRRS virus type I and/or type II
  • T cell epitope-EP8 is part of the amino acid sequence of the membrane protein of PRRSV, and when stimulating PBMC isolated from pigs infected with PRRSV, interferon gamma is induced, and when inoculated into pigs infected with PRRSV, high levels in PBMC It was confirmed that the interferon gamma was induced.
  • polynucleotide represented by structure 1 is represented by structure 1:
  • nucleotides may be further included between [X] and [Y] and between [Y] and [Z], but is not limited thereto.
  • [X] is a PRRS type II virus, such as the NSP1 gene (NSP1-alpha gene and NSP1- 70% or more (or 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more) within the range of maintaining the nucleic acid sequence of the beta gene; ORF1a and ORF1b) or an equivalent function to the nucleic acid sequence at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5%; hereinafter the same applies) to nucleic acid sequences having sequence identity
  • the nucleic acid sequence of the NSP1 gene of the LMY ver2 virus may be represented by SEQ ID NO: 2
  • the nucleic acid sequence of the NSP1 gene of the LMY parent strain may be represented by SEQ ID NO: 1.
  • the [Y] is a nucleic acid sequence encoding T cell epitope-EP7 (LLAFSITYTPVMIYALKVSRGRLLGL; SEQ ID NO: 3), a PRRSV-derived membrane protein, or 70% or more (or 75% or more, 80% or more) of the nucleic acid sequence while maintaining functional equivalence thereto % or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5% It may be a nucleic acid sequence having sequence homology of the above; hereinafter the same applies).
  • the EP7 encoding nucleic acid sequence is 70% or more (or 75% or more, 80% or more, 85% or more, 90% or more, 90% or more, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5%; the same applies hereafter) of sequence homology It may be a nucleic acid sequence having.
  • [Y] may be a modified EP7 encoding nucleic acid sequence.
  • the modified EP7 encoding nucleic acid sequence in addition to the EP7 encoding nucleic acid sequence, AscI restriction enzyme recognition site (GGCGCGCC; SEQ ID NO: 8), Kozak sequence (GCCACC; SEQ ID NO: 13) and transcription regulatory sequence (TRS) (eg TRS6: GTTCCGTGGCAACCCCTATAACCAGAGTTTCAGCGGAACA; SEQ ID NO: 14) may further include one or more selected from the group consisting of.
  • the AscI restriction enzyme recognition site may be included at both ends of the EP7 encoding nucleic acid sequence, respectively.
  • the Kozak sequence and/or the transcriptional regulatory sequence are each independently the 5' end and/or the 3' end of the EP7 encoding nucleic acid sequence, for example, the Kozak sequence is at the 5' end, the transcriptional regulatory sequence (TRS6) is may be included at the 3' end.
  • [Y] is the EP7 encoding nucleic acid sequence (e.g., SEQ ID NO: 4), the Kozak sequence located at the 5' end of the EP7 encoding nucleic acid sequence (e.g., SEQ ID NO: 13), the EP7 encoding nucleic acid sequence It may include TRS6 (e.g., SEQ ID NO: 14) located at the 3' end, and an AscI restriction enzyme recognition site (SEQ ID NO: 8) located at the 5' end of the Kozak sequence and the 3' end of the TRS6, respectively.
  • TRS6 e.g., SEQ ID NO: 14
  • SEQ ID NO: 8 AscI restriction enzyme recognition site
  • the [Y] is a nucleic acid sequence encoding T cell epitope-EP8 (LWGVYSAIETWKFITSRCRLCLLGRKYILAPAHHVESA; SEQ ID NO: 12), a membrane protein derived from PRRSV, or 70% or more (or 75% or more, 80% or more) of the nucleic acid sequence while maintaining functional equivalence thereto % or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5% It may be a nucleic acid sequence having sequence homology of the above; hereinafter the same applies).
  • the EP8 encoding nucleic acid sequence is 70% or more (or 75% or more, 80% or more, 85% or more, 90% or more, 90% or more, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5%; the same applies hereafter) of sequence homology It may be a nucleic acid sequence having.
  • [Y] may be a modified EP8 encoding nucleic acid sequence.
  • the modified EP8 encoding nucleic acid sequence in addition to the EP8 encoding nucleic acid sequence, AscI restriction enzyme recognition site (GGCGCGCC; SEQ ID NO: 8), Kozak sequence (GCCACC; SEQ ID NO: 13) and transcription regulatory sequence (TRS) (eg TRS6: GTTCCGTGGCAACCCCTATAACCAGAGTTTCAGCGGAACA; SEQ ID NO: 14) may further include one or more selected from the group consisting of.
  • the AscI restriction enzyme recognition site may be included at both ends of the EP8 encoding nucleic acid sequence, respectively.
  • the Kozak sequence and/or the transcriptional regulatory sequence are each independently the 5' end and/or the 3' end of the EP8 encoding nucleic acid sequence, for example, the Kozak sequence is at the 5' end, the transcriptional regulatory sequence (TRS6) is may be included at the 3' end.
  • the [Y] is an EP8 encoding nucleic acid sequence (e.g., SEQ ID NO: 10), a Kozak sequence located at the 5' end of the EP8 encoding nucleic acid sequence (e.g., SEQ ID NO: 13), the EP8 encoding nucleic acid sequence It may include TRS6 (e.g., SEQ ID NO: 14) located at the 3' end, and an AscI restriction enzyme recognition site (SEQ ID NO: 8) located at the 5' end of the Kozak sequence and the 3' end of the TRS6, respectively.
  • TRS6 e.g., SEQ ID NO: 14
  • SEQ ID NO: 8 AscI restriction enzyme recognition site
  • At least 70% or at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92% of the nucleic acid sequence of SEQ ID NO: 21 while maintaining the nucleic acid sequence of SEQ ID NO: 21 or functional equivalence thereof at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5%; the same applies hereinafter) of sequence homology. there is.
  • the [Z] is 70% or more (or 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5% or more; The same applies) may be a nucleic acid sequence having sequence homology.
  • equivalent function can mean a function that is qualitatively (activity) and/or quantitatively (level) identical or similar to the desired function.
  • amino acid sequence of the protein encoded by the gene may be identical to the amino acid sequence of the protein encoded by the wild-type gene.
  • the [X] is the NSP1 gene of the LMY parent strain (Accession No. GenBank accession no.DQ473474.1.) consisting of the NSP1 encoding nucleic acid sequence derived from PRRS type II virus, for example, the nucleic acid sequence of SEQ ID NO: 1 It may include all kinds of point mutations (silent mutations) that occur within a range in which the nucleic acid sequence or the amino acid sequence of the NSP1 protein encoded by the NSP1 gene remains the same in the nucleic acid sequence, for example, the above Mutations may be freely selected and used within a range of purposes for lowering the CPB (Codon Pair Bias) level of the NSP1 gene.
  • CPB Codon Pair Bias
  • the CPB Codon Pair Bias
  • the CPB means a bias caused by interaction when viral gene codons are arranged in pairs, and can be quantified using a computer algorithm. Since it is attenuated (Virus Attenuation by Genome-Scale Changes in Codon Pair Bias, Science, 2008, J. Robert Coleman et al.), some nucleotide sequences with high CPB levels are replaced with nucleotide sequences with low CPB levels, or codon pairs According to the deoptimization principle, an attenuated mutant of LMY used in the production of the chimeric virus provided herein can be prepared by silent mutation.
  • bases to be substituted among the nucleotide sequences of the gene encoding NSP1 of the LMY parent strain for attenuation may be selected using a known Synthetic Attenuated Virus Engineering (SAVE) program.
  • SAVE Synthetic Attenuated Virus Engineering
  • the [X] region in the present specification analyzes the genetically safe NSP1 region in the genome of the parent strain, LMY, and selects and replaces some or all of the regions with relatively high Codon Pair Bias (CPB) Deoptimization It may be a sequence of nucleotides.
  • the [X] is (i) the nucleic acid sequence of the NSP1 gene represented by SEQ ID NO: 1, or (ii) the nucleic acid sequence of SEQ ID NO: 1, position 222, position 225, position 237, position 240 Position No.
  • At least one, at least 25, at least 66, at least 80, or at least 91 bases selected from the group consisting of positions may include substitution mutations.
  • the [X] is (i) the nucleic acid sequence of the NSP1 gene represented by SEQ ID NO: 1, or (ii) a mutation in which G at position 222 is substituted with C in the nucleic acid sequence of SEQ ID NO: 1, 225 A mutation in which C at position 237 is substituted with C, A in position 240 is substituted with T, T in position 252 is substituted by C, and position 306 is substituted by T A mutation in which A is substituted with C, T at position 309 is substituted with C, G at position 312 is substituted with A, C at position 315 is substituted with A, T at position 324 A mutation in which C is substituted with C, a mutation in which C at position 327 is substituted with G, a mutation in which G at position 330 is substituted with A, C at position 333 is substituted with T, C at position 336 is G , T at position 339 is substituted with C, A at position 342 is substituted with T, T at position 345 is substituted by T
  • the attenuated mutant strain of LMY prepared by introducing the above mutation may be the LMY ver2 virus of Accession No. 13394BP, and the LMY ver2 virus may have a nucleic acid sequence of SEQ ID NO: 2 as a gene encoding the NSP1 protein. .
  • [X] is the nucleic acid sequence of the NSP1 gene (SEQ ID NO: 2) of the LMY ver2 virus having accession number 13394BP, the nucleic acid sequence of the NSP1 gene (SEQ ID NO: 1) of the LMY parent strain, or a function equivalent to the above nucleic acid sequence At least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% of the sequence It may be a nucleic acid sequence having homology.
  • the LMY mutant sequence provided herein such as the sequence of LMY ver2 (SEQ ID NO: 2), may have a lower Codon Pair Bias (CPB) than the wild-type LMY site, and the wild-type LMY site is SEQ ID NO: It may consist of a nucleic acid sequence of 1, but is not limited thereto.
  • CPB Codon Pair Bias
  • the [Y] is a nucleic acid sequence encoding the porcine reproductive and respiratory syndrome virus-derived T cell epitope-EP7 of the amino acid sequence LLAFSITYTPVMIYALKVSRGRLLGL (SEQ ID NO: 3), such as the nucleic acid sequence of SEQ ID NO: 4 or a functional equivalent thereof 70% or more (or 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5% or more; the same applies hereinafter) of sequence homology.
  • SEQ ID NO: 3 amino acid sequence LLAFSITYTPVMIYALKVSRGRLLGL
  • [Y] may further include at least one selected from the group consisting of AscI restriction enzyme recognition site (SEQ ID NO: 8), Kozak sequence (SEQ ID NO: 13), and TRS6 (SEQ ID NO: 14), For example, 70% or more (or 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5% or more; hereinafter the same applies).
  • AscI restriction enzyme recognition site SEQ ID NO: 8
  • Kozak sequence SEQ ID NO: 13
  • TRS6 SEQ ID NO: 14
  • 70% or more or 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5%
  • the [Y] is a nucleic acid sequence encoding the porcine reproductive and respiratory syndrome virus-derived T cell epitope-EP8 of the amino acid sequence LWGVYSAIETWKFITSRCRLCLLGRKYILAPAHHVESA (SEQ ID NO: 12), such as the nucleic acid sequence of SEQ ID NO: 10 or a functional equivalent thereof 70% or more (or 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5% or more; the same applies hereinafter) of sequence homology.
  • [Y] may further include at least one selected from the group consisting of AscI restriction enzyme recognition site (SEQ ID NO: 8), Kozak sequence (SEQ ID NO: 13), and TRS6 (SEQ ID NO: 14), For example, 70% or more (or 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5% or more; hereinafter the same applies).
  • AscI restriction enzyme recognition site SEQ ID NO: 8
  • Kozak sequence SEQ ID NO: 13
  • TRS6 SEQ ID NO: 14
  • 70% or more or 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5%
  • the [Z] is a nucleic acid sequence of the ORF2 to ORF7 region of the BP2017-2 virus having accession number KCTC 13393BP, for example, the nucleic acid sequence of SEQ ID NO: 5, or 70% within a range that maintains a function equivalent to the sequence
  • [A]n may be further included at the 3' end of [Z] in Structural Formula 1.
  • n is the number of nucleotides including base A, and may be an integer from 10 to 100.
  • 10 to 80, 10 to 70, 10 to 60, 10 to 50, 10 to 40, 10 to 30, 15 to 80, 15 to 70, 15 to 60, 15 to 50, 15 to 40, 15 to 30 , 20 to 30, may be an integer of 20 to 26.
  • the polynucleotide is DNA, RNA (when the nucleic acid sequence is expressed on the basis of DNA, all or some thymine (T) in the sequence is a sequence in which uracil (U) is substituted), reverse transcript of the RNA ( DNA), or a combination thereof.
  • the polynucleotide may have a function as a genome of a PRRSV chimeric virus.
  • another embodiment of the present invention provides a chimeric virus mutant of porcine reproductive and respiratory syndrome virus (PRRSV) comprising a polynucleotide having the structure of Structural Formula 1 above.
  • PRRSV porcine reproductive and respiratory syndrome virus
  • the chimeric virus mutant may include a polynucleotide having the structure of Structural Formula 1 as a genome.
  • the term 'chimeric virus mutant' refers to (a) PRRS type II virus, such as LMY parent strain (Accession No. GenBank accession no.DQ473474.1) or NSP1 gene (ORF1a) of LMY ver2 virus with Accession No.
  • PRRS type II virus such as LMY parent strain (Accession No. GenBank accession no.DQ473474.1) or NSP1 gene (ORF1a) of LMY ver2 virus with Accession No.
  • chimeric virus comprising ORF2 to ORF7 of BP2017-2 virus having accession number KCTC 13393BP (c) modified by introducing T cell epitope-EP7 encoding gene derived from porcine reproductive and respiratory syndrome virus In order to express the virus, it can also be expressed as 'chimeric virus containing T cell epitope-EP7 encoding gene', 'EP7 expression chimeric virus', 'PRRSV-EP7 chimeric virus', or abbreviated as 'PRRSV chimeric virus'.
  • the term 'chimeric virus mutant' refers to (a) PRRS type II virus, such as LMY parent strain (Accession No. GenBank accession no.DQ473474.1) or NSP1 gene (ORF1a) of LMY ver2 virus with Accession No.
  • PRRS type II virus such as LMY parent strain (Accession No. GenBank accession no.DQ473474.1) or NSP1 gene (ORF1a) of LMY ver2 virus with Accession No.
  • chimeric virus comprising ORF2 to ORF7 of BP2017-2 virus having accession number KCTC 13393BP (c) modified by introducing T cell epitope-EP8 coding gene derived from porcine reproductive and respiratory syndrome virus To express the virus, it can also be expressed as 'chimeric virus containing T cell epitope-EP8 coding gene', 'chimeric virus expressing EP8', 'PRRSV-EP8 chimeric virus', or abbreviated as 'chimeric virus of PRRSV'.
  • the genome of the PRRSV chimeric virus mutant may be DNA or RNA, preferably RNA.
  • the polynucleotide having the structure of Structural Formula 1 (the genome of a chimeric virus mutant of PRRSV) may not be natural, and may be recombinantly or synthetically produced.
  • the structural formula 1 is 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more within the range of maintaining the nucleic acid sequence of SEQ ID NO: 6 or equivalent function to the nucleic acid sequence.
  • a nucleic acid sequence having at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence homology may be the nucleic acid sequence of SEQ ID NO: 6.
  • the structural formula 1 is 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more within the range of maintaining the nucleic acid sequence of SEQ ID NO: 11 or equivalent function to the nucleic acid sequence.
  • a nucleic acid sequence having at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence homology may be the nucleic acid sequence of SEQ ID NO: 11.
  • the polynucleotide (RNA) provided herein may include a nucleic acid sequence in which T is substituted with U among the sequences described above, and the T cell epitope-EP7 introduced in Table 2, respectively.
  • the nucleic acid sequence of (Modified T cell epitope-EP7) and/or T cell epitope-EP8 (Modified T cell epitope-EP8) is underlined
  • the chimeric virus of PRRSV comprising the polynucleotide of structural formula 1 as its genome is 1 to 80, 1 to 70, 1 to 60, 1 to 50, 1 to 40, 1 to 30, and 1 to 20.
  • 1 to 10 passages, or 1 to 5 passages may include cultured progeny viruses.
  • PRRSV-EP7 a PRRSV chimeric virus comprising a nucleic acid sequence including the polynucleotide of SEQ ID NO: 6 as a genome, and named PRRSV-EP7.
  • the PRRSV-EP7 virus may be a virus having accession number KCTC 14269BP.
  • PRRSV chimeric virus comprising a nucleic acid sequence including the polynucleotide of SEQ ID NO: 11 as a genome, and named rPRRSV-EP8.
  • the rPRRSV-EP8 virus may be a virus having accession number KCTC 14270BP.
  • another example provides a vector including the polynucleotide of structural formula 1 (e.g., a genome of a chimeric virus mutant of PRRSV).
  • the vector may be obtained recombinantly and may be used as a carrier or expression vector of the polynucleotide.
  • Another example is to provide a cell containing the polynucleotide of structural formula 1 (e.g., the genome of a chimeric virus mutant of PRRSV; RNA, DNA, or both), or a vector containing the same.
  • the cell may be obtained recombinantly, and in order to produce a large amount of the chimeric virus mutant, the genome (RNA, DNA, or vector containing the same) of the chimeric virus mutant, or the chimeric virus mutant containing the genome is transfected. It means a cell to be speculated, and the type of cell is not particularly limited as long as it is within the above target range.
  • porcine reproductive and respiratory syndrome virus vaccine comprising at least one selected from the group consisting of the polynucleotide of Structural Formula 1, a vector containing the same, and a chimeric virus mutant of PRRSV comprising the polynucleotide of Structural Formula 1 as a genome. composition is provided.
  • porcine reproductive and respiratory syndrome including at least one selected from the group consisting of the polynucleotide of Structural Formula 1, a vector containing the same, and a chimeric virus mutant of PRRSV comprising the polynucleotide of Structural Formula 1 as a genome. and/or pharmaceutical compositions for treatment.
  • the porcine reproductive and respiratory syndrome may be caused by porcine reproductive and respiratory syndrome virus (PRRSV).
  • a pharmaceutically effective amount of at least one selected from the group consisting of the polynucleotide of Structural Formula 1, a vector containing the polynucleotide, and a chimeric virus mutant of PRRSV comprising the polynucleotide of Structural Formula 1 as a genome is applied to the porcine reproductive and respiratory syndrome virus.
  • Immunization against porcine reproductive and respiratory syndrome virus, or porcine reproductive and respiratory syndrome virus infection comprising administering to a subject in need of immunization against porcine reproductive and respiratory syndrome virus infection or porcine reproductive and respiratory syndrome virus infection or prevention and/or treatment of porcine reproductive and respiratory syndrome virus infection or a method for preventing and/or treating porcine reproductive and respiratory syndrome.
  • the subject may be an animal other than human, for example, a pig.
  • the PRRSV chimeric virus mutant may include subcultured progeny.
  • the subcultured progeny are 1 to 80, 1 to 70, 1 to 60, 1 to 50, 1 to 40, 1 to 30, 1 to 20, 1 to 10, or 1 to 5 It may include a subcultured progeny virus.
  • the vaccine may be a live vaccine or a killed vaccine, but preferably a live vaccine.
  • the attenuated PRRS chimeric virus variants described herein may be modified live vaccines containing one or more of the aforementioned virus strains in a viable state in a pharmaceutically acceptable carrier. Additionally, or alternatively, inactivated virus may be used to prepare killed vaccines.
  • the vaccine may further include one or more selected from the group consisting of a carrier, a diluent, an excipient, and an adjuvant.
  • a carrier a diluent
  • an excipient a diluent
  • an adjuvant an adjuvant
  • the type of pharmaceutically acceptable carrier is not particularly limited, but may include any and all solvents, dispersion media, coatings, stabilizers, preservatives, antibacterial and antifungal agents, isotonic agents, absorption delaying agents, and the like.
  • the genome of the PRRSV-EP7 chimeric virus mutant provided herein, and a vaccine composition comprising the same, can be used to prevent pigs from the effects of PRRS disease.
  • Subunits, including immunogenic fragments or fractions of rPRRSV-EP7 chimeric virus variants, can also be used to prevent pigs from the effects of PRRS disease.
  • the attenuated chimeric virus variant of the present invention or a vaccine composition containing the same can be administered prophylactically before pigs are exposed to a PRRS virus strain causing PRRS, and can be administered to pigs simultaneously with exposure to the virus strain. It can be administered therapeutically after exposure of the target pig to the virus strain.
  • the genome of the PRRSV-EP8 chimeric virus mutant provided herein, and a vaccine composition comprising the same, can be used to prevent pigs from the effects of PRRS disease.
  • subunits including immunogenic fragments or fractions of the rPRRSV-EP8 chimeric virus variant can also be used to prevent pigs from the effects of PRRS disease.
  • the attenuated chimeric virus variant of the present invention or a vaccine composition containing the same can be administered prophylactically before pigs are exposed to a PRRS virus strain causing PRRS, and can be administered to pigs simultaneously with exposure to the virus strain. It can be administered therapeutically after exposure of the target pig to the virus strain.
  • Vaccine compositions provided herein may be used to prevent porcine reproductive and respiratory syndrome (PRRS) and/or porcine reproductive and respiratory syndrome virus (PRRSV) infection, e.g., infection with and/or resulting from North American PRRSV and/or European PRRSV. It can be used for prevention of PRRS.
  • PRRS porcine reproductive and respiratory syndrome
  • PRRSV porcine reproductive and respiratory syndrome virus
  • the North American type PRRSV may be a type II VR2332 virus strain
  • the European type PRRSV may be a type I virus (Lelystad virus, LV), but is not limited thereto.
  • the pharmaceutical composition for preventing and/or treating porcine reproductive and respiratory syndrome described above may include additional components known to those skilled in the art, and may further include appropriate carriers, excipients, and diluents commonly used in the preparation of pharmaceutical compositions. there is.
  • oral formulations such as powders, granules, tablets, capsules, suspensions, emulsions, syrups, aerosols, external preparations, suppositories and sterile injection solutions according to conventional methods.
  • Suitable formulations known in the art are preferably those disclosed in the literature (Remington's Pharmaceutical Science, recently, Mack Publishing Company, Easton PA).
  • Carriers, excipients and diluents that may be included in the pharmaceutical composition include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxy benzoate, propylhydroxy benzoate, talc, magnesium stearate and mineral oil.
  • composition When the composition is formulated, it is prepared using diluents or excipients such as commonly used fillers, extenders, binders, wetting agents, disintegrants, and surfactants.
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, etc. These solid preparations are prepared by mixing at least one excipient such as starch, calcium carbonate, sucrose, lactose, gelatin, etc. with the composition. is prepared In addition to simple excipients, lubricants such as magnesium stearate and talc are also used.
  • Liquid preparations for oral administration include suspensions, internal solutions, emulsions, syrups, etc.
  • Formulations for parenteral administration include sterilized aqueous solutions, non-aqueous solvents, suspensions, emulsions, freeze-dried formulations, and suppositories.
  • Propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate may be used as non-aqueous solvents and suspending agents.
  • Witepsol, Macrogol, Tween 61, cacao butter, laurin paper, glycerogeratin and the like may be used as a base for the suppository.
  • a preferred dosage of the pharmaceutical composition varies depending on the condition and body weight of the subject, the severity of the disease, the type of drug, the route and duration of administration, but can be appropriately selected by those skilled in the art.
  • the composition of the present invention may be administered in an amount of 0.0001 to 1,000 mg/kg (body weight) per day.
  • the administration of the composition may be administered once a day or divided into several times.
  • the pharmaceutical composition may be a vaccine composition.
  • the vaccine may be a live vaccine and/or a killed vaccine, and specifically, the attenuated PRRS chimeric virus described herein may be a modified live vaccine containing one or more strains of the virus described above in a viable state in a pharmaceutically acceptable carrier. . Additionally, or alternatively, inactivated virus may be used to prepare killed vaccines.
  • the vaccine may include a PRRSV mutant at an appropriate concentration in consideration of the weight, age, dietary stage and / or immunity of the subject to be administered within the range of PRRS prevention purposes.
  • the dose of the virus mutant in the vaccine composition ranges from TCID 50 2 to 6, or TCID 50 3 to 4, but may vary depending on the type of subject, but is not limited thereto.
  • the composition may be administered in the range of TCID 50 (Median Tissue Culture Infectious Dose; virus concentration that infects 50% of cells) 2 to 6, or TCID 50 3 to 4, based on the content of the PRRSV-EP7 chimeric virus mutant, It may vary depending on the type of entity, but is not limited thereto.
  • the administration of the composition may be administered once a day or divided into several times.
  • the composition can be administered in the range of TCID 50 (Median Tissue Culture Infectious Dose; virus concentration that infects 50% of cells) 2 to 6, or TCID 50 3 to 4, based on the content of the PRRSV-EP8 chimeric virus mutant, It may vary depending on the type of entity, but is not limited thereto.
  • the administration of the composition may be administered once a day or divided into several times.
  • composition of the present invention can be administered to a subject by various routes. All modes of administration can be envisaged.
  • the chimeric virus mutant of PRRSV provided herein or a composition containing the same is administered via parenteral administration such as oral, subcutaneous, intramuscular, intradermal, sublingual, transdermal, rectal, transmucosal, surface area, buccal administration through inhalation, or a combination thereof.
  • parenteral administration such as oral, subcutaneous, intramuscular, intradermal, sublingual, transdermal, rectal, transmucosal, surface area, buccal administration through inhalation, or a combination thereof.
  • PRRS chimeric virus mutants can be administered in the form of implants that allow sustained release of the virus.
  • the chimeric virus mutant or a composition containing the same may be administered by subcutaneous injection, intravenous injection, intradermal injection, parenteral injection, intramuscular injection, needle free injection, electroporation, oral delivery, intranasal delivery, orally. It may be administered by oronasal delivery, or any combination thereof.
  • the chimeric virus mutant of PRRSV or a composition comprising the same may be administered through injection, inhalation or transplantation, and injection is particularly preferred.
  • the chimeric virus or composition comprising it may be administered once or several times, and also intermittently, eg in different doses daily for days, weeks or months.
  • Injections may be administered by injection in desired amounts or by spraying subcutaneously or intranasally, or alternatively by continuous infusion.
  • At least one selected from the group consisting of a polynucleotide represented by Structural Formula 3 below, a vector containing the same, and a chimeric virus mutant of PRRSV comprising the polynucleotide of Structural Formula 3 as a genome may be used (combined) together:
  • [X] is the same as in Structural Formula 1 described above, that is, a PRRS type II virus, such as LMY parent strain (Accession No. GenBank accession no.DQ473474.1) or having accession number KCTC 13394BP 70% or more (or 75%) of the nucleic acid sequence (e.g., SEQ ID NO: 2) of the NSP1 gene (NSP1-alpha gene and NSP1-beta gene; ORF1a and ORF1b) of the LMY ver2 virus or a function equivalent to the nucleic acid sequence is maintained.
  • LMY parent strain accesion No. GenBank accession no.DQ473474.1
  • KCTC 13394BP accession number 13394BP 70% or more (or 75%) of the nucleic acid sequence (e.g., SEQ ID NO: 2) of the NSP1 gene (NSP1-alpha gene and NSP1-beta gene; ORF1a and ORF1b) of the LM
  • nucleic acid sequence having sequence homology may include a nucleic acid sequence having sequence homology, for example, the nucleic acid sequence of the NSP1 gene of the LMY ver2 virus may be represented by SEQ ID NO: 2, , The nucleic acid sequence of the NSP1 gene of the LMY parent strain may be represented by SEQ ID NO: 1.
  • the [Ya] is a nucleic acid sequence encoding T cell epitope-EP7 (LLAFSITYTPVMIYALKVSRGRLLGL; SEQ ID NO: 3), a membrane protein derived from PRRSV, or 70% or more (or 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5 % or more; hereinafter the same applies) may be a nucleic acid sequence having sequence homology, and specifically, the EP7-encoded nucleic acid sequence is 70% of the nucleic acid sequence of SEQ ID NO: 4 or the sequence of SEQ ID NO: 4 while maintaining functional equivalence thereto.
  • [Ya] may be a modified EP7 encoding nucleic acid sequence.
  • the modified EP7 encoding nucleic acid sequence in addition to the EP7 encoding nucleic acid sequence, AscI restriction enzyme recognition site (SEQ ID NO: 8), Kozak sequence (SEQ ID NO: 13) and transcriptional regulatory sequence (e.g., TRS6 (SEQ ID NO: 14)) It may further include one or more selected from the group consisting of.
  • the AscI restriction enzyme recognition site may be included at both ends of the EP7 encoding nucleic acid sequence, respectively.
  • the Kozak sequence and/or the transcriptional regulatory sequence are each independently at the 5' end and/or the 3' end of the EP7 encoding nucleic acid sequence, for example, the Kozak sequence is at the 5' end and the transcriptional regulatory sequence (TRS6) is at the 5' end. may be included at the 3' end.
  • the [Ya] is the EP7 encoding nucleic acid sequence (e.g., SEQ ID NO: 4), the Kozak sequence located at the 5' end of the EP7 encoding nucleic acid sequence (e.g., SEQ ID NO: 13), the EP7 encoding nucleic acid sequence It may include TRS6 (e.g., SEQ ID NO: 14) located at the 3' end, and an AscI restriction enzyme recognition site (SEQ ID NO: 8) located at the 5' end of the Kozak sequence and the 3' end of the TRS6, respectively.
  • TRS6 e.g., SEQ ID NO: 14
  • SEQ ID NO: 8 AscI restriction enzyme recognition site
  • At least 70% or at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92% with the sequence of SEQ ID NO: 20 while maintaining the nucleic acid sequence of SEQ ID NO: 20 or functional equivalence thereto
  • 93% or more 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5% or more; hereinafter the same applies).
  • the [Yb] is a nucleic acid sequence encoding T cell epitope-EP8 (LWGVYSAIETWKFITSRCRLCLLGRKYILAPAHHVESA; SEQ ID NO: 12), a membrane protein derived from PRRSV, or 70% or more (or 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5 % or more; hereinafter the same applies) may be a nucleic acid sequence having sequence homology, and specifically, the EP8-encoded nucleic acid sequence is 70% of the nucleic acid sequence of SEQ ID NO: 10 or the sequence of SEQ ID NO: 10 while maintaining functional equivalence thereto.
  • [Yb] may be a modified EP8 encoding nucleic acid sequence.
