WO2022250431A1 - 모노바디 기반 키메라 항원 수용체 및 이를 포함하는 면역 세포 - Google Patents

모노바디 기반 키메라 항원 수용체 및 이를 포함하는 면역 세포 Download PDF

Info

Publication number
WO2022250431A1
WO2022250431A1 PCT/KR2022/007379 KR2022007379W WO2022250431A1 WO 2022250431 A1 WO2022250431 A1 WO 2022250431A1 KR 2022007379 W KR2022007379 W KR 2022007379W WO 2022250431 A1 WO2022250431 A1 WO 2022250431A1
Authority
WO
WIPO (PCT)
Prior art keywords
cancer
monobody
cell
cells
domain
Prior art date
Application number
PCT/KR2022/007379
Other languages
English (en)
French (fr)
Inventor
이준행
Original Assignee
주식회사 박셀바이오
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 박셀바이오 filed Critical 주식회사 박셀바이오
Priority to EP22811624.0A priority Critical patent/EP4349857A1/en
Priority to CN202280037489.2A priority patent/CN117693519A/zh
Publication of WO2022250431A1 publication Critical patent/WO2022250431A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/461—Cellular immunotherapy characterised by the cell type used
    • A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0005—Vertebrate antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/463—Cellular immunotherapy characterised by recombinant expression
    • A61K39/4631—Chimeric Antigen Receptors [CAR]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464402—Receptors, cell surface antigens or cell surface determinants
    • A61K39/464422—Ephrin Receptors [Eph]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70517—CD8
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70521—CD28, CD152
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70575—NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62—DNA sequences coding for fusion proteins
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
    • A61K2239/54—Pancreas
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment

Definitions

  • the present invention relates to monobody-based chimeric antigen receptors.
  • the monobody-based chimeric antigen receptor includes an extracellular ligand-binding domain including the monobody.
  • the present invention relates to an immune cell expressing a monobody-based chimeric antigen receptor on a cell surface membrane.
  • T cells are immune cells that mediate adaptive immunity and account for 75% of all lymphocytes. Most T cells exist in the blood in an inactive state, but when stimulated with an antigen, they change into an active form and can eliminate cells with specific antigens. The action of T cells can be activated by receptors capable of recognizing antigens (T cell receptor; TCR), co-stimulatory molecules and cytokines.
  • TCR of T cells binds to MHC (major histocompatibility complex) molecules bound to tumor-related antigens.
  • Cancer cells suppress the expression of these MHCs or immune checkpoints such as CTLA-4 and PD-1 expressed on the T cell surface. It suppresses the function of T cells by changing the function of the immune checkpoint.
  • T cells Chimeric Antigen Receptor T cells; CAR-T
  • CAR-T Chimeric Antigen Receptor T cells
  • scFv single chain variable fragment
  • the structure of the currently developed chimeric antigen receptor is divided into a scFv (single chain variable fragment) portion that recognizes an antigen, a transmembrane domain, and a signaling domain that transmits signals into cells.
  • Pharmaceutical companies and clinicians such as Novartis, Gilead, Celgene, and AbClone have developed CAR-T using scFv that specifically binds to the CD19 antigen of blood cancer cells as a blood cancer treatment (International Publication Nos. WO201616473, WO2015157252 , WO2018023025, WO2017211900, WO2017211900, WO2016028896).
  • Ephrin receptor is a 108 kDa membrane receptor tyrosine kinase (RTK), which is separated into three parts. rich region) and two fibronectin III repeats, a transmembrane part in the middle, and a kinase active domain in the cytoplasm (Labrador et al., 1997; Pasquale, 1997).
  • the ephrin receptor is a protein that binds to ephrin, a ligand, and transmits signals outside the cell into the cell through the phosphorylation process. Cell proliferation, cell migration, differentiation and synaptic transmission of nerve cells, tissue remodeling, bone cell differentiation, and blood vessel formation (Pasquale EB. Cell.