  • the modified EP8 encoding nucleic acid sequence in addition to the EP8 encoding nucleic acid sequence, AscI restriction enzyme recognition site (SEQ ID NO: 8), Kozak sequence (SEQ ID NO: 13) and transcriptional regulatory sequence (e.g., TRS6 (SEQ ID NO: 14)) It may further include one or more selected from the group consisting of.
  • the AscI restriction enzyme recognition site may be included at both ends of the EP8 encoding nucleic acid sequence, respectively.
  • the Kozak sequence and/or the transcriptional regulatory sequence are each independently the 5' end and/or the 3' end of the EP8 encoding nucleic acid sequence, for example, the Kozak sequence is at the 5' end, the transcriptional regulatory sequence (TRS6) is may be included at the 3' end.
  • [Yb] is the EP8 encoding nucleic acid sequence (e.g., SEQ ID NO: 10), the Kozak sequence located at the 5' end of the EP8 encoding nucleic acid sequence (e.g., SEQ ID NO: 13), the EP8 encoding nucleic acid sequence It may include TRS6 (e.g., SEQ ID NO: 14) located at the 3' end, and an AscI restriction enzyme recognition site (SEQ ID NO: 8) located at the 5' end of the Kozak sequence and the 3' end of the TRS6, respectively.
  • TRS6 e.g., SEQ ID NO: 14
  • SEQ ID NO: 8 AscI restriction enzyme recognition site
  • At least 70% or at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92% with the sequence of SEQ ID NO: 21 while maintaining the nucleic acid sequence of SEQ ID NO: 21 or functional equivalence thereto
  • 93% or more 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, or 99.5% or more; hereinafter the same applies).
  • the [Z] is the same as in Structural Formula 1 described above, that is, the gene nucleic acid sequence of the ORF2 to ORF7 region of the BP2017-2 virus having accession number KCTC 13393BP (e.g., SEQ ID NO: 5) or a function equivalent to the nucleic acid sequence is maintained 70% or more within range (or 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% It may be a nucleic acid sequence having a sequence identity of at least 98%, at least 99%, or at least 99.5%; the same applies hereinafter).
  • porcine reproductive and respiratory syndrome virus vaccine composition comprising a.
  • Another example is
  • porcine reproductive and respiratory syndrome may be caused by porcine reproductive and respiratory syndrome virus (PRRSV).
  • PRRSV porcine reproductive and respiratory syndrome virus
  • Another example is
  • porcine reproductive and respiratory syndrome virus comprising the step of concomitantly administering a pharmaceutically effective amount to a subject in need of immunization against porcine reproductive and respiratory syndrome virus, or prevention of porcine reproductive and respiratory syndrome virus infection or prevention of porcine reproductive and respiratory syndrome virus
  • a method for immunization or prophylaxis of porcine reproductive and respiratory syndrome virus infection or prophylaxis of porcine reproductive and respiratory syndrome is provided.
  • the subject may be an animal other than human, for example, a pig.
  • the PRRSV chimeric virus and/or its variants may include subcultured progeny.
  • the subcultured progeny are 1 to 80, 1 to 70, 1 to 60, 1 to 50, 1 to 40, 1 to 30, 1 to 20, 1 to 10, or 1 to 5 It may include a subcultured progeny virus.
  • the PRRSV-EP7 chimeric virus may react with the blood of the recipient, for example, peripheral blood mononuclear cells (PBMC) to express or increase the expression of cytokines such as IFN-gamma.
  • PBMCs peripheral blood mononuclear cells
  • the IFN-gamma is about 1.05 times or more, about 1.1 times higher than the genome of the PRRSV chimeric virus in which the EP7 gene is not inserted, and the vaccine composition containing the same.
  • 1.3-fold, 1.5-fold, 1.7-fold, 1.9-fold, or 2.1-fold, or 2.5-fold, 3.0-fold, or 3.5-fold. can express more.
  • the PRRSV-EP7 chimeric virus can stimulate PBMCs of pigs infected with PRRS.
  • the amount of infected PRRSV is about 0.7-fold or less, about 0.5-fold or less, about 0.4-fold or less, about 0.3-fold or less, or about 0.2-fold, compared to unstimulated PBMCs. to about 0.3 times.
  • the PRRSV-EP8 chimeric virus may react with the blood of the recipient, for example, peripheral blood mononuclear cells (PBMC) to express or increase the expression of cytokines such as IFN-gamma.
  • PBMCs peripheral blood mononuclear cells
  • the IFN-gamma is increased by about 1.1 times or more, about 1.3 times, compared to the genome of the PRRSV chimeric virus in which the EP8 gene is not inserted, and the vaccine composition containing the same.
  • the PRRSV-EP8 chimeric virus can stimulate PBMCs of pigs infected with PRRS.
  • the amount of infected PRRSV is about 0.7-fold or less, about 0.5-fold or less, about 0.4-fold or less, about 0.3-fold or less, or about 0.2-fold, compared to unstimulated PBMCs. to about 0.3 times.
  • Another example is
  • the step (2) may be performed by chemically or recombinantly synthesizing the nucleic acid sequence below, or by treating both ends of the genome of the PRRSV-EP7 virus with AscI.
  • the resulting polynucleotide fragment may include an EP7 encoding nucleic acid sequence (eg, SEQ ID NO: 4) and AscI recognition sites (SEQ ID NO: 8) at both ends of the EP7 encoding nucleic acid sequence.
  • the step (2) further includes inserting a kozak sequence (SEQ ID NO: 13) at the front (5' end) of the EP7 encoding nucleic acid sequence and TRS6 (SEQ ID NO: 14) at the end (3' end) of the EP7 encoding nucleic acid sequence. can do.
  • the polynucleotide fragment obtained in step (2) includes the EP7 encoding nucleic acid sequence (SEQ ID NO: 4), the Kozak sequence (SEQ ID NO: 13) located at the 5' end of the EP7 encoding nucleic acid sequence, and the EP7 encoding nucleic acid sequence.
  • TRS6 SEQ ID NO: 14
  • SEQ ID NO: 8 AscI restriction enzyme recognition site located at the 5' end of the Kozak sequence and the 3' end of the TRS6, respectively. It may be represented by the nucleic acid sequence of SEQ ID NO: 20.
  • the step (2) may be performed by chemically or recombinantly synthesizing the nucleic acid sequence below, or treating both ends of the genome of the PRRSV-EP8 virus with AscI.
  • the obtained polynucleotide fragment may include an EP8 encoding nucleic acid sequence (eg, SEQ ID NO: 10) and AscI recognition sites (SEQ ID NO: 8) at both ends of the EP8 encoding nucleic acid sequence.
  • the step (2) further includes inserting a kozak sequence (SEQ ID NO: 13) at the front (5' end) of the EP8 encoding nucleic acid sequence and TRS6 (SEQ ID NO: 14) at the end (3' end) of the EP8 encoding nucleic acid sequence. can do.
  • the polynucleotide fragment obtained in step (2) includes the EP8 encoding nucleic acid sequence (SEQ ID NO: 10), the Kozak sequence (SEQ ID NO: 13) located at the 5' end of the EP8 encoding nucleic acid sequence, and the EP8 encoding nucleic acid sequence.
  • TRS6 SEQ ID NO: 14
  • SEQ ID NO: 8 AscI restriction enzyme recognition site located at the 5' end of the Kozak sequence and the 3' end of the TRS6, respectively. It may be represented by the nucleic acid sequence of SEQ ID NO: 21.
  • the polynucleotide fragment prepared by treating the genome of the LMY ver2 virus or the LMY mother strain in step (1) with restriction enzymes AscI and PacI contains regions encoding NSP1-beta (ORF1a and ORF1b; SEQ ID NO: 2 or SEQ ID NO: 1) can include
  • the polynucleotide fragment prepared by treating the genome of the BP2017-2 virus in step (3) with restriction enzymes AscI and PacI may include ORF2 to ORF7 sites (SEQ ID NO: 5).
  • two or more or all three polynucleotide fragments of (1) to (3) may be recombined simultaneously or sequentially regardless of order.
  • a chimeric virus can be prepared by inoculating the infectious clone obtained by the recombination into cells.
  • the cell means a cell transfected with chimeric virus DNA or RNA, or a vector containing the same, an infectious clone, or a chimeric virus in order to produce a large amount of chimeric virus, and the type of cell is not particularly limited.
  • kits for performing any of the methods of immunization, prophylaxis and/or treatment described above comprises a container, a vaccine composition, preferably containing a chimeric virus variant of PRRSV as described above, a pharmaceutically acceptable carrier, an adjuvant, and a clinical sign or effect of PRRS infection, preferably reducing the frequency or severity of PRRS. Instructions for administering the immunogenic composition to an animal in need thereof may be included.
  • a kit may also include means for injection and/or other forms of means for administration. Additionally, the kit may include a solvent.
  • the attenuated vaccine may be lyophilized and reconstituted with a solvent to give a solution for injection and/or inhalation.
  • the solvent may be water, physiological saline, a buffer or a fortifying solvent.
  • a kit may include a separate container containing the attenuated virus, a solvent and/or a pharmaceutically acceptable carrier. Instructions for use may be labels and/or printed matter affixed to one or more containers.
  • the PRRSV-EP7 and/or PRRSV-EP8 chimeric viruses provided herein can stimulate PBMCs of pigs infected with PRRS to induce IFN-gamma expression, and inhibit virus amplification in target cells to effectively protect PRRSV. It can be usefully used as a prophylactic and/or therapeutic vaccine.
  • FIG. 1 shows a schematic diagram of a PRRS infected clone loaded with the PRRS T cell peptide Epitop-EP7 or the T cell peptide Epitop-EP8 (PRRS T cell peptide Epitop-EP7 or T cell peptide Epitop-EP8 is a PRRSV peptide). displayed).
  • Figure 2 shows the peptide sequence of the viral gene extracted after subculture of rPRRSV-EP7 loaded with the PRRS T cell peptide Epitope-EP7 once, four times, six times, and 29 times.
  • Figure 3 shows a graph showing the IFN-gamma expression induction ability by comparing the IFN-gamma expression induction of the existing vaccine strain and the peptide-expressing vaccine strain (rPRRSV-EP7).
  • FIG. 4 shows a virus suppression assay (Virus Suppression Assay, VSA) graph of an existing vaccine strain and a peptide-expressing vaccine strain (rPRRSV-EP7).
  • VSA virus Suppression Assay
  • FIG. 5 shows the peptide sequences of viral genes extracted after subculture of rPRRSV-EP8 loaded with the PRRS T cell peptide Epitope-EP8 once, six times, and 29 times.
  • Figure 6 shows a graph showing the ability to induce IFN-gamma expression by comparing the induction of IFN-gamma expression between an existing vaccine strain and a peptide-expressing vaccine strain (rPRRSV-EP8).
  • VSA Virus Suppression Assay
  • Example 8 shows a graph of results of measuring the number of IFN-gamma expressing cells through ELIspot IFN-gamma measurement according to Example 6-2.
  • RNA Since RNA is easily destroyed, cells were transfected by synthesizing RNA from DNA after performing all tasks.
  • a porcine reproductive and respiratory syndrome (PRRS) chimeric virus was prepared as follows.
  • Example 1-1 Design of chimeric viruses
  • the Porcine Reproductive Reproductive Syndrome (PRRS) chimeric virus was isolated in 2017 from the Non-Structural Protein 1 (NSP1; SEQ ID NO: 1) part of the LMY strain and the Namsan Farm in Namsan-ri, Gongju-si, Chungcheongnam-do. It was designed to include ORF2, ORF3, ORF4, ORF5, ORF6, and ORF7 sites of BP2017-2.
  • NSP1 Non-Structural Protein 1
  • LMY strain (GenBank accession no.DQ473474.1.), a PRRS strain isolated from the existing quarantine headquarters, was used to replace 91 bases in the nucleotide sequence of the gene at the NSP1 site, resulting in an LMY mutant, recombinant LMY ver2 virus (LMY ver2 mutant) was manufactured.
  • LMY ver2 mutant recombinant LMY ver2 virus
  • the recombinant LMY ver2 virus was prepared by silent mutation of a part of the nucleotide sequence according to the Codon Pair Deoptimization principle (Table 3) using a generally known SAVE (Synthetic Attenuated Virus Engineering) program.
  • SAVE Synthetic Attenuated Virus Engineering
  • CPB codon pair base
  • CPB levels fluctuate when some nucleotide sequences of the LMY virus gene are substituted with other nucleotide sequences, and are closely related to the proliferation of the virus.
  • NSP1 regions NSP1-alpha and NSP1-beta, SEQ ID NO: 1
  • NSP1-alpha and NSP1-beta SEQ ID NO: 1
  • the LMY virus mutant in which 91 base sequences of NSP1 prepared by the above method were mutated was referred to as LMY ver2, and the base sequence is shown in Table 3 below.
  • the LMY ver2 has accession number 13394BP.
  • the CPB value of the LMY parent strain was about 0.0139 and the NSP1-beta CPB value was about 0.016, but the CPB values of the LMY ver2 mutant strain of the present invention were about -0.2393 in NSP1 and about -0.33 in NSP1-beta. From this, it was found that the proliferation of the LMY ver2 mutant strain of the present invention was reduced compared to the existing parent strain and was an attenuated strain. Details related to this are shown in Table 4.
  • NSP1 site Codon Pare Deoptimization LMY NSP1 0.01392516640897059 LMY ver2 NSP1 -0.2393184052058128 LMY NSP1-beta 0.016079236408108866 LMY ver2 NSP1-beta -0.3377269630038442
  • the entire gene sequence (GenBank accession no.DQ473474.1.) of the LMY strain was divided into 7 fragments and synthesized, respectively.
  • Fragment 1 of the seven fragments is the NPS-1 site, and this site was synthesized as a DNA fragment (SEQ ID NO: 2) in which 91 bases of the gene sequence of the NSP1 site of the LMY strain were substituted.
  • the synthesized fragment genes were sequentially cut with the restriction enzymes in Table 5 and then linked with ligase to prepare one infectious clone.
  • Example 1-3 Construction of chimeric virus clones
  • PRRS virus contains a total of 8 ORFs, that is, ORF1a, ORF1b, and ORF2 to 7.
  • Sites of ORF2 to ORF7 in the genomic region including the entire structural gene of the LMY ver2 mutant strain (an infectious clone of LMY ver2) prepared in Example 1-2 were cut using restriction enzymes AscI and PacI. Subsequently, the parts (SEQ ID NO: 5) corresponding to the ORF2 to ORF7 regions of the LMY ver2 mutant strain among the genome regions of the BP2017-2 strain were cut with the same AscI and PacI restriction enzymes, and then corresponding to the ORF1a and ORF1b regions of the LMY ver2 mutant strain
  • the site (LMY ver2 NSP1 region of Example 1-2; SEQ ID NO: 2) and the site corresponding to the ORF2 to ORF7 regions of the BP2017-2 strain (SEQ ID NO: 5) were linked with ligase to obtain one recombinant infectious clone (infectious clone ) was prepared and named LMY+BP2017.
  • the restriction enzymes used are shown in Table 6
  • the completed infectious clone was inserted into a high copy vector loaded with a CMV promoter and an ampicillin resistance gene, transfected into BHK cells (Korea Cell Line Bank) using lipofectamine, and finally ORF1a and An LMY+BP2017 chimeric virus containing ORF1b region (LMY ver2 NSP1 region) and ORF2 to ORF7 regions of strain BP2017-2 was constructed.
  • the LMY+BP2017 chimeric virus was published on October 24, 2018 in Korea Research Institute of Bioscience and Biotechnology. It was deposited at the center and received accession number KCTC13675BP.
  • Example 2-1 Preparation of Chimeric Virus Mutants Loaded with T Cell Peptide Epitope-EP7
  • the T cell peptide epitope-EP7 (EP7) is part of the amino acid sequence of the membrane protein (ORF6) of the PRRS virus. -gamma (IFN-gamma) production and/or secretion can be induced.
  • the amino acid sequence of EP7 and the nucleic acid sequence of the gene encoding it are shown in Table 7 below.
  • T cell peptide epitope-EP7 LLAFSITYTPVMIYALKVSRGRLLGL 3 Encoding Nucleic Acid Sequence of T Cell Epitope-EP7 ctgctagctttcagtatcacatatactccagttatgatatacgcacttaaggtctctcgtgggcgtctcctagggctc 4 Modified T-Cell Peptide Epitope-EP7 Encoding Gene ggcgcgcc gcacc atgctgctagctttcagtatcacatatactccagttatgatatacgcacttaaggtctctcgtgggcgtctctagggctctag gttccgtggcaaccccctataaccagagtttcagcggaaca ggcgcgcc 20
  • the ORF1 site (SEQ ID NO: 2) of the infectious clone of LMY ver2 prepared in Example 1 and the ORF2 to ORF7 sites of the BP2017-2 strain (SEQ ID NO: 5 ) and the T cell peptide epitope-EP7 (T cell epitope-EP7) encoding gene were ligase-linked to prepare an EP7-expressing chimeric virus mutant (rPRRSV-EP7 chimeric virus).
  • the modified EP7-epitope plasmid in pTOP Blunt V2 synthesized by Macrogen was treated with restriction enzyme AscI to fragment the modified EP7-epitope, and the T cell peptide
  • AscI restriction enzyme recognition sites SEQ ID NO: 8
  • a kozak sequence SEQ ID NO: 13
  • SEQ ID NO: 13 A modified T cell peptide epitope-EP7 coding gene (SEQ ID NO: 20) was constructed by additionally inserting TRS6 (SEQ ID NO: 14).
  • AscI restriction enzyme was applied to the genome (there is an AscI restriction enzyme recognition site between ORF1 and ORF2) including the entire structural gene of the LMY ver2 mutant strain (infectious clone of LMY ver2) described in Example 1-3 above at 37 ° C for 1 hour treatment to cleave between ORF1b and ORF2, treatment with CIP (Calf-intestinal alkaline phosphatase) enzyme at 37°C for 30 minutes, inactivation at 75°C for 10 minutes to remove phosphate group, gel elution and PCR purification to prepare fragments.
  • CIP Calf-intestinal alkaline phosphatase
  • both ends of the gene sequence (SEQ ID NO: 20) of the T cell peptide Epitope-EP7 prepared above were treated with AscI to fragment, and PCR purification was performed after gel elution in the same way to obtain the T cell peptide Epitope-EP7 encoding gene fragment prepared.
  • the two fragments prepared through the above process were linked with ligase at 16 ° C for 1 hour, transformed into DH5alpha com cells, and after 24 hours, colony was confirmed, PCR was performed on the colony to confirm the insert site.
  • PCR was performed on the colony to confirm the insert site.
  • the infectious clone was transfected into BHK cells (Korea Cell Line Bank) using lipofectamine, and finally the ORF1a and ORF1b regions (LMY ver2 NSP1 region) of the LMY ver2 mutant strain (SEQ ID NO: 2), T cell peptide epitope A chimeric virus mutant (rPRRSV-EP7 chimeric virus) containing the EP7 coding region (SEQ ID NO: 20) and ORF2 to ORF7 regions (SEQ ID NO: 5) of strain BP2017-2 was prepared.
  • the genome sequence of the chimeric virus mutant thus obtained is shown in SEQ ID NO: 6.
  • chimeric virus mutant (rPRRSV-EP7 chimeric virus) was deposited at the Biological Resource Center of the Korea Research Institute of Bioscience and Biotechnology located in Jeongeup-si, Jeollabuk-do, Korea on August 10, 2020, and was given accession number KCTC 14269BP.
  • PRRSV-derived T cell peptide epitope-EP8 is a part of the amino acid sequence of the membrane protein (ORF6) of PRRS virus. This can induce interferon-gamma (IFN-gamma) production and/or secretion.
  • IFN-gamma interferon-gamma
  • the amino acid sequence of EP8 and the nucleic acid sequence of the gene encoding it are shown in Table 8 below.
  • the modified EP8-epitope plasmid in pTOP Blunt V2 synthesized by Macrogen was treated with restriction enzyme AscI and fragmented to obtain the T cell peptide Epitope-EP8 and its To obtain a polynucleotide fragment containing the AscI restriction enzyme recognition site (SEQ ID NO: 8) at both ends, the kozak sequence (SEQ ID NO: 13) at the 5' end of the polynucleotide fragment and TRS6 (SEQ ID NO: 14) at the 3' end. was additionally inserted to construct a modified T cell peptide epitope-EP8 encoding gene (SEQ ID NO: 21).
  • AscI restriction enzyme was applied to the genome (there is an ASC1 restriction enzyme recognition site between ORF1 and ORF2) including the entire structural gene of the LMY ver2 mutant strain (an infectious clone of LMY ver2) described in Example 1-3 above for 1 hour at 37 ° C. treatment to cleave between ORF1b and ORF2, treatment with CIP enzyme at 37°C for 30 minutes, inactivation at 75°C for 10 minutes to remove phosphate groups, and PCR purification after gel elution to prepare fragments.
  • both ends of the gene sequence (SEQ ID NO: 21) of the T cell peptide Epitope-EP8 prepared above were treated with AscI to fragment, and PCR purification was performed after gel elution in the same way to obtain the T cell peptide Epitope-EP8 encoding gene A fragment was prepared.
  • the two fragments prepared through the above process were linked with ligase for 1 hour at 16 ° C, transformed into DH5alpha com cells, and after 24 hours, colony was confirmed, PCR was performed on the colony to confirm the insert site.
  • a plasmid was obtained by the manufacturer's midi prep method using the QIAGEN Plasmid Midi Kit (cat. nos. 12143) to obtain a recombinant infectious clone. manufactured.
  • the infectious clone was transfected into BHK cells (Korea Cell Line Bank) using lipofectamine, and finally the ORF1a and ORF1b regions (LMY ver2 NSP1 region) of the LMY ver2 mutant strain (SEQ ID NO: 2), T cell peptide epitope - A chimeric virus mutant (rPRRSV-EP8 chimeric virus) containing the EP8 coding region (SEQ ID NO: 21) and the ORF2 to ORF7 regions (SEQ ID NO: 5) of the BP2017-2 strain was prepared.
  • the genome sequence of the chimeric virus mutant thus obtained is shown in SEQ ID NO: 11.
  • chimeric virus mutant (rPRRSV-EP8 chimeric virus) was deposited at the Korea Research Institute of Bioscience and Biotechnology located in Jeongeup-si, Jeollabuk-do, Korea on August 10, 2020, accession number accession number KCTC 14270BP has been granted
  • the rPRRSV-EP7 chimeric virus was stabilized by passage 1, 4, 6, and 29 times in MARC-145 cells (KVCC), known as a PRRS virus-receptive cell line, and after gene extraction from the virus, RT - PCR was performed to confirm the nucleic acid sequence of the inserted gene.
  • KVCC MARC-145 cells
  • RT-PCR was performed according to the manufacturer's instructions using the primer set in Table 10 and a one step RT-PCR kit (Qiagen), and specific PCR conditions are shown in Table 9.
  • PCR reaction solution Composition of PCR reaction solution sheep 5x Qiagen one-step RT-PCR buffer 10ul dNTP Mix10mM 2ul Forward Primer 1ul Reverse Primer 1ul Qiagen one step RT-PCR Enzyme Mix 2ul Template RNA 2ul Distilled water 7ul total volume 25ul PCR reaction conditions Reverse transcription 30min 50°C Initial PCR activation step 15min 95°C 3-step cycling Denaturation 1 min 94°C Annealing 1 min 67°C Extension 1 min 72°C Number of cycles : 30 final extension 10min 72°C
  • primer Base sequence (5' ⁇ 3') sequence number 2-Vector-seq-FOR primers gggaagattataatgatgcgtttcgtg 15 PRRS-ORF2-REV primer accagccaaccggcgatggt 16
  • the amino acid sequence obtained based on the identified nucleic acid sequence is shown in FIG. 2.
  • Example 2 The immune enhancing effect of the rPRRSV-EP7 chimeric virus (Example 2) confirmed to stably express the EP7 peptide in Example 3 was evaluated by the degree of IFN-gamma expression.
  • ELISpot Enzyme linked immunospot kit (MABTECH) was used.
  • PBMC peripheral blood mononuclear cell
  • PRRS LMY virus in 3-week-old piglets (10 4.5 TCID 50 /ml)
  • rPRRSV-EP7 Example 2
  • rPRRSV LMY + BP2017 chimeric virus of Examples 1-3
  • EP7 peptide and Inactivated LMY PRRS LMY parent strain
  • inactivated LMY obtained by passage 7 of the PRRS LMY parent strain (Accession No. GenBank accession no.DQ473474.1) in MARC cells was inoculated into wells containing the PBMC, and the PBMC (negative control, NC) was prepared.
  • VSA Virus Suppression Assay
  • target cells monocyte derived macrophage, MDM
  • monocyte derived macrophage, MDM monocyte derived macrophage differentiated from monocytes in PBMC of the same individual (autologous) or another individual having the same genotype (genotype-matched heterologous) were prepared. More specifically, after thawing the frozen PBMCs, they were washed with serum-free EMEM ( Eagle's Minimum Essential Medium) and cultured in serum-free EMEM for 2 hours at 37 o C. After discarding the medium and floating cells, 10% FBS was added only to the adherent cells.
  • EMEM Eagle's Minimum Essential Medium
  • rat M-CSF mouse-colony stimulating factor, Biolegend, San Diego, CA, USA
  • VSA target cells target MDM cells
  • effector cells activated by the prepared stimulus MDM cells
  • PRRS LMY 0.00005 moi (moi based on MDM cells)
  • RNA was extracted from the cells and the supernatant, and the virus proliferation level in the target cells was confirmed using Real-time PCR (QuantiTect Probe RT-PCR Kit; Qiagen).
  • RNA was extracted from 0.1 ml of the supernatant of the mixed cultured sample.
  • Primers used in the real-time PCR are shown in Table 13 and PCR conditions are shown in Table 12.
  • PCR reaction solution Composition of PCR reaction solution sheep QuantiTect Probe RT-PCR buffer 5ul enzyme 0.5ul Forward Primer 0.3ul Reverse Primer 0.3ul Probe 0.5ul Template RNA 1ul Distilled water 2.4ul total volume 10ul PCR reaction conditions Reverse transcription 30min 50°C Initial PCR activation step 15min 95°C 3-step cycling Denaturation 15sec 94°C Annealing 1 min 60°C Extension 1 min 72°C Number of cycles: 40 final extension 10min 72°C
  • primer Base sequence (5' ⁇ 3') sequence number PRRSV specific Primer For atgatgrgctggctaact 17 PRRSV specific Primer Rev acaccggtcgccctaattg 18 Taq man Probe 5FAM-tgtggtgaatggcactgattgaca-3BHQ1 19
  • the real-time PCR repeated a total of 35 cycle reactions, and the Ct value was calculated for each sample according to the threshold value, and 35 or more were excluded.
  • the Ct value was expressed as a genomic copy by substituting it into a standard curve.
  • FIG. 4 PBMC stimulation by the Type 2 PRRS chimeric virus vaccine strain (rPRRSV-EP7) expressing the EP7 peptide is more effective for unstimulated PBMC (T cells) than when stimulated with the existing vaccine strain (rPRRSV).
  • rPRRSV-EP7 75%; rPRRSV: 28%).
  • the rPRRSV-EP8 chimeric virus was stabilized by passage 1, 6, and 29 times in MARC-145 cells (KVCC) known as a PRRS virus-receptive cell line, and after gene extraction from the virus, RT-PCR was performed. performed to confirm the nucleic acid sequence of the inserted gene.
  • KVCC MARC-145 cells
  • RT-PCR was performed according to the manufacturer's instructions using the primer set in Table 15 and a one step RT-PCR kit (Qiagen), and specific PCR conditions are shown in Table 14.
  • PCR reaction solution Composition of PCR reaction solution sheep 5x Qiagen one-step RT-PCR buffer 10ul dNTP Mix10mM 2ul Forward Primer 1ul Reverse Primer 1ul Qiagen one step RT-PCR Enzyme Mix 2ul Template RNA 2ul Distilled water 7ul total volume 25ul PCR reaction conditions Reverse transcription 30min 50°C Initial PCR activation step 15min 95°C 3-step cycling Denaturation 1 min 94°C Annealing 1 min 67°C Extension 1 min 72°C Number of cycles : 30 final extension 10min 72°C
  • primer Base sequence (5' ⁇ 3') sequence number 2-Vector-seq-FOR primers GGGAAGATTATAATGATGCGTTTCGTG 15 PRRS-ORF2-REV primer ACCAGCCAACCGGCGATGGT 16
  • the amino acid sequence obtained based on the identified nucleic acid sequence is shown in FIG. 5. As shown in FIG. 5, it was confirmed that the inserted EP8-encoding gene was stably maintained even at the time of subculture 29 times, stably expressing EP8, and the results are shown in FIG.
  • Example 2 The immune enhancing effect of the rPRRSV-EP8 chimeric virus (Example 2) confirmed to stably express the EP8 peptide in Example 6 was evaluated by the degree of IFN-gamma expression.
  • ELISpot Enzyme linked immunospot kit (MABTECH) was used.
  • PBMC peripheral blood mononuclear cell
  • PRRS LMY virus in 3-week-old piglets (10 4.5 TCID 50 /ml)
  • rPRRSV-EP8 expressing EP8 peptide in each well containing, as vaccine strains for antigen stimulation, rPRRSV-EP8 expressing EP8 peptide (Example 2), rPRRSV (LMY + BP2017 chimeric virus of Example 1.3) and Inactivated LMY (PRRS LMY parent strain (Accession LMY) obtained by culturing No.
  • inactivated LMY obtained by passage 7 of the PRRS LMY parent strain (Accession No. GenBank accession no.DQ473474.1) in MARC cells was prepared by inoculating wells containing the PBMCs.
  • rPRRSV and PRRS LMY parent strains (Accession No. GenBank accession no.DQ473474.1) in which the EP8 gene was not inserted were compared with inactivated LMY obtained by passage 7 in MARC cells. Therefore, rPRRSV-EP8 expressing the EP8 peptide showed a higher IFN-gamma expression level, and these results show that the vaccine strain can obtain a better immune enhancing effect by expressing the EP8 peptide.
  • VSA Virus Suppression Assay
  • target cells monocyte derived macrophage, MDM
  • monocyte derived macrophage, MDM monocyte derived macrophage differentiated from monocytes in PBMC of the same individual (autologous) or another individual having the same genotype (genotype-matched heterologous) were prepared. More specifically, after thawing the frozen PBMCs, they were washed with serum-free EMEM ( Eagle's Minimum Essential Medium) and cultured in serum-free EMEM for 2 hours at 37 o C. After discarding the medium and floating cells, 10% FBS was added only to the adherent cells.
  • EMEM Eagle's Minimum Essential Medium
  • rat M-CSF mouse-colony stimulating factor, Biolegend, San Diego, CA, USA
  • VSA target cells target MDM cells
  • effector cells activated by the prepared stimulus MDM cells
  • PRRS LMY 0.00005 moi (moi based on MDM cells)
  • RNA was extracted from the cells and the supernatant, and the virus proliferation level in the target cells was confirmed using Real-time PCR (QuantiTect Probe RT-PCR Kit; Qiagen).
  • RNA was extracted from 0.1 ml of the supernatant of the mixed cultured sample.
  • Primers used in the real-time PCR are shown in Table 18 and PCR conditions are shown in Table 17.
  • PCR reaction solution Composition of PCR reaction solution sheep QuantiTect Probe RT-PCR buffer 5ul enzyme 0.5ul Forward Primer 0.3ul Reverse Primer 0.3ul Probe 0.5ul Template RNA 1ul Distilled water 2.4ul total volume 10ul PCR reaction conditions Reverse transcription 30min 50°C Initial PCR activation step 15min 95°C 3-step cycling Denaturation 15sec 94°C Annealing 1 min 60°C Extension 1 min 72°C Number of cycles: 40 final extension 10min 72°C
  • primer Base sequence (5' ⁇ 3') sequence number PRRSV specific Primer For atgatgrgctggctaact 17 PRRSV specific Primer Rev acaccggtcgccctaattg 18 Taq man Probe 5FAM-tgtggtgaatggcactgattgaca-3BHQ1 19
  • the real-time PCR repeated a total of 35 cycle reactions, and the Ct value was calculated for each sample according to the threshold value, and 35 or more were excluded.
  • the Ct value was expressed as a genomic copy by substituting it into a standard curve.
  • FIG. 7 PBMC stimulation by the type 2 PRRS chimeric virus vaccine strain (rPRRSV-EP8) expressing the EP8 peptide was more effective for unstimulated PBMC (T cells) than when stimulated with the existing vaccine strain (rPRRSV). A high virus reduction rate was confirmed (rPRRSV-EP8: 70%; rPRRSV: 28%). These results show that the ability to inhibit viral growth is remarkably increased by expressing the EP8 peptide in the vaccine strain.
  • cellular immunoassay was performed by IFN-gamma measurement.
  • the IFN-gamma was measured using ELIspot (Enzyme linked immunospot) kit (MABTECH). Specifically, as shown in the experimental group shown in Table 19 below, the vaccine composition was injected into three groups of 3-week-old pigs at a dose of 5*10 4 TCID 50 (Tissue culture infective dose 50 ) by intradermal injection (ID) method. Inoculated.
  • ELIspot Enzyme linked immunospot
  • Serum and PBMC were obtained 21 days after the vaccination (week 3) and 28 days (week 4), and each well containing the obtained PBMC 5*10 5 cells/mL was labeled with biotin, an antibody in the ELISpot kit.
  • the anti-IFN-gamma primary antibody and streptavidin-HRP-labeled secondary antibody were sequentially treated and incubated at 37°C for 1 hour, and spot forming units (SFU) per 5*10 5 cells were calculated. At this time, the SFU level represents the IFN-gamma expression level.
  • SFU spot forming units
  • the expression level of IFN-gamma was high in the 3rd week in the G3 group (rPRRSV-EP).
  • the stimulation of cellular immunity by the peptide occurred due to the expression of IFN-gamma in the G3 group at 3 weeks.
  • the vaccination with the peptide expression of G3 showed a clear cellular immunity induction enhancement effect during pig infection.
  • the high level of cellular immunity on day 21 after vaccination suggests the possibility of forming protective immunity early in vaccination.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Mycology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Wood Science & Technology (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Engineering & Computer Science (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

돼지생식기호흡기증후군바이러스 (PRRSV) 유래 펩타이드를 발현하는 키메라 바이러스 및 이의 백신으로서의 용도가 제공된다. 상기 키메라 바이러스는 면역 자극효과가 우수하고 타겟세포에서의 바이러스 증폭을 억제하여 효과적으로 방어할 수 있는 백신으로서 유용하다.

Description

돼지생식기호흡기증후군바이러스 유래 펩타이드를 발현하는 키메라 바이러스 및 이를 포함하는 백신 조성물
돼지생식기호흡기증후군바이러스 (PRRSV) 유래 펩타이드 (T 세포 에피톱)를 발현하는 키메라 바이러스 및 이의 백신으로서의 용도가 제공된다. 상기 키메라 바이러스는 면역 자극효과가 우수하고 타겟세포에서의 바이러스 증폭을 억제하여 효과적으로 방어할 수 있는 백신으로서 유용하다.
돼지생식기호흡기증후군 (Porcine Reproductive and Respiratory Syndrome, 이하 PRRS)은 돼지 써코바이러스 감염증 및 구제역과 함께 국내 양돈산업에 가장 큰 피해를 주는 전염병에 해당한다. PRRS는 임신한 암퇘지의 생식 불능, 유산이나 조산, 사산의 번식장애를 유발하며, 젖먹이 돼지와 비육돈에게 재채기, 발열 등의 호흡기 증상을 유발한다. 일반적으로 바이러스에 이환된 이후 세균 등의 2차 감염에 의해 심한 호흡기 증상을 야기하지만, 만성적으로 감염된 경우에는 특징적인 임상 증상 없이 증체량 감소 및 폐사율의 증가를 나타나게 된다.
이 바이러스 질환은 미국에서 1987년에 최초로 발견되었고, 이어서 유럽에서 발견되었으며, 1990년대 초에 아시아에서 동정되었다. 지금까지, PRRS는 양돈국가에서 풍토병의 특징을 가지며 세계적으로 확산되어, 매년 막대한 경제적 손실을 일으켰다.
PRRS의 원인이 되는 병원체는 Arterivirus 속, Arteriviridae 과, Nidovirales 목에 속하는 PRRS 바이러스이다. PRRS 바이러스는 positive-sense single stranded RNA genome을 갖고 있으며, 크기는 약 15.4 kilobase이다. PRRS 바이러스의 genome은 9개의 ORF를 갖고 있다 (Conzelmann et al., 1993; Meulenberg et al.,1993). 그 중 비구조단백질 (Non-Structural Protein, NSP)을 코딩하는 ORF1a 및 ORF1b가 바이러스 유전체 (genome)의 약 80%를 차지하고 있다 (Bautista et al.,2002; Meulenberg et al., 1993; Snijder and Meulenberg, 1998, 2001). 상기 비구조단백질 중 NSP1-alpha, NSP-1 beta, NSP2 내지 NSP8은 ORF1a에, NSP9 내지 NSP12는 ORF1b에 위치하는 것으로 알려져 있다. 글리코실화된 구조 단백질인 GP2, GP3, GP4, GP5와, 비글리코실화된 막 (Membrane, M) 단백질, 뉴클레오캡시드 (N) 단백질은 나머지 20%를 차지하는 ORF2-7에 의하여 코딩된다. Minor 구조단백질인 GP2, GP3, GP4가 heterotrimer를 형성하여 바이러스가 숙주 세포 내로 침입할 때 작용하며, major 구조단백질인 GP5, M은 heterodimer를 형성하여 바이러스의 감염력을 높여주는 작용을 한다.
PRRS 바이러스는 RNA 바이러스의 특성상 변이가 심하여 바이러스 간에 차이가 많이 난다. PRRS 바이러스는 크게 북미형과 유럽형으로 나뉜다. 유럽형을 대표하는 타입 I (Lelystad virus, LV) 및 북미형 바이러스주 (Northern American strain) ATCC VR2332를 대표하는 타입 II (VR2332의 게놈 서열은 GenBank 등록번호 AY150564 참조)(Murtaugh et al., Arch Virol. 1995; 140:1451-1460) 이 있다.
북미형과 유럽형 간에는 최대 40%까지 유전자 차이가 존재하여 서로 교차 방어가 되지 않는 것으로 알려져 있다. 또한 같은 타입에 속하는 변이주 간에도 교차 방어가 되지 않는 경우가 많다(Meng, X. J. et al., 2000). 이로 인해, 각각에 대해 표준 변이주 기반의 백신은 제작되어 있지만 교차 방어능이 좋지 못하기 때문에 PRRS를 효과적으로 예방하지 못하고 있는 실정이다. 이를 극복하기 위하여 안전성, 면역원성, 및 방어능을 효과적으로 갖춘 백신을 제작하기 위한 다양한 시도가 이루어지고 있다.
이 같은 질병의 심각성 때문에 돼지 생식기 호흡기 증후군 (PRRS)의 원인체인 돼지생식기호흡기증후군 바이러스 (PRRSV)를 발견한 이후, 약 20년 동안 이 바이러스에 대한 예방법을 개발하기 위하여 많은 노력이 투자되었음에도 아직까지 효과적인 예방법 및 관리법이 개발되지 않은 실정이다. 돼지생식기호흡기증후군 바이러스 (PRRSV) 제어를 위해 불활화 백신과 약독화 생백신 등 다양한 백신이 개발되었으나, 오직 감염성이 확보된 약독화 백신만이 만족스러운 수준의 방어 효과를 유도하는 것으로 밝혀졌다. 하지만, 돼지생식기호흡기증후군 바이러스 (PRRSV)가 유전적으로 매우 다양하게 존재하기 때문에 다양한 바이러스 종류간의 교차면역이 부재하여 하나의 백신으로 다양한 돼지생식기호흡기증후군 바이러스 (PRRSV)를 방어하기는 어렵다. 또한 현재 약독화 백신은 다른 동물 종의 세포 주에서 100~200 계대 이상의 연속 계대를 통해서만 생산이 가능하므로 개발 기간이 길고 효능과 안전성의 보장이 어려운 문제가 있다. 이로 인해 각각에 대해 표준 변이주 기반의 백신은 제작되어 있지만 교차 방어능이 좋지 못하기 때문에 PRRS를 효과적으로 예방하지 못하고 있는 실정이다.
이를 극복하기 위하여 안전성, 면역원성, 및 방어능을 효과적으로 갖춘 백신을 제작하기 위한 다양한 시도가 이루어지고 있다 (출원번호 제10-2011-7004020호, 발명의 명칭: 고병원성 돼지 생식기 및 호흡기 증후군 (HP PRRS)에 대한 백신).
본 발명은 병원성이 낮고 안정성이 높으며, 역유전학기법을 이용하여 세포면역을 활성화할 수 있는 펩타이드를 발굴하고, 이를 발현하는 백신주를 제공한다.
일 예는 돼지생식기호흡기증후군 바이러스 (PRRSV) 유래 T 세포 에피톱이 탑재된 T 세포 에피톱 발현 키메라 바이러스를 제공한다.
다른 예는 상기 키메라 바이러스를 포함하는 백신 조성물을 제공한다.
다른 예는 상기 키메라 바이러스의 제조방법을 제공한다.
일 예에서, 상기 키메라 바이러스는, 유전체 (genome)로서,
(1) PRRS 타입 II 바이러스에서 유래한 ORF1a 및 ORF1b의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 상기 핵산 서열과 70% 이상 서열 상동성을 갖는 핵산 서열;
(2) 돼지생식기호흡기증후군 바이러스 유래의 T 세포 에피톱-EP7을 암호화하는 핵산 서열 또는 이와 기능적 동등성을 유지하면서 상기 핵산 서열과 70% 이상 서열 상동성을 갖는 핵산 서열 및/또는 돼지생식기호흡기증후군 바이러스 유래의 T 세포 에피톱-EP8을 암호화하는 핵산 서열 또는 이와 기능적 동등성을 유지하면서 상기 핵산 서열과 70% 이상 서열 상동성을 갖는 핵산 서열; 및
(3) 수탁번호 KCTC 13393BP의 BP2017-2 바이러스의 ORF2 내지 ORF7 부위의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 상기 핵산 서열과 70% 이상 서열 상동성을 갖는 핵산 서열
을 포함하는 것일 수 있다.
상기 핵산 서열 (1), (2) 및 (3)은 순서대로 5'→3' 방향으로 배열된 것일 수 있다.
상기 PRRS 타입 II 바이러스에서 유래한 ORF1a 및 ORF1b의 핵산 서열은 서열번호 1 또는 서열번호 2로 표현되는 것일 수 있다.
상기 돼지생식기호흡기증후군바이러스 유래의 T 세포 에피톱-EP7을 암호화하는 핵산 서열은 서열번호 3의 아미노산을 암호화하는 핵산 서열일 수 있으며, 보다 구체적으로 서열번호 4로 표현되는 것일 수 있다.
상기 돼지생식기호흡기증후군바이러스 유래의 T 세포 에피톱-EP8를 암호화하는 핵산 서열은 서열번호 12의 아미노산을 암호화하는 핵산 서열일 수 있으며, 보다 구체적으로 서열번호 10으로 표현되는 것일 수 있다.
상기 BP2017-2 바이러스의 ORF2 내지 ORF7 부위의 핵산 서열은 서열번호 5로 표현되는 것일 수 있다.
본 발명은 백신으로 사용할 수 있는 돼지생식기호흡기증후군 (PRRS) 바이러스의 키메라 바이러스에 관한 것이다. 본 발명의 PRRSV의 키메라 바이러스는 모균주보다 약독화되어 있어 병원성이 낮고 안정성이 높으며, 교차면역이 가능한 중화항체의 분비를 향상시킴으로써 돼지의 면역력을 현저히 증진시킨다. 이에, PRRS 질환의 효과적인 예방 및 치료용 백신으로 사용할 수 있다.
이하, 본 발명을 더욱 자세히 설명한다.
용어의 정리
본 명세서에 사용된 "약독화된 바이러스"는 PRRS 질환의 임상 징후를 유발하지 않고 표적 포유동물에서 면역반응을 유발할 수 있는 무독성 바이러스를 의미하기도 하고, 또한 약독화된 바이러스로 감염되고 약독화된 바이러스를 투여받지 못한 동물에서 임상 징후의 발생빈도를 낮추거나, 징후의 중증도가 비-약독화된 PRRS 바이러스로 감염된 "대조군" 동물에 비해 감소된 것을 의미하기도 한다. 이러한 상황에서, "감소/감소된"이란 용어는 앞에서 정의한 대조군에 비해 적어도 10%, 바람직하게는 25%, 더욱 바람직하게는 50%, 가장 바람직하게는 100% 이상의 감소를 의미한다.
본 명세서에 사용된 "백신 조성물"은 PRRS 키메라 바이러스 또는 이의 임의의 면역원성 단편 또는 분획, 바람직하게는 약독화된 PRRS 키메라 바이러스, 예컨대 상기 본 발명의 PRRS 키메라 바이러스일 수 있다. 이는 숙주의 "면역학적 반응"을 PRRSV에 대한 세포 및/또는 항체 매개의 면역 반응으로 유발한다. 백신 조성물은 PRRSV 감염 및 이와 관련된 임상 징후들에 대해 예방 면역을 부여할 수 있는 것이 바람직하다.
본 명세서에 사용된 "면역 반응"은 본 발명의 PRRSV의 키메라 바이러스, 또는 이를 포함하는 백신 조성물을 투여 받은 동물에게 투여된 키메라 바이러스 또는 백신에 대한 임의의 세포- 및/또는 항체-매개의 면역 반응을 의미한다. 보통, "면역 반응"은 다음과 같은 효과 중 하나 이상을 포함하지만, 이에 국한되는 것은 아니다: 당해 조성물 또는 백신에 포함된 항원 또는 항원들에 대해 특이적으로 유도된 항체, B 세포, 헬퍼 T 세포, 억제인자 T 세포 및/또는 세포독성 T 세포 및/또는 γδ T 세포의 생산 또는 활성화. 숙주는 면역원성 조성물이나 백신을 투여받지 않은 대조군에 비해 새로운 감염에 대한 내성이 향상되고/되거나 질환의 임상 중증도가 감소되도록 치료적 또는 예방적 면역학적 반응을 나타내는 것이 바람직하다. 이러한 예방은 최대 전술한 숙주 감염과 관련된 증상들의 결여 및 이를 비롯하여 빈도 또는 중증도의 감소에 의해 증명될 것이다.
본 명세서에 사용된 용어 "돼지들", "돼지" 및 "새끼돼지"는 상호 동등한 의미로 호환 사용될 수 있다.
용어 "백신을 접종하다"는 PRRS 질환에 노출되기 전에 본 명세서에 기술된 PRRSV의 키메라 바이러스 또는 이를 포함하는 백신을 투여하는 것을 의미한다.
용어 "예방하다" 또는 "예방"은 본 발명의 PRRSV 바이러스 또는 이를 포함하는 백신 조성물을 투여 받은 결과로서, PRRS의 임상의 발생 빈도, 징후의 중증도 또는 빈도가 감소하는 것을 의미한다. 중증도 또는 빈도의 감소는 본 발명의 PRRSV의 키메라 바이러스 또는 이를 포함하는 백신 조성물을 투여 받지 않은 동물 또는 동물 그룹과 비교한 결과일 수 있다. 상기 동물은 바람직하게는 돼지일 수 있다.
본 명세서의 핵산 서열은 편의를 위해 DNA 뉴클레오타이드를 기준으로 기재되었으며, 폴리뉴클레오타이드의 종류가 RNA인 경우 (예컨대, PRRS 바이러스의 유전체)에는 염기서열 내 모든 또는 일부의 티민 (Thymine, T)이 우라실 (Uracil, U)로 치환된 서열을 의미한다.
본 명세서에서, 폴리뉴클레오타이드 ("유전자"와 혼용될 수 있음) 또는 폴리펩타이드 ("단백질"과 혼용될 수 있음)가 "특정 핵산 서열 또는 아미노산 서열을 포함한다 또는 특정 핵산 서열 또는 아미노산 서열로 이루어진다 또는 표현된다" 함은 상기 폴리뉴클레오타이드 또는 폴리펩타이드가 상기 특정 핵산 서열 또는 아미노산 서열을 필수적으로 포함하는 것을 의미할 수 있으며, 상기 폴리뉴클레오타이드 또는 폴리펩타이드의 본래의 기능 및/또는 목적하는 기능을 유지하는 범위에서 상기 특정 핵산 서열 또는 아미노산 서열에 변이 (결실, 치환, 변형, 및/또는 부가)가 가해진 "실질적으로 동등한 서열"을 포함하는 것 (또는 상기 변이를 배제하지 않는 것)으로 해석될 수 있다.
일 예에서, 폴리뉴클레오타이드 또는 폴리펩타이드가 "특정 핵산 서열 또는 아미노산 서열을 포함한다, 또는 상기 서열로 이루어진다 또는 표현된다" 함은 상기 폴리뉴클레오타이드 또는 폴리펩타이드가 (i) 상기 특정 핵산 서열 또는 아미노산 서열을 필수적으로 포함하거나, 또는 (ii) 상기 특정 핵산 서열 또는 아미노산 서열과 70% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 99.5% 이상, 또는 99.9% 이상의 상동성을 갖는 아미노산 서열로 이루어지거나 이를 필수적으로 포함하고, 본래의 기능 및/또는 목적하는 기능을 유지하는 것을 의미할 수 있다.
본 명세서에서, 용어 “상동성 (identity)”은 주어진 핵산 서열 또는 아미노산 서열과 일치하는 정도를 의미하며 백분율(%)로 표시될 수 있다. 핵산 서열에 대한 상동성의 경우, 예를 들면, 문헌에 의한 알고리즘 BLAST (참조: Karlin 및 Altschul, Pro. Natl. Acad. Sci. USA, 90, 5873, 1993)나 Pearson에 의한 FASTA (참조: Methods Enzymol., 183, 63, 1990)를 사용하여 결정할 수 있다. 이러한 알고리즘 BLAST에 기초하여, BLASTN이나 BLASTX라고 불리는 프로그램이 개발되어 있다(참조: http://www.ncbi.nlm.nih.gov).
본 명세서에서, 용어 "핵산 서열 또는 염기 서열"은 뉴클레오타이드 (DNA 또는 RNA)를 2 이상 포함하는 핵산 분자 (예컨대, 올리고뉴클레오타이드 또는 폴리뉴클레오타이드)의 뉴클레오타이드에 포함된 염기들의 배열 정보 또는 상기 염기 배열을 가지는 핵산 분자를 의미하는 것일 수 있다.
본 명세서에서, 용어 “작출”은 세포에 유전자를 삽입하여, 세포에 형질도입으로 제작된 바이러스의 감염성이 회복되어 세포에서의 변성 효과를 나타내는 것을 의미한다.
키메라 바이러스 변이주
일 예에서 돼지생식기호흡기증후군 바이러스(PRRSV)의 약독화된 키메라 바이러스 변이주를 제공한다. 다른 예는 폴리뉴클레오타이드를 제공하며, 상기 폴리뉴클레오타이드는 상기 키메라 바이러스 변이주의 유전체를 구성하는 것일 수 있다.
본 명세서에 기재된 바로서, 키메라 바이러스는 어느 한 종(species)의 돼지생식기호흡기증후군 바이러스(PRRSV)의 유전체 (genome) 중 일부가 다른 종의 PRRSV의 해당 유전체 부분으로 대체(치환)된 것을 의미할 수 있다. 보다 구체적으로, 상기 키메라 바이러스는 PRRS 타입 II 바이러스, 예컨대, LMY 모균주 (Accession No. GenBank accession no.DQ473474.1) 또는 PRRSV인 수탁번호 KCTC 13394BP의 LMY ver2 바이러스에서 유래한 ORF1a 및 ORF1b 부위 (NSP1)와 PRRSV인 수탁번호 KCTC 13393BP의 BP2017-2 바이러스의 ORF2 내지 ORF7 부위가 융합된 유전체를 가지는 PRRSV의 키메라 바이러스일 수 있다.
상기 키메라 바이러스 변이주는 상기한 PRRSV의 키메라 바이러스에 변이가 가해진 것으로, 보다 구체적으로, PRRSV로부터 유래한 T 세포 에피톱-EP7를 발현하도록 변이가 가해진 것을 의미할 수 있으며, 이를 EP7 발현 키메라 바이러스 변이주 또는 PRRSV-EP7 키메라 바이러스로 명명한다.
상기 EP7 발현 키메라 바이러스 변이주는 PRRS 바이러스 (타입 I 및/또는 타입 II)에 감염된 돼지의 PBMCs (peripheral blood mononuclear cell)를 자극하여 interferon-gamma (IFN-gamma)를 유도하고, 타겟 세포에서의 바이러스 증폭을 억제하여 효과적으로 방어할 수 있는 백신주로 활용될 수 있다.
또한, 상기 T 세포 에피톱-EP7은 PRRSV의 membrane 단백질의 아미노산 서열의 일부로서 PRRSV에 감염된 돼지에서 분리된 PBMC를 자극하는 경우, 인터페론 감마를 유도하고, PRRSV의 감염된 돼지에 접종 시 PBMC에서 높은 수준의 인터페론 감마를 유도함을 확인하였다.
상기 키메라 바이러스 변이주는 상기한 PRRSV의 키메라 바이러스에 변이가 가해진 것으로, 보다 구체적으로, PRRSV로부터 유래한 T 세포 에피톱-EP8을 발현하도록 변이가 가해진 것을 의미할 수 있으며, 이를 EP8 발현 키메라 바이러스 변이주 또는 PRRSV-EP8 키메라 바이러스로 명명한다.
상기 EP8 발현 키메라 바이러스 변이주는 PRRS 바이러스 (타입 I 및/또는 타입 II)에 감염된 돼지의 PBMCs (peripheral blood mononuclear cell)를 자극하여 interferon-gamma (IFN-gamma)를 유도하고, 타겟 세포에서의 바이러스 증폭을 억제하여 효과적으로 방어할 수 있는 백신주로 활용될 수 있다.
또한, 상기 T 세포 에피톱-EP8은 PRRSV의 membrane 단백질의 아미노산 서열의 일부로서 PRRSV에 감염된 돼지에서 분리된 PBMC를 자극하는 경우, 인터페론 감마를 유도하고, PRRSV의 감염된 돼지에 접종 시 PBMC에서 높은 수준의 인터페론 감마를 유도함을 확인하였다.
일 예는 구조식 1로 표현되는 폴리뉴클레오타이드를 제공한다:
[구조식 1]
5'-[X]-[Y]-[Z]-3'
상기 식에서, [X] 및 [Y] 사이, 및 [Y] 및 [Z] 사이에는 0 내지 20,000개의 뉴클레오타이드가 추가로 포함될 수 있고, 이에 제한되는 것은 아니다.
상기 식에서, [X]는 PRRS 타입 II 바이러스, 예컨대, LMY 모균주 (Accession No. GenBank accession no.DQ473474.1) 또는 수탁번호 KCTC 13394BP를 갖는 LMY ver2 바이러스의 NSP1 유전자 (NSP1-alpha 유전자 및 NSP1-beta 유전자; ORF1a 및 ORF1b)의 핵산 서열 또는 상기 핵산 서열과 동등한 기능이 유지되는 범위 내에서 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열을 포함하는 것일 수 있으며, 예를 들어 상기 LMY ver2 바이러스의 NSP1 유전자의 핵산 서열은 서열번호 2로 표현되는 것일 수 있고, 상기 LMY 모균주의 NSP1 유전자의 핵산 서열은 서열번호 1로 표현되는 것일 수 있다.
상기 [Y]는 PRRSV 유래의 멤브레인 단백질인 T 세포 에피톱-EP7 (LLAFSITYTPVMIYALKVSRGRLLGL; 서열번호 3)을 암호화하는 핵산 서열 또는 이와 기능적 동등성을 유지하면서 상기 핵산 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
구체적으로, 상기 EP7 암호화 핵산 서열은 서열번호 4의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 4의 핵산 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
또한, 상기 [Y]는 변형된 EP7 암호화 핵산 서열일 수 있다. 상기 변형된 EP7 암호화 핵산 서열은, 상기 EP7 암호화 핵산 서열에 더하여, AscI 제한 효소 인식 부위 (GGCGCGCC; 서열번호 8), Kozak 서열 (GCCACC; 서열번호 13) 및 전사조절서열 (transcription regulatory sequence; TRS) (예컨대, TRS6: GTTCCGTGGCAACCCCTATAACCAGAGTTTCAGCGGAACA; 서열번호 14)로 이루어진 군으로 선택되는 1 이상을 추가로 포함하는 것일 수 있다. 일 예에서, 상기 AscI 제한 효소 인식 부위는 상기 EP7 암호화 핵산 서열의 양 말단에 각각 포함될 수 있다. 일 예에서, 상기 Kozak 서열 및/또는 전사조절서열은 각각 독립적으로 상기 EP7 암호화 핵산 서열의 5' 말단 및/또는 3' 말단, 예컨대, Kozak 서열은 5' 말단에, 전사조절서열 (TRS6)은 3' 말단에 포함될 수 있다.
일 구체예에서, 상기 [Y]는 EP7 암호화 핵산 서열 (e.g., 서열번호 4), 상기 EP7 암호화 핵산 서열의 5' 말단에 위치하는 Kozak 서열 (e.g., 서열번호 13), 상기 EP7 암호화 핵산 서열의 3' 말단에 위치하는 TRS6 (e.g., 서열번호 14), 및 상기 Kozak 서열의 5' 말단 및 상기 TRS6의 3' 말단에 각각 위치하는 AscI 제한효소 인식 부위 (서열번호 8)을 포함하는 것일 수 있으며, 구체적으로 서열번호 20의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 20의 핵산 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
상기 [Y]는 PRRSV 유래의 멤브레인 단백질인 T 세포 에피톱-EP8 (LWGVYSAIETWKFITSRCRLCLLGRKYILAPAHHVESA; 서열번호 12)을 암호화하는 핵산 서열 또는 이와 기능적 동등성을 유지하면서 상기 핵산 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다. 구체적으로, 상기 EP8 암호화 핵산 서열은 서열번호 10의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 10의 핵산 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
또한, 상기 [Y]는 변형된 EP8 암호화 핵산 서열일 수 있다. 상기 변형된 EP8 암호화 핵산 서열은, 상기 EP8 암호화 핵산 서열에 더하여, AscI 제한 효소 인식 부위 (GGCGCGCC; 서열번호 8), Kozak 서열 (GCCACC; 서열번호 13) 및 전사조절서열 (transcription regulatory sequence; TRS) (예컨대, TRS6: GTTCCGTGGCAACCCCTATAACCAGAGTTTCAGCGGAACA; 서열번호 14)로 이루어진 군으로 선택되는 1 이상을 추가로 포함하는 것일 수 있다. 일 예에서, 상기 AscI 제한 효소 인식 부위는 상기 EP8 암호화 핵산 서열의 양 말단에 각각 포함될 수 있다. 일 예에서, 상기 Kozak 서열 및/또는 전사조절서열은 각각 독립적으로 상기 EP8 암호화 핵산 서열의 5' 말단 및/또는 3' 말단, 예컨대, Kozak 서열은 5' 말단에, 전사조절서열 (TRS6)은 3' 말단에 포함될 수 있다.
일 구체예에서, 상기 [Y]는 EP8 암호화 핵산 서열 (e.g., 서열번호 10), 상기 EP8 암호화 핵산 서열의 5' 말단에 위치하는 Kozak 서열 (e.g., 서열번호 13), 상기 EP8 암호화 핵산 서열의 3' 말단에 위치하는 TRS6 (e.g., 서열번호 14), 및 상기 Kozak 서열의 5' 말단 및 상기 TRS6의 3' 말단에 각각 위치하는 AscI 제한효소 인식 부위 (서열번호 8)을 포함하는 것일 수 있으며, 구체적으로 서열번호 21의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 21의 핵산 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
상기 [Z]는 수탁번호 KCTC 13393BP를 갖는 BP2017-2 바이러스의 ORF2 내지 ORF7 부위의 유전자 핵산 서열 또는 상기 핵산 서열과 동등한 기능이 유지되는 범위 내에서 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
본 명세서에 사용된 바로서, 상기 "동등한 기능"은 목적하는 기능과 질적(활성) 및/또는 양적(수준)으로 동일 또는 유사한 기능을 의미할 수 있다. 예를 들어, 상기 유전자가 암호화하는 단백질의 아미노산 서열이 야생형 유전자가 암호화하는 단백질의 아미노산 서열과 동일한 것일 수 있다.
일 예에서, 상기 [X]는 PRRS 타입 II 바이러스 유래의 NSP1 암호화 핵산 서열, 예컨대, 서열번호 1의 핵산서열로 이루어지는 LMY 모균주 (Accession No. GenBank accession no.DQ473474.1.)의 NSP1 유전자의 핵산 서열 또는 상기 핵산 서열에서, 상기 NSP1 유전자에 의해 암호화되는 NSP1 단백질의 아미노산 서열이 동일하게 유지되는 범위 내에서 발생하는 모든 종류의 점 돌연변이 (침묵 돌연변이)를 포함할 수 있으며, 예를 들어, 상기 돌연변이는 NSP1 유전자의 CPB (Codon Pair Bias) 수치를 낮추기 위한 목적 범위에서 자유롭게 선택되어 사용될 수 있다. 상기 CPB (Codon Pair Bias)는 바이러스 유전자 코돈이 쌍으로 배열시 상호작용하여 생기는 편향성을 의미하는 것으로, 컴퓨터 알고리즘을 이용해 수치화할 수 있으며, CPB 수치가 감소 (deoptimization)되면 바이러스의 증식성이 감소하고 약독화 되므로 (Virus Attenuation by Genome-Scale Changes in Codon Pair Bias, Science, 2008, J. Robert Coleman et al.), CPB 수치가 높은 일부 염기서열을 CPB 수치가 낮은 염기서열로 치환하거나, 또는 Codon Pair Deoptimization 원리에 따라 침묵 돌연변이 (silent mutation) 시켜 본 명세서에서 제공되는 키메라 바이러스 제조에 사용되는 LMY의 약독화된 변이주를 제작할 수 있다.
일 구체예에서, 약독화를 위하여 상기 LMY 모균주의 NSP1를 암호화하는 유전자의 염기 서열 중에서 치환되는 염기들은 공지되어 있는 SAVE(Synthetic Attenuated Virus Engineering) 프로그램을 사용하여 선택된 것일 수 있다. 구체적으로, 본 명세서에서의 상기 [X] 영역은 모균주인 LMY의 genome에서 유전적으로 안전성이 높은 NSP1 부위를 분석하여 비교적 Codon Pair Bias (CPB)가 높게 나타난 영역에서 일부 또는 전부를 선택해 치환하여 Deoptimization 시킨 염기서열일 수 있다.
예를 들어, 상기 [X]는 (i) 서열번호 1로 표현되는 NSP1 유전자의 핵산 서열, 또는 (ii) 상기 서열번호 1의 핵산 서열에서, 222번 위치, 225번 위치, 237번 위치, 240번 위치, 252번 위치, 306번 위치, 309번 위치, 312번 위치, 315번 위치, 324번 위치, 327번 위치, 330번 위치, 333번 위치, 336번 위치, 339번 위치, 342번 위치, 345번 위치, 357번 위치, 363번 위치, 366번 위치, 378번 위치, 379번 위치, 381번 위치, 393번 위치, 396번 위치, 543번 위치, 546번 위치, 549번 위치, 555번 위치, 558번 위치, 561번 위치, 573번 위치, 579번 위치, 582번 위치, 588번 위치, 612번 위치, 618번 위치, 621번 위치, 627번 위치, 633번 위치, 639번 위치, 654번 위치, 673번 위치, 675번 위치, 678번 위치, 681번 위치, 684번 위치, 705번 위치, 708번 위치, 729번 위치, 735번 위치, 738번 위치, 741번 위치, 744번 위치, 747번 위치, 771번 위치, 786번 위치, 789번 위치, 792번 위치, 810번 위치, 825번 위치, 828번 위치, 838번 위치, 840번 위치, 846번 위치, 849번 위치, 858번 위치, 867번 위치, 879번 위치, 882번 위치, 885번 위치, 891번 위치, 900번 위치, 903번 위치, 906번 위치, 924번 위치, 936번 위치, 939번 위치, 948번 위치, 954번 위치, 963번 위치, 966번 위치, 1026번 위치, 1029번 위치, 1038번 위치, 1047번 위치, 1053번 위치, 1066번 위치, 1068번 위치, 1086번 위치, 및 1110번 위치로 이루어지는 군에서 선택되는 하나 이상, 25 이상, 66 이상, 80 이상 또는 91개 모든 위치의 염기가 치환된 변이를 포함하는 것일 수 있다.