  • Ephrin receptor A2 (EphA2) is expressed in very small amounts in normal cells, but is found in most cancer cells, including liver cancer, prostate cancer, pancreatic cancer, head and neck cancer, stomach cancer, colon cancer, lung cancer, cervical cancer, and ovarian cancer. It is non-specifically overexpressed and promotes cancer progression (carcinogenesis), metastasis (metastasis), angiogenesis (angiogenesis), and resistance of tumors (resistance of tumors).
  • EphA2 has about 65% protein homology with EphA1, is found at almost the same location in the lungs of mice, and is overexpressed along with EphA1 and its ligand Ephrin-A1 in several malignancies including non-cellular lung cancer.
  • EphA2/A1-Ephrin It is involved in carcinogenesis and malignant progression through interaction with -A1 (Naj AC et al., Nat Genet. 43:436-441, 2011; Finney AC et al., Circulation. 136:566-582, 2017).
  • Patent Document 1 KR10-2020-0105840 A
  • Patent Document 2 KR10-2018-0121904 A
  • Patent Document 3 KR10-2018-0127344 A
  • Patent Document 4 KR10-2007-0107721 A
  • Patent Document 5 KR10-1528939 B1
  • Patent Document 7 KR10-1636882 B1
  • Patent Document 8 KR10-2018-0134347 A
  • Patent Document 9 KR10-2157197 B1
  • Non-Patent Document 1 Park SH, Park S, Kim DY, Pyo A, Kimura RH, Sathirachinda A, Choy HE, Min JJ, Gambhir SS, Hong Y. Isolation and Characterization of a Monobody with a Fibronectin Domain III Scaffold That Specifically Binds EphA2. PLoS One. 2015 Jul 15;10(7):e0132976. doi: 10.1371/journal.pone.0132976. eCollection 2015.PMID: 26177208
  • Non-Patent Document 2 Kim MA, Yoon HS, Park SH, Kim DY, Pyo A, Kim HS, Min JJ, Hong Y. Engineering of monobody conjugates for human EphA2-specific optical imaging. PLoS One. 2017 Jul 7;12(7):e0180786. doi: 10.1371/journal.pone.0180786. eCollection 2017.PMID: 28686661
  • Non-Patent Document 3 Pyo A, You SH, Sik Kim H, Young Kim J, Min JJ, Kim DY, Hong Y. Production of (64) Cu-labeled monobody for imaging of human EphA2-expressing tumors. Bioorg Med Chem Lett. 2020 Jul 15;30(14):127262. doi: 10.1016/j.bmcl.2020.127262. Epub 2020 May 15. PMID: 32527560
  • CAR-immune cells eg, CAR-T cells
  • scFv single chain variable fragment
  • solid cancer has various antigens (heterogeneity) that are different for each patient, and animal-based antibody information must be used to build a variety of libraries for these cancer antigens, which is costly and lengthy. It requires time and a lot of effort.
  • Antibodies, bispecific antibodies, and scFvs are large in size, so when used for the treatment of solid cancer, their tissue penetration is low, making it difficult to achieve sufficient therapeutic effect.
  • Bicistronic scFv that is, when two antigen recognition sites are expressed in T cells or NK cells, the affinity of the scFv for the antigen is lowered, resulting in low therapeutic effect or side effects due to non-specific binding.
  • Monobodies are similar to scFvs and can recognize antigens, and are smaller than scFvs and have advantages of high tissue penetration, but have the following problems when used to treat cancer cells.
  • the monobody itself has low stability in serum, and for example, a relatively large amount must be administered (e.g., greater than about 60 ⁇ g) to use the monobody for contrast media.
  • Monobodies have a short half-life in the body ( ⁇ 24h) and require frequent injections.
  • the inventors of the present invention can selectively recognize and bind cancer cells, have excellent in vivo penetration, have high effects, are not harmful even when administered in large amounts, and continuously stay in tissues A novel monobody-based CAR-immune cell capable of inducing immune memory was completed.
  • An object of the present invention is to provide a monobody-based chimeric antigen receptor and an immune cell expressing the same on a cell surface membrane in order to solve the problems of the prior art.