일 예에서, 상기 [X]는 (i) 서열번호 1로 표현되는 NSP1 유전자의 핵산 서열, 또는 (ii) 상기 서열번호 1의 핵산 서열에서, 222번 위치의 G가 C로 치환된 변이, 225번 위치의 C가 A로 치환된 변이, 237번 위치의 T가 C로 치환된 변이, 240번 위치의 A가 T로 치환된 변이, 252번 위치의 T가 C로 치환된 변이, 306번 위치의 A가 C로 치환된 변이, 309번 위치의 T가 C로 치환된 변이, 312번 위치의 G가 A로 치환된 변이, 315번 위치의 C가 A로 치환된 변이, 324번 위치의 T가 C로 치환된 변이, 327번 위치의 C가 G로 치환된 변이, 330번 위치의 G가 A로 치환된 변이, 333번 위치의 C가 T로 치환된 변이, 336번 위치의 C가 G로 치환된 변이, 339번 위치의 T가 C로 치환된 변이, 342번 위치의 A가 T로 치환된 변이, 345번 위치의 T가 A로 치환된 변이, 357번 위치의 A가 G로 치환된 변이, 363번 위치의 T가 A로 치환된 변이, 366번 위치의 T가 C로 치환된 변이, 378번 위치의 C가 T로 치환된 변이, 379번 위치의 C가 A로 치환된 변이, 381번 위치의 C가 G로 치환된 변이, 393번 위치의 T가 C로 치환된 변이, 396번 위치의 T가 A로 치환된 변이, 543번 위치의 T가 C로 치환된 변이, 546번 위치의 T가 C로 치환된 변이, 549번 위치의 C가 A로 치환된 변이, 555번 위치의 T가 C로 치환된 변이, 558번 위치의 T가 C로 치환된 변이, 561번 위치의 T가 A로 치환된 변이, 573번 위치의 C가 T로 치환된 변이, 579번 위치의 T가 C로 치환된 변이, 582번 위치의 G가 T로 치환된 변이, 588번 위치의 T가 C로 치환된 변이, 612번 위치의 T가 C로 치환된 변이, 618번 위치의 G가 C로 치환된 변이, 621번 위치의 T가 C로 치환된 변이, 627번 위치의 A가 T로 치환된 변이, 633번 위치의 T가 C로 치환된 변이, 639번 위치의 T가 G로 치환된 변이, 654번 위치의 C가 T로 치환된 변이, 673번 위치의 C가 T로 치환된 변이, 675번 위치의 C가 A로 치환된 변이, 678번 위치의 C가 T로 치환된 변이, 681번 위치의 C가 G로 치환된 변이, 684번 위치의 C가 G로 치환된 변이, 705번 위치의 G가 C로 치환된 변이, 708번 위치의 C가 T로 치환된 변이, 729번 위치의 A가 C로 치환된 변이, 735번 위치의 T가 C로 치환된 변이, 738번 위치의 G가 T로 치환된 변이, 741번 위치의 T가 C로 치환된 변이, 744번 위치의 T가 C로 치환된 변이, 747번 위치의 T가 A로 치환된 변이, 771번 위치의 T가 C로 치환된 변이, 786번 위치의 T가 C로 치환된 변이, 789번 위치의 C가 T로 치환된 변이, 792번 위치의 T가 G로 치환된 변이, 810번 위치의 C가 T로 치환된 변이, 825번 위치의 T가 C로 치환된 변이, 828번 위치의 C가 T로 치환된 변이, 838번 위치의 T가 C로 치환된 변이, 840번 위치의 G가 C로 치환된 변이, 846번 위치의 C가 G로 치환된 변이, 849번 위치의 G가 A로 치환된 변이, 858번 위치의 A가 G로 치환된 변이, 867번 위치의 T가 C로 치환된 변이, 879번 위치의 T가 C로 치환된 변이, 882번 위치의 C가 G로 치환된 변이, 885번 위치의 C가 T로 치환된 변이, 891번 위치의 C가 T로 치환된 변이, 900번 위치의 T가 C로 치환된 변이, 903번 위치의 C가 A로 치환된 변이, 906번 위치의 T가 C로 치환된 변이, 924번 위치의 G가 T로 치환된 변이, 936번 위치의 T가 C로 치환된 변이, 939번 위치의 T가 C로 치환된 변이, 948번 위치의 A가 C로 치환된 변이, 954번 위치의 A가 C로 치환된 변이, 963번 위치의 A가 T로 치환된 변이, 966번 위치의 T가 C로 치환된 변이, 1026번 위치의 A가 G로 치환된 변이, 1029번 위치의 G가 C로 치환된 변이, 1038번 위치의 C가 T로 치환된 변이, 1047번 위치의 T가 C로 치환된 변이, 1053번 위치의 T가 C로 치환된 변이, 1066번 위치의 A가 C로 치환된 변이, 1068번 위치의 A가 C로 치환된 변이, 1086번 위치의 C가 T로 치환된 변이, 및 1110번 위치의 T가 C로 치환된 변이로 이루어진 군에서 선택된 1 이상, 25 이상, 66 이상, 80 이상, 또는 상기 91개 모든 변이를 포함하는 것일 수 있다.
상기와 같은 변이가 도입되어 제조된 LMY의 약독화된 변이주는 수탁번호 13394BP의 LMY ver2 바이러스일 수 있으며, 상기 LMY ver2 바이러스는 NSP1 단백질을 암호화하는 유전자로서 서열번호 2의 핵산 서열을 갖는 것일 수 있다.
따라서, 상기 [X]는 수탁번호 13394BP를 갖는 LMY ver2 바이러스의 NSP1 유전자 (서열번호 2)의 핵산 서열, LMY 모균주의 NSP1 유전자 (서열번호 1)의 핵산 서열, 또는 상기 핵산서열과 동등한 기능을 유지하는 범위 내에서 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상의 서열 상동성을 갖는 핵산 서열일 수 있다.
본 명세서에서 제공하는 LMY의 변이주 서열, 예컨대 LMY ver2 (서열번호 2)의 서열은 야생형 LMY 부위에 비해 코톤쌍 편향 (Codon Pair Bias, CPB)이 더 낮은 것일 수 있고, 상기 야생형 LMY 부위는 서열번호 1의 핵산 서열로 이루어지는 것일 수 있고, 이에 제한되는 것은 아니다.
일 예에서, 상기 [Y]는 아미노산 서열 LLAFSITYTPVMIYALKVSRGRLLGL (서열번호 3)의 돼지생식기호흡기증후군 바이러스 유래의 T 세포 에피톱-EP7를 암호화하는 핵산 서열, 예컨대, 서열번호 4의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 4의 핵산 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
다른 예에서, 상기 [Y]는 AscI 제한 효소 인식 부위 (서열번호 8), Kozak 시퀀스 (서열번호 13) 및 TRS6 (서열번호 14)로 이루어진 군으로 선택되는 1 이상을 추가로 포함할 수 있으며, 예컨대, 서열번호 20의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 20의 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
일 예에서, 상기 [Y]는 아미노산 서열 LWGVYSAIETWKFITSRCRLCLLGRKYILAPAHHVESA (서열번호 12)의 돼지생식기호흡기증후군 바이러스 유래의 T 세포 에피톱-EP8을 암호화하는 핵산 서열, 예컨대, 서열번호 10의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 10의 핵산 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
다른 예에서, 상기 [Y]는 AscI 제한 효소 인식 부위 (서열번호 8), Kozak 시퀀스 (서열번호 13) 및 TRS6 (서열번호 14)로 이루어진 군으로 선택되는 1 이상을 추가로 포함할 수 있으며, 예컨대, 서열번호 21의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 21의 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
또한, 상기 [Z]는 수탁번호 KCTC 13393BP를 갖는 BP2017-2 바이러스의 ORF2 내지 ORF7 부위의 유전자 핵산 서열, 예컨대, 서열번호 5의 핵산 서열, 또는 상기 서열과 동등한 기능을 유지하는 범위 내에서 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상의 서열 상동성을 갖는 핵산 서열일 수 있다.
본 발명의 일 예에 따르면, 상기 구조식 1의 [Z]의 3' 말단에 [A]n을 추가로 포함할 수 있다. 상기 n은 염기 A를 포함하는 뉴클레오타이드의 개수로, 10 내지 100의 정수일 수 있다. 바람직하게는 10 내지 80, 10 내지 70, 10 내지 60, 10 내지 50, 10 내지 40, 10 내지 30, 15 내지 80, 15 내지 70, 15 내지 60, 15 내지 50, 15 내지 40, 15 내지 30, 20 내지 30, 20 내지 26의 정수일 수 있다.
상기 폴리뉴클레오타이드는 DNA, RNA (핵산 서열이 DNA 기준으로 표현된 경우, 서열 내 내 모든 또는 일부 티민 (Thymine, T)이 우라실 (Uracil, U)로 치환된 서열임), 상기 RNA의 역전사체 (DNA), 또는 이들의 조합일 수 있다. 상기 폴리뉴클레오타이드는 PRRSV의 키메라 바이러스의 유전체 (genome)로서의 기능을 가질 수 있다.
이에, 본 발명의 다른 예는 상기 구조식 1의 구조를 갖는 폴리뉴클레오타이드를 포함하는 돼지생식기호흡기증후군 바이러스 (PRRSV)의 키메라 바이러스 변이주를 제공한다. 상기 키메라 바이러스 변이주는 구조식 1의 구조를 갖는 폴리뉴클레오타이드를 유전체로서 포함하는 것일 수 있다.
상기 본 명세서에서, 용어 '키메라 바이러스 변이주'는 (a) PRRS 타입 II 바이러스, 예컨대, LMY 모균주 (Accession No. GenBank accession no.DQ473474.1) 또는 수탁번호 13394BP의 LMY ver2 바이러스의 NSP1 유전자 (ORF1a 및 ORF1b) 및 (b) 수탁번호 KCTC 13393BP를 갖는 BP2017-2 바이러스의 ORF2 내지 ORF7를 포함하는 키메라 바이러스에 (c) 돼지생식기호흡기증후군 바이러스 유래의 T 세포 에피톱-EP7 암호화 유전자가 도입되어 변형된 바이러스를 표현하기 위한 것으로, 'T 세포 에피톱-EP7 암호화 유전자를 포함하는 키메라 바이러스', 'EP7 발현 키메라 바이러스', 'PRRSV-EP7 키메라 바이러스', 또는 약칭하여 'PRRSV의 키메라 바이러스'로도 표현될 수 있다.
상기 본 명세서에서, 용어 '키메라 바이러스 변이주'는 (a) PRRS 타입 II 바이러스, 예컨대, LMY 모균주 (Accession No. GenBank accession no.DQ473474.1) 또는 수탁번호 13394BP의 LMY ver2 바이러스의 NSP1 유전자 (ORF1a 및 ORF1b) 및 (b) 수탁번호 KCTC 13393BP를 갖는 BP2017-2 바이러스의 ORF2 내지 ORF7를 포함하는 키메라 바이러스에 (c) 돼지생식기호흡기증후군 바이러스 유래의 T 세포 에피톱-EP8 암호화 유전자가 도입되어 변형된 바이러스를 표현하기 위한 것으로, 'T 세포 에피톱-EP8 암호화 유전자를 포함하는 키메라 바이러스', 'EP8 발현 키메라 바이러스', 'PRRSV-EP8 키메라 바이러스', 또는 약칭하여 'PRRSV의 키메라 바이러스'로도 표현될 수 있다.
상기 PRRSV의 키메라 바이러스 변이주의 유전체는 DNA 또는 RNA일 수 있으며, 바람직하게는 RNA일 수 있다.
구조식 1의 구조를 갖는 폴리뉴클레오타이드 (PRRSV의 키메라 바이러스 변이주의 유전체)은 천연의 것이 아닐 수 있으며, 재조합적 또는 합성적으로 제조된 것일 수 있다.
일 예에서, 상기 구조식 1은 서열번호 6의 핵산서열 또는 상기 핵산 서열과 동등한 기능을 유지하는 범위 내에서 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상의 서열 상동성을 갖는 핵산 서열을 포함하는 것일 수 있다. 예컨대, 서열번호 6의 핵산서열일 수 있다.
일 예에서, 상기 구조식 1은 서열번호 11의 핵산서열 또는 상기 핵산 서열과 동등한 기능을 유지하는 범위 내에서 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상의 서열 상동성을 갖는 핵산 서열을 포함하는 것일 수 있다. 예컨대, 서열번호 11의 핵산서열일 수 있다.
하기 표 1에서, LMY ver2의 NSP1 유전자의 염기서열 중 굵은 글씨로 표시된 부분은 NSP1-beta 부위를 의미한다.
Figure PCTKR2022001653-appb-img-000001
Figure PCTKR2022001653-appb-img-000002
Figure PCTKR2022001653-appb-img-000003
(표 1에서, AscI 제한효소 인식부위는 밑줄, Kozak 서열은 이탤릭체, TRS6는 밑줄 및 이탤릭체로 각각 표시하였으며, Kozak 서열과 TRS6 사이의 부위는 EP7 및/또는 EP8 암호화 핵산서열이고, EP7 및/또는 EP8 핵산서열 앞뒤로 ATG (start codon), TAG (stop codon)가 붙어서 삽입됨)
Figure PCTKR2022001653-appb-img-000004
Figure PCTKR2022001653-appb-img-000005
Figure PCTKR2022001653-appb-img-000006
Figure PCTKR2022001653-appb-img-000007
Figure PCTKR2022001653-appb-img-000008
Figure PCTKR2022001653-appb-img-000009
Figure PCTKR2022001653-appb-img-000010
Figure PCTKR2022001653-appb-img-000011
Figure PCTKR2022001653-appb-img-000012
Figure PCTKR2022001653-appb-img-000013
Figure PCTKR2022001653-appb-img-000014
Figure PCTKR2022001653-appb-img-000015
Figure PCTKR2022001653-appb-img-000016
Figure PCTKR2022001653-appb-img-000017
(상기 표 1 및 2에 있어서, 본 명세서에서 제공되는 폴리뉴클레오타이드 (RNA)는 기재된 서열 중 T가 U로 치환된 핵산 서열을 포함하는 것일 수 있고, 표 2에서 각각 도입된 T 세포 에피톱-EP7 (Modified T cell epitope-EP7) 및/또는 T 세포 에피톱-EP8 (Modified T cell epitope-EP8)의 핵산서열을 밑줄로 표시하였다)
상기 구조식 1의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스는 1 내지 80계대, 1 내지 70계대, 1 내지 60계대, 1 내지 50계대, 1 내지 40계대, 1 내지 30계대, 1 내지 20계대, 1 내지 10계대, 또는 1 내지 5계대 배양된 자손 바이러스를 포함하는 것일 수 있다.
일 구체예는 유전체로서 서열번호 6의 폴리뉴클레오타이드를 포함하는 핵산서열을 포함하는 상기 PRRSV의 키메라 바이러스를 제공하며, 이를 PRRSV-EP7라고 명명하였다. 상기 PRRSV-EP7 바이러스는 수탁번호 KCTC 14269BP를 갖는 바이러스일 수 있다.
일 구체예는 유전체로서 서열번호 11의 폴리뉴클레오타이드를 포함하는 핵산서열을 포함하는 상기 PRRSV의 키메라 바이러스를 제공하며, 이를 rPRRSV-EP8이라고 명명하였다. 상기 rPRRSV-EP8 바이러스는 수탁번호 KCTC 14270BP를 갖는 바이러스일 수 있다.
또한, 다른 예는 상기한 구조식 1의 폴리뉴클레오타이드 (e.g., PRRSV의 키메라 바이러스 변이주의 유전체)를 포함하는 벡터를 제공한다. 상기 벡터는 재조합적으로 얻어진 것일 수 있고, 상기 폴리뉴클레오타이드의 전달체(carrier) 또는 발현벡터로서 사용될 수 있다.
다른 예는 상기한 구조식 1의 폴리뉴클레오타이드 (e.g., PRRSV의 키메라 바이러스 변이주의 유전체; RNA, DNA, 또는 이들 모두), 또는 이를 포함하는 벡터를 포함하는 세포를 제공할 수 있다. 상기 세포는 재조합적으로 얻어진 것일 수 있고, 상기 키메라 바이러스 변이주를 다량 제조하기 위해, 상기 키메라 바이러스 변이주의 유전체(RNA, DNA, 또는 이를 포함하는 벡터), 또는 상기 유전체를 포함하는 키메라 바이러스 변이주가 트랜스펙션되는 세포를 의미하며, 상기 목적 범위 내라면 세포의 종류를 특별히 한정하지는 않는다.
키메라 바이러스 변이주의 용도
다른 예는 상기 구조식 1의 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 구조식 1의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 변이주로 이루어진 군에서 선택된 1종 이상을 포함하는, 돼지 생식기 호흡기 증후군 바이러스 백신 조성물을 제공한다.
다른 예는 상기 구조식 1의 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 구조식 1의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 변이주로 이루어진 군에서 선택된 1종 이상을 포함하는, 돼지 생식기 호흡기 증후군의 예방 및/또는 치료용 약학적 조성물을 제공한다. 상기 돼지 생식기 호흡기 증후군은 돼지 생식기 호흡기 증후군 바이러스 (PRRSV)에 의하여 유발되는 것일 수 있다.
다른 예는 상기 구조식 1의 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 구조식 1의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 변이주로 이루어진 군에서 선택된 1종 이상의 약학적 유효량을 돼지 생식기 호흡기 증후군 바이러스에 대한 면역화, 또는 돼지 생식기 호흡기 증후군 바이러스 감염 또는 돼지 생식기 호흡기 증후군의 예방 및/또는 치료를 필요로 하는 개체에게 투여하는 단계를 포함하는, 돼지 생식기 호흡기 증후군 바이러스에 대한 면역화, 또는 돼지 생식기 호흡기 증후군 바이러스 감염 또는 돼지 생식기 호흡기 증후군의 예방 및/또는 치료 방법을 제공한다. 상기 개체는 인간을 제외한 동물일 수 있으며, 예컨대, 돼지일 수 있다.
상기 PRRSV의 키메라 바이러스 변이주는 계대 배양된 자손을 포함할 수 있다. 상기 계대 배양된 자손은 1 내지 80계대, 1 내지 70계대, 1 내지 60계대, 1 내지 50계대, 1 내지 40계대, 1 내지 30계대, 1 내지 20계대, 1 내지 10계대, 또는 1내지 5계대 배양된 자손 바이러스를 포함하는 것일 수 있다.
일 예에 따르면, 상기 백신은 생백신 또는 사백신일 수 있으나, 생백신인 것이 바람직하다. 구체적으로, 본원에 기술된 약독화된 PRRS 키메라 바이러스 변이주는 약제학적으로 허용되는 담체에 전술한 하나 이상의 바이러스주를 생존 상태로 함유하는 변형 생백신일 수 있다. 또한, 또는 대안적으로, 불활성화된 바이러스를 사백신을 제조하는 데에도 사용할 수 있다.
상기 백신은 담체, 희석제, 부형제, 및 어주번트 (adjuvant)로 이루어진 군에서 선택되는 1 이상을 더 포함할 수 있다. 약제학적으로 허용되는 담체는 그 종류를 특별히 한정하지 않으나, 임의의 모든 용매, 분산 매질, 코팅, 안정제, 보존제, 항균제 및 항진균제, 등장제, 흡수지연제 등을 포함할 수 있다.
본 명세서에서 제공되는 PRRSV-EP7 키메라 바이러스 변이주의 유전체, 및 이를 포함하는 백신 조성물은 PRRS 질환의 영향으로부터 돼지를 예방하기 위해 사용될 수 있다. 또한, rPRRSV-EP7 키메라 바이러스 변이주의 면역원성 단편 또는 분획을 비롯한 서브유닛도 PRRS 질환의 영향으로부터 돼지를 예방하는데 사용될 수 있다. 본 발명의 약독화된 키메라 바이러스 변이주 또는 이를 포함하는 백신 조성물은 PRRS를 유발하는 PRRS 바이러스주에 돼지가 노출되기 전에 예방적으로 투여될 수 있고, 상기 바이러스주에 돼지가 노출됨과 동시에 돼지에 투여될 수 있고, 바이러스주에 표적 돼지가 노출된 후 치료적으로 투여될 수 있다.
본 명세서에서 제공되는 PRRSV-EP8 키메라 바이러스 변이주의 유전체, 및 이를 포함하는 백신 조성물은 PRRS 질환의 영향으로부터 돼지를 예방하기 위해 사용될 수 있다. 또한, rPRRSV-EP8 키메라 바이러스 변이주의 면역원성 단편 또는 분획을 비롯한 서브유닛도 PRRS 질환의 영향으로부터 돼지를 예방하는데 사용될 수 있다. 본 발명의 약독화된 키메라 바이러스 변이주 또는 이를 포함하는 백신 조성물은 PRRS를 유발하는 PRRS 바이러스주에 돼지가 노출되기 전에 예방적으로 투여될 수 있고, 상기 바이러스주에 돼지가 노출됨과 동시에 돼지에 투여될 수 있고, 바이러스주에 표적 돼지가 노출된 후 치료적으로 투여될 수 있다.
본 명세서에서 제공되는 백신 조성물은 돼지 생식기 호흡기 증후군 (PRRS) 및/또는 돼지 생식기 호흡기 증후군 바이러스 (PRRSV) 감염의 예방, 예를 들어 북미형 PRRSV 및/또는 유럽형 PRRSV의 감염 및/또는 이에 의해 발병하는 PRRS의 예방에 이용될 수 있다. 일 예에서 상기 북미형 PRRSV는 타입 II형 VR2332 바이러스 균주 (strain)일 수 있고, 상기 유럽형 PRRSV는 타입 I 바이러스 (Lelystad virus, LV)일 수 있으나, 이에 제한되는 것은 아니다.
상기한 돼지 생식기 호흡기 증후군의 예방 및/또는 치료용 약학적 조성물은 당업자에게 공지된 추가 성분을 포함할 수 있고, 약학적 조성물의 제조에 통상적으로 사용하는 적절한 담체, 부형제 및 희석제를 더 포함할 수 있다.
또한 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 경구형 제형, 외용제, 좌제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다. 당해 기술 분야에 알려진 적합한 제제는 문헌 (Remington's Pharmaceutical Science, 최근, Mack Publishing Company, Easton PA)에 개시되어 있는 것을 사용하는 것이 바람직하다.
상기 약학적 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토오스, 덱스트로오스, 수크로오스, 소르비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘포스페이트, 칼슘 실리케이트, 셀룰로오스, 메틸 셀룰로오스, 미정질 셀룰로오스, 폴리비닐 피롤리돈, 물, 메틸히드록시 벤조에이트, 프로필히드록시 벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유 등이 있다. 상기 조성물을 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다. 경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 상기 조성물에 적어도 하나 이상의 부형제 예를 들면, 전분, 칼슘 카보네이트, 수크로오스, 락토오스, 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 마그네슘 스테아레이트, 탈크 같은 윤활제들도 사용된다. 경구투여를 위한 액상 제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조 제제, 좌제가 포함된다. 비수성용제, 현탁제로는 프로필렌글리콜, 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔, 마크로골, 트윈61, 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다.
상기 약학적 조성물의 바람직한 투여량은 개체의 상태 및 체중, 질병의 정도, 약물형태, 투여경로 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있다.
예를 들어, 바람직한 효과를 위해서, 본 발명의 조성물은 1일 0.0001 내지 1,000 mg/kg (체중)의 양으로 투여할 수 있다. 상기 조성물의 투여는 하루에 한번 투여할 수도 있고, 수 회 나누어 투여할 수도 있다. 일 예에서 상기 약학적 조성물은 백신 조성물일 수 있다. 상기 백신은 생백신 및/또는 사백신일 수 있으며, 구체적으로, 본원에 기술된 약독화된 PRRS 키메라 바이러스는 약제학적으로 허용되는 담체에 전술한 하나 이상의 바이러스주를 생존 상태로 함유하는 변형 생백신일 수 있다. 또한, 또는 대안적으로, 불활성화된 바이러스를 사백신을 제조하는 데에도 사용할 수 있다.
상기 백신은 PRRS의 예방 목적 범위에서 투여 대상의 체중, 연령, 식이 단계 및/또는 면역력을 고려하여 적절한 농도의 PRRSV 변이주를 포함할 수 있다. 예를 들어 백신 조성물 내의 바이러스 변이주 투여량은 TCID50 2 내지 6, 또는 TCID50 3 내지 4, 범위이나, 개체의 종류에 따라 달라 질 수 있으며, 이에 제한되지 않는다.
상기 조성물은, PRRSV-EP7 키메라 바이러스 변이주 함량 기준으로, TCID50 (Median Tissue Culture Infectious Dose; 세포의 50%를 감염시키는 바이러스 농도) 2 내지 6, 또는 TCID50 3 내지 4 범위로 투여할 수 있고, 개체 종류에 따라 달라질 수 있으며, 이에 제한되는 것은 아니다. 상기 조성물의 투여는 하루에 한번 투여할 수도 있고, 수 회 나누어 투여할 수도 있다.
상기 조성물은, PRRSV-EP8 키메라 바이러스 변이주 함량 기준으로, TCID50 (Median Tissue Culture Infectious Dose; 세포의 50%를 감염시키는 바이러스 농도) 2 내지 6, 또는 TCID50 3 내지 4 범위로 투여할 수 있고, 개체 종류에 따라 달라질 수 있으며, 이에 제한되는 것은 아니다. 상기 조성물의 투여는 하루에 한번 투여할 수도 있고, 수 회 나누어 투여할 수도 있다.
본 발명의 조성물은 개체에게 다양한 경로로 투여될 수 있다. 투여의 모든 방식은 예상될 수 있다.
본 명세서에서 제공되는 PRRSV의 키메라 바이러스 변이주 또는 이를 포함하는 조성물은 경구, 또는 피하, 근육내, 피내, 설하, 경피, 직장, 경점막, 흡입을 통한 표면적, 협측 투여 등의 비경구 투여를 통해, 또는 이의 조합으로 투여될 수 있다. 또한, PRRS 키메라 바이러스 변이주는 바이러스의 서방출을 허용할 수 있는 이식체 형태로 투여될 수 있다. 다른 예에서, 상기 키메라 바이러스 변이주 또는 이를 포함하는 조성물을 피하 주사, 정맥내 주사, 진피내 주사, 비경구 주사, 근육내 주사, 무침(needle free) 주사, 전기천공, 경구 전달, 비내 전달, 구비강(oronasal) 전달, 또는 그의 임의의 조합에 의해 투여할 수 있다.
일 구체예에서, 상기 PRRSV의 키메라 바이러스 변이주 또는 이를 포함하는 조성물은 주사, 흡입 또는 이식을 통해 투여될 수 있고, 주사가 특히 바람직하다. 백신접종 또는 치료의 원하는 기간 및 유효성에 따라 상기 키메라 바이러스 또는 이를 포함하는 조성물은 1회 또는 여러 번, 또한 간헐적으로, 예컨대 수일, 수주 또는 수개월 동안 매일 다른 투여량으로 투여될 수 있다. 주사는 원하는 양으로 주사하거나 피하 혹은 비강에 분무하여 주입할 수 있다, 또는 대안적으로 연속 주입할 수 있다.
병용투여
일 구체예에서, 하기 구조식 2로 표현되는 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 구조식 2의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 변이주로 이루어진 군에서 선택된 1종 이상과,
하기 구조식 3으로 표현되는 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 구조식 3의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 변이주로 이루어진 군에서 선택된 1종 이상은 함께 사용 (병용)될 수 있다:
[구조식 2]
5'-[X]-[Ya]-[Z]-3'
[구조식 3]
5'-[X]-[Yb]-[Z]-3'
상기 구조식 2 및 3에서, [X]는 앞서 기재된 구조식 1과 동일하며, 즉, PRRS 타입 II 바이러스, 예컨대, LMY 모균주 (Accession No. GenBank accession no.DQ473474.1) 또는 수탁번호 KCTC 13394BP를 갖는 LMY ver2 바이러스의 NSP1 유전자 (NSP1-alpha 유전자 및 NSP1-beta 유전자; ORF1a 및 ORF1b)의 핵산 서열 (예컨대, 서열번호 2) 또는 상기 핵산 서열과 동등한 기능이 유지되는 범위 내에서 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열을 포함하는 것일 수 있으며, 예를 들어, 상기 LMY ver2 바이러스의 NSP1 유전자의 핵산 서열은 서열번호 2로 표현되는 것일 수 있고, 상기 LMY 모균주의 NSP1 유전자의 핵산 서열은 서열번호 1로 표현되는 것일 수 있다.
상기 [Ya]는 PRRSV 유래의 멤브레인 단백질인 T 세포 에피톱-EP7 (LLAFSITYTPVMIYALKVSRGRLLGL; 서열번호 3)을 암호화하는 핵산 서열 또는 이와 이와 기능적 동등성을 유지하면서 상기 핵산 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있고, 구체적으로, 상기 EP7 암호화 핵산 서열은 서열번호 4의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 4의 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
또한, 상기 [Ya]는 변형된 EP7 암호화 핵산 서열일 수 있다. 상기 변형된 EP7 암호화 핵산 서열은, 상기 EP7 암호화 핵산 서열에 더하여, AscI 제한 효소 인식 부위 (서열번호 8), Kozak 서열 (서열번호 13) 및 전자조절서열(e.g., TRS6 (서열번호 14))로 이루어진 군으로 선택되는 1 이상을 추가로 포함할 수 있다. 일 예에서, 상기 AscI 제한 효소 인식 부위는 상기 EP7 암호화 핵산 서열의 양 말단에 각각 포함될 수 있다. 일 예에서, 상기 Kozak 서열 및/또는 전사조절서열은 각각 독립적으로 상기 EP7 암호화 핵산 서열의 5' 말단 및/또는 3' 말단, 예컨대, Kozak 서열은 5' 말단에, 전사조절서열(TRS6)은 3' 말단에 포함될 수 있다.
일 구체예에서, 상기 [Ya]는 EP7 암호화 핵산 서열 (e.g., 서열번호 4), 상기 EP7 암호화 핵산 서열의 5' 말단에 위치하는 Kozak 서열 (e.g., 서열번호 13), 상기 EP7 암호화 핵산 서열의 3' 말단에 위치하는 TRS6 (e.g., 서열번호 14), 및 상기 Kozak 서열의 5' 말단 및 상기 TRS6의 3' 말단에 각각 위치하는 AscI 제한효소 인식 부위 (서열번호 8)을 포함하는 것일 수 있으며, 구체적으로 서열번호 20의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 20의 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
상기 [Yb]는 PRRSV 유래의 멤브레인 단백질인 T 세포 에피톱-EP8 (LWGVYSAIETWKFITSRCRLCLLGRKYILAPAHHVESA; 서열번호 12)을 암호화하는 핵산 서열 또는 이와 이와 기능적 동등성을 유지하면서 상기 핵산 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있고, 구체적으로, 상기 EP8 암호화 핵산 서열은 서열번호 10의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 10의 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
또한, 상기 [Yb]는 변형된 EP8 암호화 핵산 서열일 수 있다. 상기 변형된 EP8 암호화 핵산 서열은, 상기 EP8 암호화 핵산 서열에 더하여, AscI 제한 효소 인식 부위 (서열번호 8), Kozak 서열 (서열번호 13) 및 전자조절서열(e.g., TRS6 (서열번호 14))로 이루어진 군으로 선택되는 1 이상을 추가로 포함할 수 있다. 일 예에서, 상기 AscI 제한 효소 인식 부위는 상기 EP8 암호화 핵산 서열의 양 말단에 각각 포함될 수 있다. 일 예에서, 상기 Kozak 서열 및/또는 전사조절서열은 각각 독립적으로 상기 EP8 암호화 핵산 서열의 5' 말단 및/또는 3' 말단, 예컨대, Kozak 서열은 5' 말단에, 전사조절서열(TRS6)은 3' 말단에 포함될 수 있다.
일 구체예에서, 상기 [Yb]는 EP8 암호화 핵산 서열 (e.g., 서열번호 10), 상기 EP8 암호화 핵산 서열의 5' 말단에 위치하는 Kozak 서열 (e.g., 서열번호 13), 상기 EP8 암호화 핵산 서열의 3' 말단에 위치하는 TRS6 (e.g., 서열번호 14), 및 상기 Kozak 서열의 5' 말단 및 상기 TRS6의 3' 말단에 각각 위치하는 AscI 제한효소 인식 부위 (서열번호 8)을 포함하는 것일 수 있으며, 구체적으로 서열번호 21의 핵산 서열 또는 이와 기능적 동등성을 유지하면서 서열번호 21의 서열과 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
상기 [Z]는 앞서 기재된 구조식 1과 동일하며, 즉 수탁번호 KCTC 13393BP를 갖는 BP2017-2 바이러스의 ORF2 내지 ORF7 부위의 유전자 핵산 서열 (예컨대, 서열번호 5) 또는 상기 핵산 서열과 동등한 기능이 유지되는 범위 내에서 70% 이상 (또는 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상; 이하 동일하게 적용됨)의 서열 상동성을 갖는 핵산 서열일 수 있다.
따라서, 일 예는,
상기 구조식 2의 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 구조식 1의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 변이주로 이루어진 군에서 선택된 1종 이상, 및
상기 구조식 3의 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 구조식 2의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 변이주로 이루어진 군에서 선택된 1종 이상
을 포함하는, 돼지 생식기 호흡기 증후군 바이러스 백신 조성물을 제공한다.
다른 예는,
상기 구조식 2의 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 구조식 1의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 변이주로 이루어진 군에서 선택된 1종 이상, 및
상기 구조식 3의 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 구조식 2의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 변이주로 이루어진 군에서 선택된 1종 이상
을 포함하는, 돼지 생식기 호흡기 증후군의 예방 및/또는 치료용 조성물을 제공한다. 상기 돼지 생식기 호흡기 증후군은 돼지 생식기 호흡기 증후군 바이러스 (PRRSV)에 의하여 유발되는 것일 수 있다.
다른 예는,
상기 구조식 2의 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 구조식 1의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 변이주로 이루어진 군에서 선택된 1종 이상, 및
상기 구조식 3의 폴리뉴클레오타이드, 이를 포함하는 벡터, 및 상기 구조식 2의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 변이주로 이루어진 군에서 선택된 1종 이상의
의약학적 유효량을 돼지 생식기 호흡기 증후군 바이러스에 대한 면역화, 또는 돼지 생식기 호흡기 증후군 바이러스 감염의 예방 또는 돼지 생식기 호흡기 증후군의 예방을 필요로 하는 개체에게 병용 투여하는 단계를 포함하는, 돼지 생식기 호흡기 증후군 바이러스에 대한 면역화, 또는 돼지 생식기 호흡기 증후군 바이러스 감염의 예방 또는 돼지 생식기 호흡기 증후군의 예방 방법을 제공한다. 상기 개체는 인간을 제외한 동물일 수 있으며, 예컨대, 돼지일 수 있다.
상기 PRRSV의 키메라 바이러스 및/또는 이의 변이주는 계대 배양된 자손을 포함할 수 있다. 상기 계대 배양된 자손은 1 내지 80계대, 1 내지 70계대, 1 내지 60계대, 1 내지 50계대, 1 내지 40계대, 1 내지 30계대, 1 내지 20계대, 1 내지 10계대, 또는 1내지 5계대 배양된 자손 바이러스를 포함하는 것일 수 있다.
일 예에 따르면 상기 PRRSV-EP7 키메라 바이러스는 피접종자의 혈액, 예를 들어, 말초혈액단핵구 (PBMC)와 반응하여 IFN-gamma 등의 사이토카인을 발현시키거나 발현을 증가시킬 수 있다. 상기 PRRSV-EP7 키메라 바이러스 또는 이를 포함하는 백신 조성물로 PBMC를 자극하면, EP7 유전자가 삽입되지 않은 PRRSV의 키메라 바이러스의 유전체, 및 이를 포함하는 백신 조성물에 비해 IFN-gamma를 약 1.05배 이상, 약 1.1배 이상, 약 1.3배 이상, 1.5배 이상, 약 1.7배 이상, 약 1.9배 이상, 또는 약 2.1배 이상으로 더 많이 발현시킬 수 있고, 약 2.5배 이하, 약 3.0배 이하, 약 3.5배 이하로 더 많이 발현시킬 수 있다.
일 예에 따르면 상기 PRRSV-EP7 키메라 바이러스는 PRRS에 감염된 돼지의 PBMCs를 자극할 수 있다. 상기 백신 조성물로 PRRS에 감염된 돼지의 PBMCs를 자극하면, 아무런 자극이 없었던 PBMCs에 비해 감염된 PRRSV의 양이 약 0.7배 이하, 약 0.5배 이하, 약 0.4배 이하, 약 0.3배 이하, 또는 약 0.2배 내지 약 0.3배로 감소할 수 있다.
일 예에 따르면 상기 PRRSV-EP8 키메라 바이러스는 피접종자의 혈액, 예를 들어, 말초혈액단핵구 (PBMC)와 반응하여 IFN-gamma 등의 사이토카인을 발현시키거나 발현을 증가시킬 수 있다. 상기 PRRSV-EP8 키메라 바이러스 또는 이를 포함하는 백신 조성물로 PBMC를 자극하면, EP8 유전자가 삽입되지 않은 PRRSV의 키메라 바이러스의 유전체, 및 이를 포함하는 백신 조성물에 비해 IFN-gamma를 약 1.1배 이상, 약 1.3배 이상, 1.5배 이상, 약 1.7배 이상, 약 1.9배 이상, 또는 약 2.1배 이상으로 더 많이 발현시킬 수 있고, 약 2.5배 이하, 약 3.0배 이하, 약 3.5배 이하로 더 많이 발현시킬 수 있다.
일 예에 따르면 상기 PRRSV-EP8 키메라 바이러스는 PRRS에 감염된 돼지의 PBMCs를 자극할 수 있다. 상기 백신 조성물로 PRRS에 감염된 돼지의 PBMCs를 자극하면, 아무런 자극이 없었던 PBMCs에 비해 감염된 PRRSV의 양이 약 0.7배 이하, 약 0.5배 이하, 약 0.4배 이하, 약 0.3배 이하, 또는 약 0.2배 내지 약 0.3배로 감소할 수 있다.
다른 예는,
(1) 수탁번호 13394BP를 갖는 LMY ver2 바이러스 또는 LMY 모균주 (Accession No. GenBank accession no.DQ473474.1)의 유전체를 제한효소 (e.g., AscI 및/또는 PacI)로 처리하여 폴리뉴클레오타이드 절편을 제조하는 단계;
(2) PRRSV 유래의 멤브레인 단백질인 T 세포 에피톱-EP7 및/또는 T 세포 에피톱-EP8을 포함하는 폴리뉴클레오타이드 절편을 준비하는 단계;
(3) 수탁번호 KCTC 13393BP를 갖는 BP2017-2 바이러스의 유전체를 제한효소 (e.g., AscI 및/또는 PacI)로 처리하여 폴리뉴클레오타이드 절편을 제조하는 단계; 및
(4) 상기 단계 (1) 내지 (3)에서 얻어진 폴리뉴클레오타이드 절편들을 재조합하여 감염성 클론(infectious clone)을 제조하는 단계
를 포함하는, 돼지생식기호흡기증후군 바이러스의 키메라 바이러스 변이주를 생산하는 방법을 제공할 수 있다. 상기 단계 (1) 내지 (3)는 동시에 또는 순서에 무관하게 순차적으로 수행될 수 있다.
일 예에서, 상기 단계 (2)는 하기 핵산 서열을 화학적 또는 재조합적으로 합성하거나, PRRSV-EP7 바이러스의 유전체의 양 말단을 AscI로 처리하는 단계에 의하여 수행되는 것일 수 있다. AscI 처리의 경우, 얻어지는 폴리뉴클레오타이드 절편은 EP7 암호화 핵산 서열 (예컨대, 서열번호 4), 및 상기 EP7 암호화 핵산 서열의 양 말단에 AscI의 인식부위 (서열번호 8)을 각각 포함하는 것일 수 있다. 또한, 상기 단계 (2)는 상기 EP7 암호화 핵산 서열의 앞부분(5' 말단)에는 kozak 서열 (서열번호 13)을, 뒷부분 (3' 말단)에는 TRS6 (서열번호 14)를 삽입하는 단계를 추가적으로 포함할 수 있다. 이 경우, 상기 단계 (2)에서 얻어지는 폴리뉴클레오타이드 절편은 EP7 암호화 핵산 서열 (서열번호 4), 상기 EP7 암호화 핵산 서열의 5' 말단에 위치하는 Kozak 서열 (서열번호 13), 상기 EP7 암호화 핵산 서열의 3' 말단에 위치하는 TRS6 (서열번호 14), 및 상기 Kozak 서열의 5' 말단 및 상기 TRS6의 3' 말단에 각각 위치하는 AscI 제한효소 인식 부위 (서열번호 8)을 포함하는 것일 수 있으며, 구체적으로 서열번호 20의 핵산 서열로 표현되는 것일 수 있다.
일 예에서, 상기 단계 (2)는 하기 핵산 서열을 화학적 또는 재조합적으로 합성하거나, PRRSV-EP8 바이러스의 유전체의 양 말단을 AscI로 처리하는 단계에 의하여 수행되는 것일 수 있다. AscI 처리의 경우, 얻어지는 폴리뉴클레오타이드 절편은 EP8 암호화 핵산 서열 (예컨대, 서열번호 10), 및 상기 EP8 암호화 핵산 서열의 양 말단에 AscI의 인식부위 (서열번호 8)을 각각 포함하는 것일 수 있다. 또한, 상기 단계 (2)는 상기 EP8 암호화 핵산 서열의 앞부분(5' 말단)에는 kozak 서열(서열번호 13)을, 뒷부분(3' 말단)에는 TRS6 (서열번호 14)를 삽입하는 단계를 추가적으로 포함할 수 있다. 이 경우, 상기 단계 (2)에서 얻어지는 폴리뉴클레오타이드 절편은 EP8 암호화 핵산 서열 (서열번호 10), 상기 EP8 암호화 핵산 서열의 5' 말단에 위치하는 Kozak 서열 (서열번호 13), 상기 EP8 암호화 핵산 서열의 3' 말단에 위치하는 TRS6 (서열번호 14), 및 상기 Kozak 서열의 5' 말단 및 상기 TRS6의 3' 말단에 각각 위치하는 AscI 제한효소 인식 부위 (서열번호 8)을 포함하는 것일 수 있으며, 구체적으로 서열번호 21의 핵산 서열로 표현되는 것일 수 있다.
상기 단계 (1)의 LMY ver2 바이러스 또는 LMY 모균주의 유전체를 제한효소 AscI과 PacI로 처리하여 제조된 폴리뉴클레오타이드 절편은 NSP1-beta를 암호화하는 부위(ORF1a 및 ORF1b; 서열번호 2 또는 서열번호 1)를 포함할 수 있다.
상기 단계 (3)의 BP2017-2 바이러스의 유전체를 제한효소 AscI 와 PacI로 처리하여 제조된 폴리뉴클레오타이드 절편은 ORF2 내지 ORF7 부위 (서열번호 5)를 포함할 수 있다.
상기 단계 (4)의 폴리뉴클레오타이드 절편을 재조합하는 단계에서, 상기 (1) 내지 (3)의 폴리뉴클레오타이드 절편들은 2종 이상 또는 3종 모두 동시에 또는 순서에 무관하게 순차적으로 재조합될 수 있으며, 상기 재조합은 리가아제(ligase)를 사용하여 수행할 수 있다. 상기 재조합에 의하여 얻어진 감염성 클론을 세포에 접종해 키메라 바이러스를 제조할 수 있다.
상기 세포는 키메라 바이러스를 다량 제조하기 위해, 키메라 바이러스 DNA 또는 RNA, 또는 이를 포함하는 벡터, 감염성 클론, 키메라 바이러스가 트랜스펙션되는 세포를 의미하며, 세포의 종류를 특별히 한정하지는 않는다.
다른 예는 전술한 임의의 면역화, 예방 및/또는 치료 방법을 수행하기 위한 키트(kit)를 제공할 수 있다. 이 키트는 용기, 바람직하게는 앞서 설명된 PRRSV의 키메라 바이러스 변이주를 함유하는 백신 조성물, 약제학적으로 허용되는 담체, 보강제 및 PRRS 감염의 임상 징후 또는 효과, 바람직하게는 PRRS의 빈도 또는 중증도를 경감시키도록 이를 필요로 하는 동물에게 상기 면역원성 조성물을 투여하기 위한 사용설명서를 포함할 수 있다. 키트는 또한 주사 수단 및/또는 다른 형태의 투여 수단을 포함할 수 있다. 또한, 키트는 용매를 포함할 수 있다. 약독화된 백신은 동결건조될 수 있고, 용매로 복원되어 주사 및/또는 흡입용 용액이 될 수 있다. 용매는 물, 생리식염수, 완충액 또는 보강 용매일 수 있다. 키트는 약독화된 바이러스, 용매 및/또는 약제학적으로 허용되는 담체를 함유하는 분리 용기를 포함할 수 있다. 사용설명서는 하나 이상의 용기에 부착된 라벨 및/또는 인쇄물일 수 있다.
본 명세서에서 제공되는 PRRSV-EP7 및/또는 PRRSV-EP8 키메라 바이러스는 PRRS에 감염된 돼지의 PBMCs를 자극하여 IFN-gamma 발현을 유도하고, 타겟세포에서의 바이러스 증폭을 억제하여 효과적으로 방어할 수 있어, PRRS 예방 및/또는 치료용 백신으로 유용하게 사용할 수 있다.
도 1은 PRRS T 세포 펩타이드 에피톱-EP7 또는 T 세포 펩타이드 에피톱-EP8을 탑재한 PRRS 감염 클론의 모식도를 나타낸다 (PRRS T 세포 펩타이드 에피톱-EP7 또는 T 세포 펩타이드 에피톱-EP8은 PRRSV peptide로 표시됨).
도 2는 PRRS T 세포 펩타이드 에피톱-EP7 탑재한 rPRRSV-EP7를 1회, 4회, 6회, 및 29회 계대배양 수행 후 추출한 바이러스 유전자의 펩타이드 서열을 나타낸다.
도 3은 기존 백신주 및 펩타이드 발현 백신주 (rPRRSV-EP7)의 IFN-gamma 발현유도를 비교하여 IFN-gamma 발현 유도능을 확인할 수 있는 그래프를 나타낸다.
도 4는 기존 백신주와 펩타이드 발현 백신주 (rPRRSV-EP7)의 바이러스억제능분석 (Virus Suppression Assay, VSA) 그래프를 나타낸다.
도 5는 PRRS T 세포 펩타이드 에피톱-EP8 탑재한 rPRRSV-EP8를 1회, 6회, 및 29회 계대배양 수행 후 추출한 바이러스 유전자의 펩타이드 서열을 나타낸다.
도 6은 기존 백신주 및 펩타이드 발현 백신주 (rPRRSV-EP8)의 IFN-gamma 발현유도를 비교하여 IFN-gamma 발현 유도능을 확인할 수 있는 그래프를 나타낸다.
도 7는 기존 백신주와 펩타이드 발현 백신주 (rPRRSV-EP8)의 바이러스억제능분석 (Virus Suppression Assay, VSA) 그래프를 나타낸다.
도 8은 실시예 6-2에 따른 ELIspot IFN-gamma 측정을 통한 IFN-gamma 발현 세포수 측정 결과 그래프를 나타낸다.
이하, 본 발명을 실시예에 의해 상세히 설명한다. 단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명이 하기 실시예에 의해 한정되는 것은 아니다.
RNA는 쉽게 파괴되기 때문에 DNA로 바꾸어 모든 작업을 수행한 후에 이로부터 RNA를 합성하여 세포를 형질감염시켰다.
실시예 1: 키메라 바이러스의 제조
대한민국 특허 공개 제 2020-0081225 호 (본 명세서에서 참조로써 포함됨)의 실시예에 기재된 방법을 참조하여, 다음과 같이 돼지생식기호흡기증후군 (Porcine　Reproductive　and　Respiratory　Syndrome, PRRS) 키메라 바이러스를 제조하였다.
실시예 1-1. 키메라 바이러스의 디자인
돼지생식기호흡기증후군 (Porcine　Reproductive　and　Respiratory　Syndrome, PRRS) 키메라 바이러스는 LMY 균주의 변이주의 비구조단백질 (Non-Structural Protein 1, NSP1; 서열번호: 1) 부위 및 충남 공주시 남산리 남산농장에서 2017년에 분리된 BP2017-2의 ORF2, ORF3, ORF4, ORF5, ORF6, 및 ORF7 부위를 포함하도록 디자인하였다.
실시예 1-2. 약독화된 LMY 변이주 제조
기존 검역본부에서 분리한 PRRS 균주인, LMY 균주 (GenBank accession no.DQ473474.1.)를 사용해 NSP1 부위의 유전자의 염기서열 중 91개의 염기를 치환하여 LMY 변이주인 재조합 LMY ver2 바이러스 (LMY ver2 변이주)를 제조하였다. 상기 NSP1 부위의 유전자는 NSP1-alpha 부위에서 25개 염기가, NSP1-beta 부위에서 66개 염기가 치환되었다.
구체적으로, 상기 재조합 LMY ver2 바이러스는 일반적으로 알려진 SAVE (Synthetic Attenuated Virus Engineering) 프로그램을 이용하여 Codon Pair Deoptimization 원리 (표 3)에 따라 염기서열의 일부를 침묵 돌연변이 (silent mutation) 시켜 제조하였다. 우선, SAVE 프로그램을 사용해 LMY 바이러스의 유전자 코돈이 쌍으로 배열시 상호작용하여 생기는 편향성인 CPB (codon pair base)값을 컴퓨터 알고리즘을 이용해 수치화하였다. CPB 수치는 LMY 바이러스 유전자의 일부 염기서열이 다른 염기서열로 치환될 시 변동되며, 바이러스의 증식성과 밀접한 관련이 있다. 바이러스의 증식성은 염기서열 치환을 통해 CPB 수치가 감소 (deoptimization)되면, 증식성이 감소하고 약독화된다 (Virus Attenuation by Genome-Scale Changes in Codon Pair Bias, Science, 2008, J. Robert Coleman et al.). 본 발명자들은 LNY 모균주의 genome에서 유전적으로 안정성이 높은 NSP1 부위 (NSP1-alpha 및 NSP1-beta, 서열번호 1)를 선정하여 SAVE 프로그램으로 분석하였으며, CPB값이 비교적 높게 나타난 염기 부위 중 NSP1-alpha 부위에서 25개, NSP1-beta 부위에서 66개, 총 91개의 염기를 선택해 다른 염기로 치환하여 Deoptimization 시켜 LMY 바이러스 변이주를 제조하였다. 상기 방법으로 제조된 NSP1의 91개 염기서열이 돌연변이 (서열번호 2)된 LMY 바이러스 변이주를 LMY ver2로 지칭하였으며, 염기서열을 하기 표 3에 나타냈다. 상기 LMY ver2는 수탁번호 13394BP를 갖는다.
Figure PCTKR2022001653-appb-img-000018
Figure PCTKR2022001653-appb-img-000019
(상기 표 3에서, LMY ver2 NSP1 유전자의 핵산 서열 중 밑줄로 표시한 부분은 LMY NSP1 유전자에서 변이가 일어난 염기부분이다)
다음으로, LMY ver2 변이주의 약독화정도를 확인하기 위해, CPB 값을 측정하였다. LMY 모균주의 NSP1 CPB 값은 약 0.0139, NSP1-beta CPB 값은 약 0.016 정도로 측정되었으나, 본 발명의 LMY ver2 변이주의 CPB 값은 약 NSP1에서 -0.2393, NSP1-beta에서 약 -0.33 정도로 측정되었다. 이로부터 본 발명의 LMY ver2 변이주의 증식성이 기존 모균주보다 감소되어 있고, 약독화된 균주임을 알 수 있었다. 이와 관련된 자세한 내용은 표 4에 나타냈다.
바이러스 균주 NSP1 부위 Codon Pare Deoptimization (CPB)
LMY NSP1 0.01392516640897059
LMY ver2 NSP1 -0.2393184052058128
LMY NSP1-beta 0.016079236408108866
LMY ver2 NSP1-beta -0.3377269630038442
다음으로, LMY ver2의 감염성클론 (infectious clone)을 제조하였다.
우선, LMY 균주의 전체 유전자 서열(GenBank accession no.DQ473474.1.)을 7개의 단편(Fragments)으로 나누어 각각 합성하였다. 상기 7개의 단편 중 단편 1이 NPS-1 부위이며, 상기 부위를 LMY 균주의 NSP1 부위의 유전자 염기서열 중 91개 염기가 치환된 DNA 단편(서열번호 2)으로 합성하였다. 합성된 단편 유전자는 순서대로 하기 표 5의 제한효소로 자른 뒤 ligase로 연결하여 하나의 감염성 클론(infectious clone)을 제조하였다.
단편 제한효소 Tm (℃) 완충액 제한효소 인식부위
1 AsiSI 37 CutSmart GCGATCGC
XhoI 37 CutSmart CTCGAG
2 XhoI 37 NEB3.1 CTCGAG
MluI 37 NEB3.1 ACGCGT
3 MluI 37 NEB3.1 ACGCGT
NsiI 37 NEB3.1 ATGCAT
4 NsiI 37 CutSmart ATGCAT
SpeI 37 CutSmart ACTAGT
5 SpeI 37 CutSmart ACTAGT
AscI 37 CutSmart GGCGCGCC
6 AscI 37 CutSmart GGCGCGCC
AfeI (blunt) 37 CutSmart AGCGCT
7 AfeI (blunt) 37 CutSmart AGCGCT
PacI 37 CutSmart TTAATTAA
실시예 1-3. 키메라 바이러스 클론의 제작
도 1의 모식도와 같이, PRRS 바이러스는 총 8개의 ORF, 즉 ORF1a, ORF1b, 및 ORF2 내지 7을 포함하고 있다.
앞선 실시예 1-2에서 제작한 LMY ver2 변이주 (LMY ver2의 감염성클론)의 전체 구조 유전자를 포함하는 유전체 영역에서 ORF2 내지 ORF7의 부위를 제한효소인 AscI 및 PacI를 사용하여 절단하였다. 이어서, BP2017-2 균주의 유전체 영역 중 LMY ver2 변이주의 ORF2 내지 ORF7의 부위에 대응하는 부분 (서열번호 5)을 동일한 AscI 및 PacI 제한효소로 자른 후, 상기 LMY ver2 변이주의 ORF1a 및 ORF1b 영역에 해당하는 부위 (실시예 1-2의 LMY ver2 NSP1 영역; 서열번호 2)와 BP2017-2 균주의 ORF2 내지 ORF7 영역에 해당하는 부위 (서열번호 5)를 ligase로 연결하여 하나의 재조합 감염성 클론 (infectious clone)을 제조하였으며, LMY+BP2017 로 명명하였다. 사용한 제한효소를 하기 표 6에 나타냈다.
단편 제한효소 Tm (℃) 완충액 제한효소 인식부위 서열번호
ORF2-7 AscI 37 CutSmart GGCGCGCC 8
PacI 37 CutSmart TTAATTAA 9
상기 완성된 감염성 클론을 CMV 프로모터 및 앰피실린 (ampicillin) 저항성 유전자를 탑재한 high copy vector에 삽입한 후, lipofectamine을 이용해 BHK cell (한국세포주은행)에 형질감염 하고, 최종적으로 LMY ver2 변이주의 ORF1a 및 ORF1b 영역 (LMY ver2 NSP1 영역)과 BP2017-2 균주의 ORF2 내지 ORF7 영역을 포함하는 LMY+BP2017 키메라 바이러스를 작출하였다.상기 LMY+BP2017 키메라 바이러스는 2018년 10월 24일자로 한국생명공학연구원 생물자원센터에 기탁하여 수탁번호 KCTC13675BP를 수여받았다.
실시예 2. T 세포 펩타이드 에피톱 탑재된 키메라 바이러스 변이주의 제조
실시예 2-1. T 세포 펩타이드 에피톱-EP7 탑재된 키메라 바이러스 변이주의 제조
T 세포 펩타이드 에피톱-EP7 (T cell epitope-EP7; EP7)은 PRRS 바이러스의 membrane 단백질 (ORF6)의 아미노산 서열의 일부로서, 마크로젠에 pTOP Blunt V2 내의 EP7-epitope에 대해 합성의뢰를 하였고, 이는 interferon-gamma (IFN-gamma) 생성 및/또는 분비를 유도할 수 있다. EP7의 아미노산 서열 및 이를 암호화하는 유전자의 핵산 서열을 하기 표 7에 나타냈다.
아미노산 서열 (N→C) 또는 핵산 서열 (5'→3') 서열번호
T 세포 펩타이드 에피톱-EP7 LLAFSITYTPVMIYALKVSRGRLLGL 3
T 세포 에피톱-EP7의 암호화 핵산 서열 ctgctagctttcagtatcacatatactccagttatgatatacgcacttaaggtctctcgtgggcgtctcctagggctc 4
변형된 T-세포 펩타이드 에피톱-EP7 암호화 유전자 ggcgcgcc gccaccatgctgctagctttcagtatcacatatactccagttatgatatacgcacttaaggtctctcgtgggcgtctcctagggctctaggttccgtggcaacccctataaccagagtttcagcggaaca ggcgcgcc 20
(표 7에서, AscI 제한효소 인식부위는 밑줄, Kozak 서열은 이탤릭체, TRS6는 밑줄 및 이탤릭체로 각각 표시하였으며, Kozak 서열과 TRS6 사이의 부위는 EP7 암호화 핵산서열이고, EP7 핵산서열 앞뒤로 ATG (start codon), TAG (stop codon)가 붙어서 삽입됨).실시예 1에서 준비된 LMY ver2의 감염성 클론의 ORF1의 부위 (서열번호 2) 및 BP2017-2 균주의 ORF2 내지 ORF7 부위에 대응하는 부위 (서열번호 5)와, T 세포 펩타이드 에피톱-EP7 (T cell epitope-EP7) 암호화 유전자를 ligase로 연결하여 포함하는 EP7 발현 키메라 바이러스 변이주 (rPRRSV-EP7 키메라 바이러스)를 제작하였다.
구체적으로, 상기 T 세포 펩타이드 에피톱-EP7는 벡터에 삽입하기 위해, 마크로젠에 의뢰 합성한 pTOP Blunt V2 내의 modified EP7-epitope 플라스미드에 제한효소 AscI를 처리하여 modified EP7-epitope을 단편화하여, T 세포 펩타이드 에피톱-EP7 및 그 양 말단에 AscI 제한효소 인식부위 (서열번호 8)를 포함하는 폴리뉴클레오타이드 절편을 얻고, 상기 폴리뉴클레오타이드 절편의 5' 말단에는 kozak 서열 (서열번호 13)을, 3' 말단에는 TRS6 (서열번호 14)를 추가로 삽입하여 변형된 T 세포 펩타이드 에피톱-EP7 암호화 유전자 (서열번호 20)를 제작하였다.
앞선 실시예 1-3에 기재된 LMY ver2 변이주 (LMY ver2의 감염성클론)의 전체 구조 유전자를 포함하는 유전체(ORF1과 ORF2 사이에 AscI 제한효소 인식부위 존재)에 AscI 제한효소를 37℃에서 1시간동안 처리하여 ORF1b와 ORF2 사이를 절단하고, CIP (Calf-intestinal alkaline phosphatase) 효소를 37℃에서 30분동안 처리하고, 75℃에서 10분동안 inactivation 과정을 진행하여 인산기를 제거하고, gel elution 후 PCR purification을 수행하여 단편을 준비하였다. 이어서, 상기 제작한 T 세포 펩타이드 에피톱-EP7의 유전자 서열 (서열번호 20)의 양 끝단을 AscI로 처리하여 단편화하고, 마찬가지로 gel elution 후 PCR purification을 수행하여 T 세포 펩타이드 에피톱-EP7 암호화 유전자 단편을 준비하였다.
상기 과정을 통해 준비한 두 단편을 16℃에서 1시간동안 ligase로 연결하고, DH5alpha com cell에 transformation하고, 24시간 이후 colony를 확인한 후, colony에 대하여 PCR을 수행하여 insert 부위를 확인하였다. 또한 ligation 확인된 colony를 LB 배양 배지에 24시간 키운 후, QIAGEN Plasmid Midi Kit (cat. nos. 12143)를 사용하여 제조사의 midi prep 방법으로 플라스미드를 확보하여, 재조합 감염성 클론 (infectious clone)을 제조하였다.
바이러스 작출을 위하여 상기 감염성 클론을 lipofectamine을 이용해 BHK cell (한국세포주은행)에 형질감염하여, 최종적으로 LMY ver2 변이주의 ORF1a 및 ORF1b 영역 (LMY ver2 NSP1 영역)(서열번호 2), T 세포 펩타이드 에피톱-EP7 암호화 영역 (서열번호 20), 및 BP2017-2 균주의 ORF2 내지 ORF7 영역(서열번호 5)을 포함하는 키메라 바이러스 변이주(rPRRSV-EP7 키메라 바이러스)를 제조하였다. 이와 같이 얻어진 키메라 바이러스 변이주의 유전체 서열을 서열번호 6에 나타내었다. 또한 상기 키메라 바이러스 변이주(rPRRSV-EP7 키메라 바이러스)를 2020년 8월 10일자로 대한민국 전라북도 정읍시에 소재하는 한국생명공학연구원 생물자원센터에 기탁하여 수탁번호 KCTC 14269BP를 부여받았다.