  • the present invention relates to a chimeric antigen receptor based on a monobody comprising an extracellular ligand binding domain comprising a monobody.
  • the monobody is CRL1, ephrin receptor, EphA2, ⁇ -galactosidase, RAS, Abl kinase, VEGFR2, MBP, SARS-CoV-2, Bcr-Abl kinase, STAT3, EGFR, VEGFR2, human Lyn tyrosine SH3 domain of kinases, MLKL, Fluc homologues, mitogen-activated protein kinase (MAPK), ERK2, MAPK14, kinase SH2 domain, SUMO, AurA, WDR5, Fluc family, GFP, SARS-CoV- A protein selected from the group consisting of receptor binding domain of 2, SH3 domain of FYN, SH2 domain of ABL, SUMO1, Bcr-Abl, GPR56 ECR, PD-L1, Glypican-3, PCSK9, Gp41, CD4, and IL-23 It may specifically bind to.
  • the monobody may specifically bind to an ephrin receptor, EphA2, or human EphA2.
  • the monobody may include the amino acid sequence of SEQ ID NO: 8.
  • the monobody-based chimeric antigen receptor comprises a transmembrane domain; And it may further include an intracellular signaling domain.
  • the transmembrane domain is T-cell receptor alpha chain, T-cell receptor beta chain, T-cell receptor zeta chain, CD8 alpha chain, CD8 beta chain, CD28, CD3epsilon, CD45, CD4, CD5, CD8, CD9, CD16 , CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, a part thereof, and combinations thereof.
  • the intracellular signaling domain is one or more signaling domains selected from the group consisting of TCRzeta, FcRgamma, FcRbeta, FcRepsilon, CD3gamma, CD3delta, CD3epsilon, CD3zeta, CD5, CD22, CD79a, CD79b and CD66d. It may contain.
  • the intracellular signaling domain may include one or more selected from the group consisting of an OX40 domain, a CD2 domain, a CD27 domain, a CD28 domain, a CDS domain, an ICAM-1 domain, an LFA-1 domain, and a 4-1BB domain.
  • the monobody-based chimeric antigen receptor of the present invention may further include a hinge.
  • the present invention may relate to an expression vector comprising the polynucleotide.
  • the present invention may relate to an engineered immune cell expressing the monobody-based chimeric antigen receptor on a cell surface membrane.
  • the immune cells may be leukocytes, neutrophils, eosinophils, basophils, monocytes, lymphocytes, T cells, cytotoxic T cells, natural killer T cells, dendritic cells, or combinations thereof.
  • the present invention may relate to a pharmaceutical composition for treating cancer, comprising the above immune cells.
  • the monobody-based chimeric antigen receptor according to the present invention immune cells expressing the same on the cell surface membrane, and a composition for preventing or treating cancer using the same may exhibit the following effects.
  • Target antibody therapy which is used as an anticancer therapy based on animal-derived antibodies, as it uses a small-sized monobody based on human FN3, and chimeric T-cell therapy using scFv obtained from a library of mouse monoclonal antibodies Disease side effects and cancer cell metastasis due to anticancer drug resistance can be minimized.
  • cancer antigens e.g., EphA2
  • Monobody-based CAR-immune cells can exhibit superior anticancer effects compared to solid cancer treatment in which conventional T-cells are administered alone. It can be used as an immunocancer agent for treating or preventing solid cancer.
  • FN3 monobodies have the advantage of being able to prepare various types of monobodies for target antigens. This makes it possible to manufacture monobody-based CAR-immune cells specific for various antigens, which is very effective in treating cancer.
  • Monobody-based CAR-immune cells are smaller in size than other CAR-immune cells (eg, monobody size is about 1/3 of scFv size), so penetration into cancer tissue is easier than scFv-based CAR,
  • monobody size is about 1/3 of scFv size
  • scFv-based CAR monobody size is about 1/3 of scFv size
  • up to four monobody sequences recognizing cancer antigens can be loaded into the vector in consideration of viral packing, thereby enhancing the heterogeneity of cancer antigens, a characteristic of solid cancers. This is an advantage that can be overcome.