실시예 2-2. T 세포 펩타이드 에피톱-EP8 탑재된 키메라 바이러스 변이주의 제조
PRRSV 유래 T 세포 펩타이드 에피톱-EP8 (T cell epitope-EP8; EP8)은 PRRS 바이러스의 membrane 단백질 (ORF6)의 아미노산 서열의 일부로서, 마크로젠에 pTOP Blunt V2 내의 P8-epitope에 대해 합성의뢰를 하였고, 이는 interferon-gamma (IFN-gamma) 생성 및/또는 분비를 유도할 수 있다. EP8의 아미노산 서열 및 이를 암호화하는 유전자의 핵산 서열을 하기 표 8에 나타냈다.
펩타이드 아미노산 서열 (N→C) 또는 핵산 서열 (5'→3') 서열번호
T 세포 펩타이드 에피톱-EP8 LWGVYSAIETWKFITSRCRLCLLGRKYILAPAHHVESA 12
T 세포 에피톱-EP8의 암호화 핵산 서열 ctgtggggcgtatattccgcaatcgaaacgtggaagttcataacgagtcgctgccgtctctgcttattagggcgaaagtatatactcgctcctgctcaccacgtggagtcggct 10
변형된 T 세포 펩타이드 에피톱-EP8 암호화 유전자 ggcgcgcc gccaccatgctgtggggcgtatattccgcaatcgaaacgtggaagttcataacgagtcgctgccgtctctgcttattagggcgaaagtatatactcgctcctgctcaccacgtggagtcggcttaggttccgtggcaacccctataaccagagtttcagcggaaca ggcgcgcc 21
(표 8에서, AscI 제한효소 인식부위는 밑줄, Kozak 서열은 이탤릭체, TRS6는 밑줄 및 이탤릭체로 각각 표시하였으며, Kozak 서열과 TRS6 사이의 부위는 EP8 암호화 핵산서열이고, EP8 핵산서열 앞뒤로 ATG (start codon), TAG (stop codon)가 붙어서 삽입됨).
실시예 1에서 준비된 LMY ver2의 감염성 클론의 ORF1의 부위 (서열번호 2) 및 BP2017-2 균주의 ORF2 내지 ORF7 부위에 대응하는 부위 (서열번호 5)와, T 세포 펩타이드 에피톱-EP8 (T cell epitope-EP8) 암호화 유전자를 ligase로 연결하여 포함하는 EP8 발현 키메라 바이러스 변이주 (rPRRSV-EP8 키메라 바이러스)를 제작하였다.
구체적으로, 상기 T 세포 펩타이드 에피톱-EP8는 벡터에 삽입하기 위해, 마크로젠에 의뢰 합성한 pTOP Blunt V2 내의 modified EP8-epitope 플라스미드에 제한효소 AscI를 처리하여 단편화하여 T 세포 펩타이드 에피톱-EP8 및 그 양 말단에 AscI 제한효소 인식부위 (서열번호 8)을 포함하는 폴리뉴클레오타이드 절편을 얻고, 상기 폴리뉴클레오타이드 절편의 5' 말단에는 kozak 시퀀스 (서열번호 13)를, 3' 말단에는 TRS6 (서열번호 14)를 추가로 삽입하여 변형된 T 세포 펩타이드 에피톱-EP8 암호화 유전자 (서열번호 21)를 제작하였다.
앞선 실시예 1-3에 기재된 LMY ver2 변이주 (LMY ver2의 감염성클론)의 전체 구조 유전자를 포함하는 유전체(ORF1과 ORF2 사이에 ASC1 제한효소 인식부위 존재)에 AscI 제한효소를 37℃에서 1시간동안 처리하여 ORF1b와 ORF2 사이를 절단하고, CIP 효소를 37℃에서 30분동안 처리하고, 75℃에서 10분동안 inactivation 과정을 진행하여 인산기를 제거하고, gel elution 후 PCR purification을 수행하여, 단편을 준비하였다. 이어서, 상기 제작한 T 세포 펩타이드 에피톱-EP8의 유전자 서열 (서열번호 21)의 양 끝단을 AscI로 처리하여 단편화하고, 마찬가지로 gel elution 후 PCR purification을 수행하여, T 세포 펩타이드 에피톱-EP8 암호화 유전자 단편을 준비하였다.
상기 과정을 통해 준비한 두 단편을 16℃에서 1시간동안 ligase로 연결하고, DH5alpha com cell에 transformation하고, 24시간 이후 colony를 확인한 후, colony에 대하여 PCR를 수행하여 insert 부위를 확인하였다. 또한, ligation이 확인된 colony를 LB 배양 배지에서 24시간 키운 후, QIAGEN Plasmid Midi Kit (cat. nos. 12143)를 사용하여 제조사의 midi prep 방법으로 플라스미드를 확보하여, 재조합 감염성 클론 (infectious clone)을 제조하였다.
바이러스 작출을 위하여 상기 감염성 클론을 lipofectamine을 이용해 BHK cell (한국세포주은행)에 형질감염하여, 최종적으로 LMY ver2 변이주의 ORF1a 및 ORF1b 영역 (LMY ver2 NSP1 영역)(서열번호 2), T 세포 펩타이드 에피톱-EP8 암호화 영역 (서열번호 21), 및 BP2017-2 균주의 ORF2 내지 ORF7 영역(서열번호 5)을 포함하는 키메라 바이러스 변이주(rPRRSV-EP8 키메라 바이러스를 제조하였다. 이와 같이 얻어진 키메라 바이러스 변이주의 유전체 서열을 서열번호 11에 나타내었다. 또한 상기 키메라 바이러스 변이주(rPRRSV-EP8 키메라 바이러스)를 2020년 8월 10일자로 대한민국 전라북도 정읍시에 소재하는 한국생명공학연구원 생물자원센터에 기탁하여 수탁번호 수탁번호 KCTC 14270BP를 부여받았다.
실시예 3. 세포 계대 연구
상기 실시예 2에서 제조한 EP7 발현 키메라 바이러스 변이주 (rPRRSV-EP7 키메라 바이러스)를 계대했을 때 변형된 부위 (삽입된 유전자)가 언제까지 유지되는지를 확인하였다.
구체적으로, PRRS 바이러스 수용성 세포주로 알려진 MARC-145 세포 (KVCC)에서 rPRRSV-EP7 키메라 바이러스를 1회, 4회, 6회, 29회 계대배양을 수행하여 안정화시켰으며, 바이러스에서 유전자를 추출한 후 RT-PCR을 수행하여 삽입 유전자의 핵산 서열을 확인하였다.
구체적으로 하기 표 10의 프라이머 세트와 one step RT-PCR kit (Qiagen)를 이용해 제조자 설명에 따라서 RT-PCR을 수행하였고, 구체적인 PCR 조건을 표 9에 나타내었다.
PCR 반응액
PCR 반응액 조성 양
5x Qiagen one step RT-PCR buffer 10ul
dNTP Mix10mM 2ul
Forward Primer 1ul
Reverse Primer 1ul
Qiagen one step RT-PCR Enzyme Mix 2ul
Template RNA 2ul
증류수 7ul
전체 부피 25ul
PCR 반응 조건
Reverse transcription 30min 50℃
Initial PCR activation step 15min 95℃
3-step cycling
Denaturation 1 min 94℃
Annealing 1 min 67℃
Extension 1 min 72℃
Number of cycles : 30
Final extension 10min 72℃
프라이머 염기서열(5’ → 3’) 서열번호
2-Vector-seq-FOR primer gggaagattataatgatgcgtttcgtg 15
PRRS-ORF2-REV primer accagccaaccggcgatggt 16
상기 확인된 핵산 서열을 기초로 얻어진 아미노산 서열을 도 2에 나타내었다.
도 2에 나타난 바와 같이, 29회 계대배양시에도 삽입된 EP7 암호화 유전자가 안정적으로 유지되어 EP7을 안정적으로 발현하고 있음을 확인하였고, 그 결과를 도 2에 나타냈다.
실시예 4. rPRRSV-EP7 키메라 바이러스의 면역 증강 효과 확인 (in vitro)
상기 실시예 3에서 안정적으로 EP7 펩타이드를 발현하는 것으로 확인된 rPRRSV-EP7 키메라 바이러스 (실시예 2)의 면역 증강 효과를 IFN-gamma 발현 정도로 평가하였다. 이를 위하여 ELISpot (Enzyme linked immunospot) kit (MABTECH)를 이용하였다.
구체적으로, 3주령된 자돈에 PRRS LMY 바이러스를 공격접종 후 (104.5 TCID50/ml), 감염 5주 후에 분리한 PBMC (peripheral blood mononuclear cell) (#90-5w) 5*105cells/mL가 포함된 각 well에, 항원 자극을 위한 백신주로서, EP7 펩타이드를 발현하는 rPRRSV-EP7 (실시예 2) 또는 rPRRSV (실시예 1-3의 LMY+BP2017 키메라 바이러스) 및 Inactivated LMY (PRRS LMY 모균주 (Accession No. GenBank accession no.DQ473474.1)를 MARC cell 에서 7계대 배양하여 얻은 LMY)를 각각 넣어 5% CO2, 37oC에서 21시간 반응시켰다. 그 후, biotin이 표지된 anti-IFN-gamma 1차 항체 및 streptavidin-HRP가 표지된 2차 항체 (상기 항체들은 모두 ELISpot kit (MABTECH)에 포함된 것임)를 순차적으로 처리하고 37oC에서 1시간 배양한 다음, 세포 5*105개 당 spot forming unit (SFU)를 계산하였다. 이 때, SFU 수치는 IFN-gamma 발현수준을 나타낸다.
대조군으로, PRRS LMY 모균주 (Accession No. GenBank accession no.DQ473474.1)를 MARC cell 에서 7계대하여 얻은 Inactivated LMY를 상기 PBMC가 포함된 well에 접종한 것과 추가적으로 백신주를 접종하지 않은 상기 PBMC (negative control, NC)를 준비하였다.
상기 얻어진 결과를 표 11 및 도 3에 나타내었다.
백신주 MOI (Multiplicity of Infection) 세포 5*105개 당 spot forming unit (SFU) (평균±표준편차)
실험예 1 rPRRSV-EP7 0.1 217±14
실험예 2 rPRRSV-EP7 0.01 239.5±91.5
실험예 3 rPRRSV-EP7 0.001 60±0
실험예 4 rPRRSV 0.1 202±0
실험예 5 rPRRSV 0.01 142.5±8.5
실험예 6 rPRRSV 0.001 26.5±24.5
실험예 7 Inactivated LMY 0.01 108.5±20.8
실험예 8 NC 14±0
표 11 및 도 3에 나타난 바와 같이, 동일 MOI에서, EP7 유전자가 삽입되지 않은 rPRRSV, PRRS LMY 모균주 (Accession No. GenBank accession no.DQ473474.1)를 MARC cell 에서 7계대하여 얻은 Inactivated LMY (상기 MARC cell에서 7계대하여 얻은 바이러스의 상층액을 56℃에서, 30분동안 반응시켜 감염성을 불활화한 바이러스 상층액임) 및 NC와 비교하여, EP7 펩타이드를 발현하는 rPRRSV-EP7에서 더 높은 IFN-gamma 발현량을 보였으며, 이러한 결과는 백신주가 EP7 펩타이드를 발현함으로써 보다 우수한 면역 증강 효과를 얻을 수 있음을 보여준다.
실시예 5. rPRRSV-EP7 키메라 바이러스의 바이러스 억제능 확인
EP7 펩타이드를 발현하는 (EP7 유전자가 삽입된) rPRRSV-EP7 키메라 바이러스의 면역세포를 자극하여 바이러스를 억제하는 능력을 바이러스 억제능 평가법 (Virus Suppression Assay, VSA)을 이용하여 검증하였다.
구체적으로, 3주령된 자돈에 PRRS type2 LMY 바이러스 (Accession No. GenBank accession no.DQ473474.1)를 감염시킨 후, 감염 후 5주 차에 돼지 PBMC (T 세포)를 분리하고 동결하였다. 상기 PBMC를 녹인 후, 10% FBS (Fetal Bovine Serum)가 첨가된 RPMI-1640 (Life Technologies, Carlsbad, CA, USA) 배지에 풀어주고, 각 well 에 1.25 x 10^6 cells의 양으로 넣은 후, 열로 불활성화 시킨 EP7 펩타이드를 발현하는 Type 2 PRRS 키메라 바이러스 (rPRRSV-EP7; 실시예 2) 또는 rPRRSV (실시예 1-3) 각각 웰당 1.25*104 TCID50로 자극하거나 아무런 자극을 하지 않고 6일 동안 배양하였다. 이와 같이 얻어진 세포를 effector cell로 사용하였다.
또한, 동일 개체 (autologous) 혹은 동일 유전자형을 가진 다른 개체 (genotype-matched heterologous)의 PBMC내 monocyte로부터 분화된 타겟 세포 (monocyte derived macrophage, MDM)를 준비하였다. 보다 구체적으로, 동결된 PBMC를 녹인 후에 무혈청 EMEM (Eagle's Minimum Essential Medium)로 세척하고 37oC에서 2시간 동안 무혈청 EMEM에서 배양한 후 배지와 부유세포들은 버리고 부착세포들만 10% FBS가 첨가된 RPMI-1640 (Life Technologies, Carlsbad, CA, USA) 배지에 6일 동안 배양한 후, 쥐 M-CSF (macrophage-colony stimulating factor, Biolegend, San Diego, CA, USA)를 2일마다 5ng/ml이 되게 첨가하고 6일동안 분화시켜 VSA 타겟세포 (타겟 MDM 세포) (2.5 x 10^5 cells/well)를 준비하였다. 6일간 배양 후, 상기 준비된 자극에 의해 활성화된 effector cell과 MDM 세포와 PRRS LMY (0.00005moi (MDM 세포 기준 moi))을 혼합 배양하였다. 혼합 배양 4일 후 세포와 상층액을 이용하여 RNA를 추출하고 타겟 세포에서 바이러스 증식 수준을 Real time PCR(QuantiTect Probe RT-PCR Kit; Qiagen)을 이용하여 확인하였다.
구체적으로, 상기 혼합 배양한 시료 상층액 0.1ml에서 RNA 1ul을 추출하였다. QuantiTect Probe RT-PCR buffer 5ul와 Taq man probe와 하기 표 13의 PRRSV specific primer 세트 10pmol을 각 0.3ul 혼합한 혼합물에 상기에서 추출된 RNA 1ul를 넣고 DEPC 증류수 2.4ul을 넣고 혼합하여 real time PCR 반응을 수행하였다. 상기 Real-time PCR에 사용된 프라이머를 표 13에, PCR 조건을 표 12에 나타내었다.
PCR 반응액
PCR 반응액 조성 양
QuantiTect Probe RT-PCR buffer 5ul
효소 0.5ul
Forward Primer 0.3ul
Reverse Primer 0.3ul
Probe 0.5ul
Template RNA 1ul
증류수 2.4ul
전체 부피 10ul
PCR 반응 조건
Reverse transcription 30min 50℃
Initial PCR activation step 15min 95℃
3-step cycling
Denaturation 15sec 94℃
Annealing 1 min 60℃
Extension 1 min 72℃
Number of cycles : 40
Final extension 10min 72℃
프라이머 염기서열(5’ → 3’) 서열번호
PRRSV specific Primer For atgatgrgctggctaact 17
PRRSV specific Primer Rev acaccggtcgccctaattg 18
Taq man Probe 5FAM-tgtggtgaatggcactgattgaca-3BHQ1 19
상기 Real-time PCR은 총 35cycle 반응을 반복하였으며, 역치 값에 따라 샘플별로 Ct 값을 산출하였고, 35이상은 제외하였다. Ct 값은 standard curve에 대입하여 genomic copy로 환산하여 표기하였다.
상기 얻어진 결과를 도 4에 나타내었다. 도 4에 나타난 바와 같이, EP7 펩타이드를 발현하는 Type 2 PRRS 키메라 바이러스 백신주 (rPRRSV-EP7)에 의한 PBMC 자극이 기존 백신주 (rPRRSV)로 자극하였을 때보다 아무런 자극을 하지 않은 PBMC (T 세포)에 대한 바이러스 감소율이 높게 확인되었다 (rPRRSV-EP7: 75%; rPRRSV: 28%). 이러한 결과는 백신주가 EP7 펩타이드를 발현함으로써 바이러스 증식 억제능력이 현저히 증가함을 보여준다.
실시예 6. 세포 계대 연구
상기 실시예 2에서 제조한 EP8 발현 키메라 바이러스 변이주 (rPRRSV-EP8 키메라 바이러스)를 계대했을 때 변형된 부위 (삽입된 유전자)가 언제까지 유지되는지를 확인하였다.
구체적으로, PRRS 바이러스 수용성 세포주로 알려진 MARC-145 세포 (KVCC)에서 rPRRSV-EP8 키메라 바이러스를 1회, 6회, 29회 계대배양을 수행하여 안정화시켰으며, 바이러스에서 유전자를 추출한 후 RT-PCR을 수행하여 삽입 유전자의 핵산 서열을 확인하였다.
구체적으로 하기 표 15의 프라이머 세트와 one step RT-PCR kit (Qiagen)를 이용해 제조자 설명에 따라서 RT-PCR을 수행하였고, 구체적인 PCR 조건을 표 14에 나타내었다.
PCR 반응액
PCR 반응액 조성 양
5x Qiagen one step RT-PCR buffer 10ul
dNTP Mix10mM 2ul
Forward Primer 1ul
Reverse Primer 1ul
Qiagen one step RT-PCR Enzyme Mix 2ul
Template RNA 2ul
증류수 7ul
전체 부피 25ul
PCR 반응 조건
Reverse transcription 30min 50℃
Initial PCR activation step 15min 95℃
3-step cycling
Denaturation 1 min 94℃
Annealing 1 min 67℃
Extension 1 min 72℃
Number of cycles : 30
Final extension 10min 72℃
프라이머 염기서열(5’ → 3’) 서열번호
2-Vector-seq-FOR primer GGGAAGATTATAATGATGCGTTTCGTG 15
PRRS-ORF2-REV primer ACCAGCCAACCGGCGATGGT 16
상기 확인된 핵산 서열을 기초로 얻어진 아미노산 서열을 도 5에 나타내었다. 도 5에 나타난 바와 같이, 29회 계대배양시에도 삽입된 EP8 암호화 유전자가 안정적으로 유지되어 EP8을 안정적으로 발현하고 있음을 확인하였고, 그 결과를 도 5에 나타냈다.
실시예 7. rPRRSV-EP8 키메라 바이러스의 면역 증강 효과 확인 (in vitro)
상기 실시예 6에서 안정적으로 EP8 펩타이드를 발현하는 것으로 확인된 rPRRSV-EP8 키메라 바이러스 (실시예 2)의 면역 증강 효과를 IFN-gamma 발현 정도로 평가하였다. 이를 위하여 ELISpot (Enzyme linked immunospot) kit (MABTECH)를 이용하였다.
구체적으로, 3주령된 자돈에 PRRS LMY 바이러스를 공격접종 후 (104.5 TCID50/ml), 감염 5주 후에 분리한 PBMC (peripheral blood mononuclear cell) (#90-5w) 5*105cells/mL가 포함된 각 well에, 항원 자극을 위한 백신주로서, EP8 펩타이드를 발현하는 rPRRSV-EP8 (실시예 2), rPRRSV (실시예 1.3의 LMY+BP2017 키메라 바이러스) 및 Inactivated LMY (PRRS LMY 모균주 (Accession No. GenBank accession no.DQ473474.1)를 MARC cell 에서 7계대 배양하여 얻은 LMY)를 각각 넣어 5% CO2, 37oC에서 21시간 반응시켰다. 그 후, biotin이 표지된 anti-IFN-gamma 1차 항체 및 streptavidin-HRP가 표지된 2차 항체 (상기 항체들은 모두 ELISpot kit (MABTECH)에 포함된 것임)를 순차적으로 처리하고 37oC에서 1시간 배양한 다음, 세포 5*105개 당 spot forming unit (SFU)를 계산하였다. 이 때, SFU 수치는 IFN-gamma 발현수준을 나타낸다.
대조군으로, PRRS LMY 모균주 (Accession No. GenBank accession no.DQ473474.1)를 MARC cell 에서 7계대하여 얻은 Inactivated LMY를 상기 PBMC가 포함된 well에 접종한 것을 준비하였다.
상기 얻어진 결과를 표 16 및 도 6에 나타내었다.
백신주 MOI (Multiplicity of Infection) 세포 5*105개 당 spot forming unit (SFU)
실험예 1 rPRRSV-EP8 0.1 327
실험예 2 rPRRSV-EP8 0.01 251.5
실험예 3 rPRRSV-EP8 0.001 55
실험예 4 rPRRSV 0.1 202
실험예 5 rPRRSV 0.01 142.5
실험예 6 rPRRSV 0.001 24.5
실험예 7 Inactivated LMY 0.01 108.5
표 16 및 도 6에 나타난 바와 같이, 동일 MOI에서, EP8 유전자가 삽입되지 않은 rPRRSV 및 PRRS LMY 모균주(Accession No. GenBank accession no.DQ473474.1)를 MARC cell 에서 7계대하여 얻은 Inactivated LMY와 비교하여, EP8 펩타이드를 발현하는 rPRRSV-EP8에서 더 높은 IFN-gamma 발현량을 보였으며, 이러한 결과는 백신주가 EP8 펩타이드를 발현함으로써 보다 우수한 면역 증강 효과를 얻을 수 있음을 보여준다.
실시예 8. rPRRSV-EP8 키메라 바이러스의 바이러스 억제능 확인
EP8 펩타이드를 발현하는 (EP8 유전자가 삽입된) rPRRSV-EP8 키메라 바이러스의 면역세포를 자극하여 바이러스를 억제하는 능력을 바이러스 억제능 평가법 (Virus Suppression Assay, VSA)을 이용하여 검증하였다.
구체적으로, 3주령된 자돈에 PRRS type2 LMY 바이러스(Accession No. GenBank accession no.DQ473474.1)를 감염시킨 후, 감염 후 5주 차에 돼지 PBMC (T 세포)를 분리하고 동결하였다. 상기 PBMC를 녹인 후, 10% FBS (Fetal Bovine Serum)가 첨가된 RPMI-1640 (Life Technologies, Carlsbad, CA, USA) 배지에 풀어주고, 각 well 에 1.25 x 10^6 cells의 양으로 넣은 후, 열로 불활성화 시킨 EP8 펩타이드를 발현하는 Type 2 PRRS 키메라 바이러스 (rPRRSV-EP8; 실시예 2) 또는 rPRRSV (실시예 1-3) 각각 웰당 1.25*104 TCID50로 자극하거나 아무런 자극을 하지 않고 6일 동안 배양하였다. 이와 같이 얻어진 세포를 effector cell로 사용하였다.
또한, 동일 개체 (autologous) 혹은 동일 유전자형을 가진 다른 개체 (genotype-matched heterologous)의 PBMC내 monocyte로부터 분화된 타겟 세포 (monocyte derived macrophage, MDM)를 준비하였다. 보다 구체적으로, 동결된 PBMC를 녹인 후에 무혈청 EMEM (Eagle's Minimum Essential Medium)로 세척하고 37oC에서 2시간 동안 무혈청 EMEM에서 배양한 후 배지와 부유세포들은 버리고 부착세포들만 10% FBS가 첨가된 RPMI-1640 (Life Technologies, Carlsbad, CA, USA) 배지에 6일 동안 배양한 후, 쥐 M-CSF (macrophage-colony stimulating factor, Biolegend, San Diego, CA, USA)를 2일마다 5ng/ml이 되게 첨가하고 6일동안 분화시켜 VSA 타겟세포 (타겟 MDM 세포) (2.5 x 10^5 cells/ well)를 준비하였다. 6일간 배양 후, 상기 준비된 자극에 의해 활성화된 effector cell과 MDM 세포와 PRRS LMY (0.00005moi (MDM 세포 기준 moi))을 혼합 배양하였다. 혼합 배양 4일 후 세포와 상층액을 이용하여 RNA를 추출하고 타겟 세포에서 바이러스 증식 수준을 Real-time PCR(QuantiTect Probe RT-PCR Kit; Qiagen)을 이용하여 확인하였다.
구체적으로, 상기 혼합 배양한 시료 상층액 0.1ml에서 RNA 1ul을 추출하였다. QuantiTect Probe RT-PCR buffer 5ul와 Taq man probe와 하기 표 18의 PRRSV specific primer 세트 10pmol을 각 0.3ul 혼합한 혼합물에 상기에서 추출된 RNA 1ul를 넣고 DEPC 증류수 2.4ul을 넣고 혼합하여 real time PCR 반응을 수행하였다. 상기 Real-time PCR에 사용된 프라이머를 표 18에, PCR 조건을 표 17에 나타내었다.
PCR 반응액
PCR 반응액 조성 양
QuantiTect Probe RT-PCR buffer 5ul
효소 0.5ul
Forward Primer 0.3ul
Reverse Primer 0.3ul
Probe 0.5ul
Template RNA 1ul
증류수 2.4ul
전체 부피 10ul
PCR 반응 조건
Reverse transcription 30min 50℃
Initial PCR activation step 15min 95℃
3-step cycling
Denaturation 15sec 94℃
Annealing 1 min 60℃
Extension 1 min 72℃
Number of cycles : 40
Final extension 10min 72℃
프라이머 염기서열(5’ → 3’) 서열번호
PRRSV specific Primer For atgatgrgctggctaact 17
PRRSV specific Primer Rev acaccggtcgccctaattg 18
Taq man Probe 5FAM-tgtggtgaatggcactgattgaca-3BHQ1 19
상기 Real-time PCR은 총 35cycle 반응을 반복하였으며, 역치 값에 따라 샘플별로 Ct 값을 산출하였고, 35이상은 제외하였다. Ct 값은 standard curve에 대입하여 genomic copy로 환산하여 표기하였다.
상기 얻어진 결과를 도 7에 나타내었다. 도 7에 나타난 바와 같이, EP8 펩타이드를 발현하는 Type 2 PRRS 키메라 바이러스 백신주 (rPRRSV-EP8)에 의한 PBMC 자극이 기존 백신주 (rPRRSV)로 자극하였을 때보다 아무런 자극을 하지 않은 PBMC (T 세포)에 대한 바이러스 감소율이 높게 확인되었다 (rPRRSV-EP8: 70%; rPRRSV: 28%). 이러한 결과는 백신주가 EP8 펩타이드를 발현함으로써 바이러스 증식 억제능력이 현저히 증가함을 보여준다.
실시예 9. 면역 증강 확인 시험 (in vivo)
백신 조성물 접종 후 확보한 PBMC를 이용하여, 세포면역평가를 IFN-gamma 측정에 의하여 수행하였다.
상기 IFN-gamma는 ELIspot (Enzyme linked immunospot) kit (MABTECH)를 이용하여 측정하였다. 구체적으로, 하기 표 19에 나타낸 실험그룹과 같이, 3개의 그룹의 3주령 돼지에 5*104 TCID50 (Tissue culture infective dose50)의 용량으로 백신 조성물을 피내 주사 (intradermal injection; ID) 방식으로 접종하였다.
실험그룹 백신접종 접종역가
(1 dose)		 투여경로
G1 (n=4) 미접종 - -
G2 (n=6) rPRRSV(LMY+BP) 5*10^4 TCID50 ID
G3 (n=6) rPRRSV-EP7 + rPRRSV-EP8 (1:1) (rPRRSV-EP, LMY/BP+EP) 5*10^4 TCID50 ID
상기 백신접종 21일 후 (3주차), 28일 후 (4주차) 혈청과 PBMC를 확보하였고, 확보한 PBMC 5*105cell/mL가 포함된 각 well에 ELISpot kit 내에 있는 항체인 biotin이 표지된 anti-IFN-gamma 1차 항체 및 streptavidin-HRP가 표지된 2차 항체를 순차적으로 처리하고 37℃에서 1시간 배양한 다음, 세포 5*105개 당 spot forming unit (SFU)를 계산하였다. 이 때, SFU 수치는 IFN-gamma 발현수준을 나타낸다. 상기 얻어진 결과의 평균값을 도 8 및 하기 표 20에 나타냈다.
G1 (n=4) (SFU) G2 (n=6) (SFU) G3 (n=6) (SFU)
3주차 IFN-gamma 발현수준 1.625 4.167 74.167
4주차 IFN-gamma 발현수준 -2.5 12.25 28
도 8에 나타난 바와 같이, G3 그룹 (rPRRSV-EP)에서 IFN-gamma 발현 양이 3주차에 높게 발현되었다. 위 실험으로 G3 그룹이 3주차에 IFN-gamma 발현으로 펩타이드의 세포면역의 자극이 일어났음을 확인할 수 있었다. 이를 통해, 세포면역 증진효과 평가에서는 G3의 펩타이드 발현 백신접종은 돼지감염시 확실한 세포면역유도 증진 효과를 보였다. 더욱이 접종 21일째의 높은 수준의 세포면역은 백신접종 초기의 방어면역형성 가능성을 제안한다.
Figure PCTKR2022001653-appb-img-000020
Figure PCTKR2022001653-appb-img-000021
Figure PCTKR2022001653-appb-img-000022
Figure PCTKR2022001653-appb-img-000023

Claims (30)

  1. 구조식 1의 구조로 이루어진 폴리뉴클레오타이드:
    [구조식 1]
    5'-[X]-[Y]-[Z]-3'
    상기 [X]는 LMY 바이러스 (GenBank accession no. DQ473474.1) 또는 수탁번호 KCTC 13394BP를 갖는 LMY ver2 바이러스의 NSP1 유전자 ORF1a 및 ORF1b 부위의 핵산 서열이며,
    상기 [Y]는 서열번호 3 또는 12의 폴리펩타이드를 암호화하는 핵산 서열이며,
    상기 [Z]는 수탁번호 KCTC 13393BP를 갖는 BP2017-2 바이러스의 ORF2 내지 ORF7 부위의 핵산 서열임.
  2. 제1항에 있어서, 상기 [X]의 NSP1 유전자 ORF1a 및 ORF1b 부위의 핵산 서열은 서열번호 1 또는 서열번호 2로 표현되는 것인, 폴리뉴클레오타이드.
  3. 제1항에 있어서, 상기 [Y]는 AscI 제한 효소 인식 부위, Kozak 서열, 및 TRS6 (transcription regulatory sequence6)으로 이루어진 군에서 선택되는 1종 이상을 추가로 포함하는 것인, 폴리뉴클레오타이드.
  4. 제1항에 있어서, 상기 [Y]는 서열번호 4, 10, 20 또는 21로 표현되는 것인, 폴리뉴클레오타이드.
  5. 제1항에 있어서, 상기 [Z]의 ORF2 내지 ORF7 부위의 핵산 서열은 서열번호 5로 표현되거나, 또는 서열번호 5의 3'말단에 [A]n (상기 n은 염기 아데닌(Adenine, A)의 개수로, 1 내지 100 중에서 선택된 정수임)을 추가로 포함하는 것인, 폴리뉴클레오타이드.
  6. 제1항에 있어서, 상기 폴리뉴클레오타이드는 돼지생식기호흡기증후군 바이러스 (PRRSV)의 키메라 바이러스의 유전체이고, DNA 또는 RNA인, 폴리뉴클레오타이드.
  7. 제1항에 있어서, 상기 구조식 1은 서열번호 6 또는 서열번호 11의 핵산 서열로 이루어진 것인, 폴리뉴클레오타이드.
  8. 제1항 내지 제7항 중 어느 한 항의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스.
  9. 제8항에 있어서, 상기 키메라 바이러스는 수탁번호 KCTC 14269BP 또는 KCTC 14270BP를 갖는 것인, 키메라 바이러스.
  10. 제8항의 PRRSV의 키메라 바이러스 또는 이의 계대 배양된 자손을 포함하는, 돼지 생식기 호흡기 증후군 바이러스에 대한 백신 조성물.
  11. 제10항에 있어서, 상기 키메라 바이러스는 수탁번호 KCTC 14269BP 또는 KCTC 14270BP를 갖는 것인, 백신 조성물.
  12. 제10항에 있어서, 상기 백신은 생백신 또는 사백신인, 백신 조성물.
  13. 제10항에 있어서, 상기 백신은 담체, 희석제, 부형제, 및 어주번트 (adhuvant)로 이루어진 군에서 선택되는 1종 이상을 더 포함하는 것인, 백신 조성물.
  14. (1) 하기 구조식 2의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 또는 이의 계대 배양된 자손; 및
    (2) 하기 구조식 3의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 또는 이의 계대 배양된 자손을 포함하는, 백신 조성물:
    [구조식 2]
    5'-[X]-[Ya]-[Z]-3'
    [구조식 3]
    5'-[X]-[Yb]-[Z]-3'
    상기 [X]는 LMY 바이러스 (GenBank accession no.DQ473474.1) 또는 수탁번호 KCTC 13394BP를 갖는 LMY ver2 바이러스의 NSP1 유전자 ORF1a 및 ORF1b 부위의 핵산 서열이며,
    상기 [Ya]는 서열번호 3의 폴리펩타이드의 암호화 유전자를 포함하는 핵산 서열이며,
    상기 [Yb]는 서열번호 12의 폴리펩타이드의 암호화 유전자를 포함하는 핵산 서열이며,
    상기 [Z]는 수탁번호 KCTC 13393BP를 갖는 BP2017-2 바이러스의 ORF2 내지 ORF7 부위의 핵산 서열임.
  15. 제14항에 있어서,
    상기 [Ya]는 서열번호 4 또는 서열번호 20으로 표현되고,
    상기 [Yb]는 서열번호 10 또는 서열번호 21으로 표현되는 것인, 백신 조성물.
  16. 제14항에 있어서, 상기 [X]의 NSP1 유전자 ORF1a 및 ORF1b 부위의 핵산 서열은 서열번호 1 또는 서열번호 2로 표현되는 것인, 백신 조성물.
  17. 제14항에 있어서, 상기 [Z]의 ORF2 내지 ORF7 부위의 핵산 서열은 서열번호 5로 표현되거나, 또는 서열번호 5의 3'말단에 [A]n (상기 n은 염기 아데닌(Adenine, A)의 개수로, 1 내지 100 중에서 선택된 정수임)을 추가로 포함하는 것인, 백신 조성물.
  18. (1) LMY 바이러스 (GenBank accession no.DQ473474.1) 또는 수탁번호 13394BP의 LMY ver2 바이러스의 유전체를 제한효소 AscI와 PacI로 처리하여 폴리뉴클레오타이드 절편을 제조하는 단계;
    (2) 서열번호 3 또는 12의 폴리펩타이드의 암호화 유전자를 포함하는 폴리뉴클레오타이드 절편을 준비하는 단계,
    (3) 수탁번호 KCTC 13393BP를 갖는 BP2017-2 바이러스의 유전체를 제한효소 AscI와 PacI로 처리하여 폴리뉴클레오타이드 절편을 제조하는 단계; 및 (4) 상기 단계 (1) 내지 (3)에서 얻어진 폴리뉴클레오타이드 절편들을 재조합하여 감염성 클론(infectious clone)을 제조하는 단계
    를 포함하는, 돼지생식기호흡기증후군 바이러스의 키메라 바이러스를 생산하는 방법.
  19. 제18항에 있어서, 상기 단계 (2)에서 폴리뉴클레오타이드 절편은 서열번호 4, 10, 20 또는 21의 핵산 서열을 포함하는 것인, 키메라 바이러스를 생산하는 방법.
  20. 제18항에 있어서, 상기 LMY ver2 바이러스의 유전체를 제한효소 AscI와 PacI로 처리하여 제조된 폴리뉴클레오타이드 절편은 NSP1 단백질을 암호화하는 부위를 포함하는 것인, 키메라 바이러스를 생산하는 방법.
  21. 제18항에 있어서, 상기 BP2017-2 바이러스의 유전체를 제한효소 AscI와 PacI로 처리하여 제조된 폴리뉴클레오타이드 절편은 ORF2 내지 ORF7 부위를 포함하는 것인, 키메라 바이러스를 생산하는 방법.
  22. 제8항의 PRRSV의 키메라 바이러스 또는 이의 계대 배양된 자손을 포함하는, 돼지생식기호흡기증후군의 예방 또는 치료용 약학적 조성물.
  23. 제8항의 PRRSV의 키메라 바이러스 또는 이의 계대 배양된 자손을 포함하는, 돼지생식기호흡기증후군의 예방 또는 치료용 약학적 조성물.
    (1) 하기 구조식 2의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 또는 이의 계대 배양된 자손; 및
    (2) 하기 구조식 3의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 또는 이의 계대 배양된 자손을 포함하는, 약학적 조성물:
    [구조식 2]
    5'-[X]-[Ya]-[Z]-3'
    [구조식 3]
    5'-[X]-[Yb]-[Z]-3'
    상기 [X]는 LMY 바이러스 (GenBank accession no.DQ473474.1) 또는 수탁번호 KCTC 13394BP를 갖는 LMY ver2 바이러스의 NSP1 유전자 ORF1a 및 ORF1b 부위의 핵산 서열이며,
    상기 [Ya]는 서열번호 3의 폴리펩타이드의 암호화 유전자를 포함하는 핵산 서열이며,
    상기 [Yb]는 서열번호 12의 폴리펩타이드의 암호화 유전자를 포함하는 핵산 서열이며,
    상기 [Z]는 수탁번호 KCTC 13393BP를 갖는 BP2017-2 바이러스의 ORF2 내지 ORF7 부위의 핵산 서열임.
  24. 제23항에 있어서,
    상기 [Ya]는 서열번호 4 또는 서열번호 20으로 표현되고,
    상기 [Yb]는 서열번호 10 또는 서열번호 21으로 표현되는 것인, 약학적 조성물.
  25. 제23항에 있어서, 상기 [X]의 NSP1 유전자 ORF1a 및 ORF1b 부위의 핵산 서열은 서열번호 1 또는 서열번호 2로 표현되는 것인, 약학적 조성물.
  26. 제23항에 있어서, 상기 [Z]의 ORF2 내지 ORF7 부위의 핵산 서열은 서열번호 5로 표현되거나, 또는 서열번호 5의 3'말단에 [A]n (상기 n은 염기 아데닌(Adenine, A)의 개수로, 1 내지 100 중에서 선택된 정수임)을 추가로 포함하는 것인, 약학적 조성물.
  27. 제8항의 PRRSV의 키메라 바이러스 또는 이의 계대 배양된 자손을 돼지에 투여하는 단계를 포함하는, 돼지생식기호흡기증후군의 예방 또는 치료 방법.
  28. (1) 하기 구조식 2의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 또는 이의 계대 배양된 자손을 상기 돼지에 투여하는 단계; 및
    (2) 하기 구조식 3의 폴리뉴클레오타이드를 유전체로 포함하는 PRRSV의 키메라 바이러스 또는 이의 계대 배양된 자손을 상기 돼지에 투여하는 단계를 포함하는, 돼지생식기호흡기증후군의 예방 또는 치료 방법:
    [구조식 2]
    5'-[X]-[Ya]-[Z]-3'
    [구조식 3]
    5'-[X]-[Yb]-[Z]-3'
    상기 [X]는 LMY 바이러스 (GenBank accession no.DQ473474.1) 또는 수탁번호 KCTC 13394BP를 갖는 LMY ver2 바이러스의 NSP1 유전자 ORF1a 및 ORF1b 부위의 핵산 서열이며,
    상기 [Ya]는 서열번호 3의 폴리펩타이드의 암호화 유전자를 포함하는 핵산 서열이며,
    상기 [Yb]는 서열번호 12의 폴리펩타이드의 암호화 유전자를 포함하는 핵산 서열이며,
    상기 [Z]는 수탁번호 KCTC 13393BP를 갖는 BP2017-2 바이러스의 ORF2 내지 ORF7 부위의 핵산 서열임.
  29. 제28항에 있어서,
    상기 [Ya]는 서열번호 4 또는 서열번호 20으로 표현되고,
    상기 [Yb]는 서열번호 10 또는 서열번호 21으로 표현되는 것인, 돼지생식기호흡기증후군의 예방 또는 치료 방법.
  30. 제28항에 있어서,
    상기 [X]의 NSP1 유전자 ORF1a 및 ORF1b 부위의 핵산 서열은 서열번호 1 또는 서열번호 2로 표현되는 것이고,
    상기 [Z]의 ORF2 내지 ORF7 부위의 핵산 서열은 서열번호 5로 표현되거나, 또는 서열번호 5의 3'말단에 [A]n (상기 n은 염기 아데닌(Adenine, A)의 개수로, 1 내지 100 중에서 선택된 정수임)을 추가로 포함하는 것인,
    돼지생식기호흡기증후군의 예방 또는 치료 방법.
PCT/KR2022/001653 2021-12-30 2022-01-28 돼지생식기호흡기증후군바이러스 유래 펩타이드를 발현하는 키메라 바이러스 및 이를 포함하는 백신 조성물 WO2023128051A1 (ko)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2021-0193459 2021-12-30
KR10-2021-0193458 2021-12-30
KR1020210193459A KR20230102954A (ko) 2021-12-30 2021-12-30 돼지생식기호흡기증후군바이러스 유래 펩타이드 (ep8)을 발현하는 키메라 바이러스 및 이를 포함하는 백신 조성물
KR1020210193458A KR20230102953A (ko) 2021-12-30 2021-12-30 돼지생식기호흡기증후군바이러스 유래 펩타이드 (ep7)를 발현하는 키메라 바이러스 및 이를 포함하는 백신 조성물