  • since it has sufficient selectivity and specificity for cancer antigens it can block immune cell evasion of cancer and effectively prevent or treat cancer.
  • FIG. 1 shows the structure of a vector expressing a monobody-based chimeric antigen receptor.
  • FIGS. 2a and 2b are diagrams of a method for preparing a vector expressing a monobody-based chimeric antigen receptor.
  • Figure 3 shows the structure of the monobody-based chimeric antigen receptor expressed on the cell membrane surface.
  • FIG. 4 shows the result of FACS analysis of the expression level of the vector in immune cells into which the vector expressing the E1 monobody chimeric antigen receptor was introduced.
  • CD25 and CD69 which are T cell activators, in VEC-1 and VEC-2 immune cells.
  • FIG. 6 shows the results of FACS analysis of the expression level of EphA2 protein in solid cancer cells (gastric cancer, colon cancer, pancreatic cancer, ovarian cancer and prostate cancer).
  • FIG. 7 shows cancer cell killing ability of VEC-1 and VEC-2 immune cells analyzed using RTCA.
  • E1 monobody CAR-T VEC-1 immune cells using 3D co-culture.
  • Figure 10 shows the change in body weight of mice in the xenograft mouse model.
  • FIG. 11 shows a mouse survival curve graph drawn using the Kaplan Meier formula in a xenograft mouse model.
  • FIG. 12 is a photograph comparing the size of mouse tumors on day 44 after tumor transplantation in a xenograft mouse model.
  • FIG. 13 is an IVIS scan result comparing the degree of metastasis and proliferation of pancreatic cancer tumors in a pancreatic cancer xenograft mouse model.
  • practice of the present invention may utilize conventional techniques of cell biology, cell culture, molecular biology, microbiology, recombinant DNA, and immunology, which may be within the skill of the art.
  • CAR Monobody-based Chimeric Antigen Receptor
  • the monobody-based chimeric antigen receptor of the present invention may include an extracellular ligand binding domain.
  • extracellular ligand binding domain may refer to an oligopeptide or polypeptide capable of binding a ligand.
  • the domain is capable of interacting with cell surface molecules.
  • an extracellular ligand binding domain can be selected to recognize ligands that act as cell surface markers on target cells associated with certain diseases.
  • the term “monobody” may specifically bind to a ligand or antigen present on the surface of a target cell.
  • Monobodies can be variously selected depending on the desired target.
  • the monobodies are CRL1, ephrin receptor, EphA2, ⁇ -galactosidase, RAS, Abl kinase, VEGFR2, MBP, SARS-CoV-2, Bcr-Abl kinase, STAT3 , EGFR, VEGFR2, SH3 domain of human Lyn tyrosine kinase, MLKL, Fluc homologues, mitogen-activated protein kinase (MAPK), ERK2, MAPK14, kinase SH2 domain, SUMO, AurA, WDR5, Fluc family, GFP, receptor binding domain of SARS-CoV-2, SH3 domain of FYN, SH2 domain of ABL, SUMO1, Bcr-Abl, GPR56 ECR, PD
  • the monobody may be a known one.
  • the monobody may specifically bind to the ephrin receptor, EphA2, or human EphA2.
  • the monobody may have at least 70%, preferably at least 80%, more preferably at least 90%, 95%, 97% or 99% sequence identity to the amino acid sequence of SEQ ID NO: 8.
  • the monobody-based CAR may further include one or more selected from the group consisting of a hinge, a transmembrane domain, and an intracellular signaling domain.
  • a monobody-based CAR may include a transmembrane domain.
  • the distinguishing feature of a suitable transmembrane domain is that it is expressed on the surface of a cell, preferably an immune cell (particularly a lymphoid cell or NK cell) in the present invention, and interacts together to induce a cellular response of the immune cell against a predetermined target cell.
  • includes the ability to Transmembrane domains may be derived from natural sources or from synthetic sources. Transmembrane domains can be derived from any membrane-bound or transmembrane protein.
  • the transmembrane domain includes T-cell receptor alpha chain, T-cell receptor beta chain, T-cell receptor zeta chain, CD8 alpha chain, CD8 beta chain, CD28, CD3epsilon, CD45, CD4, CD5, CD8, CD9, CD16, It may be one or more selected from the group consisting of CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, some of these, and combinations thereof.
  • the hinge and transmembrane domains may include human CD8 alpha chain or portions thereof.
  • the hinge and transmembrane domains may comprise the amino acid sequence of SEQ ID NO: 9, preferably at least 70%, preferably at least 80%, more preferably at least 90%, 95%, 97% of the amino acid sequence of SEQ ID NO: 9 Or it may include an amino acid sequence having 99% sequence identity.
  • the intracellular signaling domain of the monobody-based CAR can be responsible for intracellular signaling after binding the extracellular ligand binding domain to the target resulting in activation of immune cells and immune responses.
  • the signaling domain may be responsible for activation of at least one of the normal effector functions of an immune cell expressing the monobody-based CAR.
  • the effector function of a T cell can be a cytotoxic activity or a helper activity involving the secretion of cytokines.
  • signal transduction domain may refer to a part of a protein that converts effector function signals in immune cells and induces cells to perform specific functions.
  • the intracellular signaling domain includes one or more selected from the group consisting of TCRzeta, FcRgamma, FcRbeta, FcRepsilon, CD3gamma, CD3delta, CD3epsilon, CD3zeta, CD5, CD22, CD79a, CD79b and CD66d.
  • the intracellular signaling domain may include one or more selected from the group consisting of an OX40 domain, a CD2 domain, a CD27 domain, a CD28 domain, a CDS domain, an ICAM-1 domain, an LFA-1 domain, and a 4-1BB domain.
  • the intracellular signaling domain may include one or more from the group consisting of a CD28 domain, a 4-1BB domain, and a CD3 zeta domain, preferably a CD28 domain and a CD3 zeta domain, or a 4-1BB domain and a CD3 zeta domain.
  • a CD28 domain preferably a CD28 domain and a CD3 zeta domain, or a 4-1BB domain and a CD3 zeta domain.
  • the CD28 domain may comprise the amino acid sequence of SEQ ID NO: 10 or an amino acid sequence having at least 70%, preferably at least 80%, more preferably at least 90%, 95%, 97% or 99% sequence identity thereto.
  • the 4-1BB domain may comprise the amino acid sequence of SEQ ID NO: 11 or an amino acid sequence having at least 70%, preferably at least 80%, more preferably at least 90%, 95%, 97% or 99% sequence identity thereto.
  • the CD3 zeta domain may comprise the amino acid sequence of SEQ ID NO: 12 or an amino acid sequence having at least 70%, preferably at least 80%, more preferably at least 90%, 95%, 97% or 99% sequence identity thereto.
  • the present invention may relate to a polynucleotide comprising a nucleic acid sequence encoding a monobody-based CAR, or a vector comprising such a nucleic acid sequence or polynucleotide.
  • the vector may mean an expression vector.
  • the polynucleotide may include the nucleic acid sequence of SEQ ID NO: 2.
  • the polynucleotide may comprise a nucleic acid sequence that has at least 70%, preferably at least 80%, more preferably at least 90%, 95%, 97% or 99% sequence identity to the nucleic acid sequence of SEQ ID NO: 2.
  • Nucleic acid sequences encoding monobody-based CARs may be codon-optimized for expression in human cells.
  • vector may refer to a construct capable of delivering, preferably capable of expressing, one or more gene(s) or sequence(s) of interest into a host cell.
  • viral vectors naked DNA or RNA expression vectors, plasmids, cosmids or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells , including, but not limited to, for example, producer cells.
  • the present invention provides an immune cell; and a method of manipulating an immune cell comprising introducing a polynucleotide into the immune cell.
  • the present invention may relate to a method of engineering an immune cell comprising providing an immune cell and expressing a monobody-based CAR on the surface of said cell.
  • the present invention may include modifying an immune cell with at least one polynucleotide encoding a monobody-based CAR, and expressing the polynucleotide into the cell.
  • Methods of making or manipulating the immune cells of the present invention may be in vitro or ex vivo methods.
  • the polynucleotide may be included in a lentiviral vector for stable expression in cells.
  • the present invention may relate to an isolated cell or cell line obtainable by the method for producing or manipulating the immune cell.
  • Cells isolated herein may include monobody-based CARs.
  • An immune cell of the present invention may refer to a cell of hematopoietic origin that is functionally involved in the initiation and/or execution of an innate and/or acquired immune response.
  • Immune cells of the present invention may be derived from stem cells.
  • Stem cells may be adult stem cells, non-human embryonic stem cells, non-human stem cells, cord blood stem cells, progenitor cells, bone marrow stem cells, induced pluripotent stem cells, pluripotent stem cells or hematopoietic stem cells.
  • the immune cells may be leukocytes, neutrophils, eosinophils, basophils, monocytes, lymphocytes, T cells, cytotoxic T cells, natural killer T cells, dendritic cells, or combinations thereof, but are not limited thereto.
  • Monobody-based CAR-immune cells, engineered immune cells or populations of these cells can be used in pharmaceutical compositions to prevent or treat cancer.
  • the present invention may relate to pharmaceutical compositions for preventing or treating cancer comprising monobody-based CAR-immune cells or engineered immune cells.
  • the invention may relate to the use of monobody-based CAR-immune cells for the manufacture of a medicament for preventing or treating cancer.
  • the treatment may be part of autologous immunotherapy or part of allogeneic immunotherapy.
  • Autologous can mean that the cell, cell line or population of cells used to treat a subject is obtained from the subject or from a human leukocyte antigen (HLA) compatible donor.
  • Allogeneic may mean that a cell or population of cells used to treat a subject is obtained from a donor rather than from the subject.
  • Cancers include melanoma, squamous cell carcinoma, breast cancer, head and neck cancer, thyroid cancer, soft tissue sarcoma, osteosarcoma, testicular cancer, prostate cancer, ovarian cancer, bladder cancer, skin cancer, brain cancer, angiosarcoma, mast cell tumor, leukemia, lymphoma, liver cancer, lung cancer, It may be pancreatic cancer, gastric cancer, kidney cancer, colon cancer, hematopoietic tumor or metastatic cancer thereof, but is not limited thereto. Also, the cancer can be a non-solid tumor or a solid cancer.
  • a non-solid tumor or non-solid cancer can be, but is not limited to, myeloma, lymphoma, or leukemia.
  • the solid cancer may be one or more selected from the group consisting of pancreatic cancer, prostate cancer, ovarian cancer, breast cancer, cervical cancer, skin cancer, colorectal cancer, kidney cancer, liver cancer, brain cancer, and lung cancer, but is not limited thereto.
  • Existing anticancer immunotherapy is known as a blood cancer treatment in which human cancer antigens are recognized and bound by mouse-based antibody molecules, specifically antibody fragments (scFv), and then cancer cells are removed by secretion of various cytokines or attack by surrounding immune cells.
  • scFv antibody fragments
  • Side effects of animal-based antibodies, low tissue penetration due to the size of scFv, and heterogeneity of different antigens for each patient in the case of solid cancers have problems in that at least two or more antigens must be recognized at the same time.
  • a pETh-E1GSE1 vector containing a nucleic acid sequence (SEQ ID NO: 2) expressing a monobody specifically binding to human EphA2 (hereinafter referred to as E1 monobody) was distributed from Professor Hong Young-jin's research team of Chonnam National University Industry-University Cooperation Foundation, and a chimeric antigen receptor was developed. An expression vector was prepared.
  • the expression vector was Invitrogen's pLenti7.3/V5-DEST TM Gateway TM Vector, and between the 5' UTR and 3' UTR of the pLenti7.3/V5-DEST vector, the CD8 ⁇ leader sequence-MSLN scFv- A nucleic acid sequence expressing the chimeric antigen receptor consisting of CD8 H&TM-CD28-CD3 ⁇ or CD8 ⁇ leader sequence-MSLN scFv-CD8 H&TM-4-1BB-CD3 ⁇ was included.
  • SEQ ID NO: 7 CD8 ⁇ signal sequence amino acid MALPVTALLLPLALLLHAARP Amino acid sequence corresponding to SEQ ID NO: 1 (amino acid sequence 1-21, NCBI accession # NP_741969.1)
  • SEQ ID NO: 8 E1 monomer amino acids VSDVPRDLEVVAATPTSLLISWYYPFCAFYYRITYGETGGNSPVQEFTVPRPSDTATISGLKPGVDYTITVYAVTCLGSYSRPISINYRT Amino acid sequence corresponding to SEQ ID NO: 2
  • SEQ ID NO: 9 CD8 ⁇ H&TM amino acids TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYC Amino acid sequence corresponding to SEQ ID NO: 3 (138-206, NCBI accession # NP_001139345.1)
  • SEQ ID NO: 10 CD28 amino acid RSKRSRLLHSDYMNMTPRRPGPTRKHYQP
  • the prepared vector and E1 monobody sequence are inserted into the site where the scFv sequence was present through homologous recombination using an Overlap cloner DNA cloning kit (Elpisbio) to obtain an E1 monobody sequence.
  • a recombinant lentiviral vector expressing the chimeric antigen receptor (pLenti7.3-EphA2 monobody chimeric antigen receptor vector) was prepared.
  • the prepared recombinant lentiviral vectors were named EphA2 mCAR-1 and EphA2 mCAR-2, respectively, and their structures are shown in FIG. 1, and schematic diagrams of the vector preparation method are shown in FIGS. 2a and 2b.
  • VEC-1 and VEC-2 Preparation and evaluation of immune cells expressing the E1 monobody-chimeric antigen receptor on the cell membrane surface (VEC-1 and VEC-2)
  • PBMC Peripheral blood mononuclear cells
  • Anti-CD3/anti-CD28 magnetic beads (anti-CD3/CD28 Dynabead; Gibco) and isolated human CD3+ T cells were mixed 1:1. After 24 hours of mixing, the activated magnetic beads were removed using a MACSiMAG separator tool. Then, the cells were washed with RPMI-1640.
  • EphA2 mCAR-1 and EphA2 mCAR-2 vectors introduced from the prepared VEC-1 and VEC-2 immune cells are properly expressed and the activation status of these immune cells is determined using FACS (Fluorescence-activated cell sorting). and confirmed.
  • the expression rate of the introduced vector i.e., the E1 monobody-chimera antigen receptor sequence
  • the expression rate of VEC-1 immune cells was about 40% compared to the control group without introduction of the vector, and the expression rate of VEC-2 immune cells showed an expression rate of about 30% (see FIG. 4). From these results, it was confirmed that the vector introduced into the immune cells was well expressed, and the E1 monobody-chimeric antigen receptor was properly expressed in the engineered immune cells VEC-1 and VEC-2.
  • EphA2-expressing cancer cells ovarian cancer cell line OVCAR-3; pancreatic cancer cell lines CAPAN-2 and AsPC-1; prostate cancer cell line PC-3, MSI-H gastric cancer cell line SNU638 and MSI-H colorectal cancer cell line DLD1, Lovo, HCT8, HCT15; see FIG. 6) and E1 monobody CAR-T cells That is, VEC-1 and VEC-2 cells) were co-cultured, and the ability of the engineered immune cells to kill cancer cells was measured (see FIGS. 7 and 8).
  • ovarian cancer cell line OVCAR-3 from Korean Cell Line Bank; pancreatic cancer cell lines Capan-2 and AsPC-1; and prostate cancer cell line PC-3; Gastric cancer cell lines SNU638 and colorectal cancer cell lines DLD1, LoVo, HCT-8, and HCT-15 were purchased and used.
  • EphA2 In order to confirm whether or not EphA2 is expressed in these cell lines, the expression level and presence of the EphA2 antigen were analyzed by FACS using an anti-EphA2 antibody. As a result, it was confirmed that all of these cancer cell lines express EphA2 to a high degree (see FIG. 6), and it will be possible to confirm the cancer cell killing ability of