Publications (1)

Publication Number Publication Date
WO2023128051A1 true WO2023128051A1 (ko) 2023-07-06

Family

ID=86999405

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/001653 WO2023128051A1 (ko) 2021-12-30 2022-01-28 돼지생식기호흡기증후군바이러스 유래 펩타이드를 발현하는 키메라 바이러스 및 이를 포함하는 백신 조성물

Country Status (1)

Country Link
WO (1) WO2023128051A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140161768A1 (en) * 2012-12-07 2014-06-12 The Board Of Trustees Of The University Of Illinois Porcine reproductive and respiratory syndrome virus compositions and uses thereof
KR20160036552A (ko) * 2013-10-19 2016-04-04 건국대학교 산학협력단 돼지 생식기 호흡기 증후군 바이러스의 키메릭 변이주
KR101933931B1 (ko) * 2017-12-27 2018-12-31 주식회사 바이오포아 돼지 생식기 및 호흡기 증후군 바이러스 변이주 및 이를 이용한 백신
KR101933932B1 (ko) * 2017-12-27 2018-12-31 주식회사 바이오포아 돼지 생식기 및 호흡기 증후군 바이러스 변이주 및 이를 이용한 백신
KR20200081225A (ko) * 2018-12-27 2020-07-07 주식회사 바이오포아 돼지 생식기 및 호흡기 증후군 바이러스의 키메라 바이러스 및 이를 이용한 백신

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140161768A1 (en) * 2012-12-07 2014-06-12 The Board Of Trustees Of The University Of Illinois Porcine reproductive and respiratory syndrome virus compositions and uses thereof
KR20160036552A (ko) * 2013-10-19 2016-04-04 건국대학교 산학협력단 돼지 생식기 호흡기 증후군 바이러스의 키메릭 변이주
KR101933931B1 (ko) * 2017-12-27 2018-12-31 주식회사 바이오포아 돼지 생식기 및 호흡기 증후군 바이러스 변이주 및 이를 이용한 백신
KR101933932B1 (ko) * 2017-12-27 2018-12-31 주식회사 바이오포아 돼지 생식기 및 호흡기 증후군 바이러스 변이주 및 이를 이용한 백신
KR20200081225A (ko) * 2018-12-27 2020-07-07 주식회사 바이오포아 돼지 생식기 및 호흡기 증후군 바이러스의 키메라 바이러스 및 이를 이용한 백신

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
YOU SU-HWA, CHANGHOON PARK, MIN-A LEE, JONG HYUK BAEK, SUN HEE CHO, SANG-HO CHA, SEOK-JIN KANG, BANG-HUN HYUN, HYANG-SIM LEE: "T cell-mediated immune response induced by chimeric virus expressing porcine reproductive and respiratory syndrome virus(PRRSV)-derived peptides", 2021 THE KOREAN ASSOCIATION FOR LABORATORY ANIMAL SCIENCE WINTER SYMPOSIUM, 28 January 2021 (2021-01-28), pages 99 - 99, XP093071050 *

Similar Documents

Publication Publication Date Title
JP6997574B2 (ja) ブタ生殖および呼吸症候群（ｐｒｒｓ）ウイルスに対する離乳前の効果的なワクチン接種
Wei et al. N-linked glycosylation of GP5 of porcine reproductive and respiratory syndrome virus is critically important for virus replication in vivo
WO2019209079A1 (en) Nucleic acid molecules inserted expression regulation sequences, expression vector comprising nucleic acid moleclues and pharmaceutical use thereof
WO2017003267A1 (ko) 항바이러스 활성 효능을 가지는 펩티드 및 이를 포함하는 조성물
WO2020005028A1 (ko) 중증 열성 혈소판 감소 증후군(sfts) 바이러스 감염 질환 예방 또는 치료용 백신 조성물
WO2020138761A1 (ko) 돼지 생식기 및 호흡기 증후군 바이러스의 키메라 바이러스 및 이를 이용한 백신
WO2023128051A1 (ko) 돼지생식기호흡기증후군바이러스 유래 펩타이드를 발현하는 키메라 바이러스 및 이를 포함하는 백신 조성물
WO2023101381A1 (ko) 구제역 바이러스 유사 입자를 생산하기 위한 백신 플랫폼
KR101933932B1 (ko) 돼지 생식기 및 호흡기 증후군 바이러스 변이주 및 이를 이용한 백신
WO2019212312A1 (ko) 키메라 지카바이러스 백신
WO2022045827A1 (ko) 신규한 코로나바이러스 재조합 스파이크 단백질, 이를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 벡터 및 상기 벡터를 포함하는 코로나바이러스감염증 예방 또는 치료용 백신
WO2020214003A1 (ko) B형 간염 바이러스의 증식을 억제하는 조성물 및 이의 방법
KR102193460B1 (ko) 돼지생식기호흡기증후군 예방용 백신 조성물 및 이의 예방 방법
KR102335864B1 (ko) 돼지 생식기 및 호흡기 증후군 바이러스의 키메라 바이러스 및 이를 이용한 백신
WO2014142515A1 (ko) 재조합 효모 전세포를 이용한 돼지 써코바이러스(pcv2) 서브유닛 백신과 그의 제조 방법
WO2022119380A1 (ko) 신규한 ace2 변이체 및 그의 이용
WO2023048532A1 (ko) 레오바이러스 기반 신규한 백신플랫폼 및 이의 용도
KR101933931B1 (ko) 돼지 생식기 및 호흡기 증후군 바이러스 변이주 및 이를 이용한 백신
WO2023027402A1 (ko) 아프리카 돼지열병 바이러스 유래 항원 단백질을 포함하는 아프리카 돼지열병의 예방용 백신
WO2021154055A1 (ko) 유럽형 돼지 생식기 호흡기 증후군 바이러스의 변이주 및 이를 포함하는 백신 조성물
WO2023211172A1 (ko) 유방암 세포 계대를 통한 키메라 지카바이러스 항암백신
WO2021125891A1 (ko) A형 간염 바이러스의 제조방법 및 상기의 방법에 따라 제조된 a형 간염 바이러스
WO2023055154A1 (ko) 재조합된 약독화 rsv 생백신 및 이를 제조하는 방법
WO2023229422A1 (ko) 지카바이러스 감염성 전장 클론 또는 이의 변이체 및 이들의 용도
WO2024014943A1 (ko) Sars-cov-2 백신 부스터 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22916212

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE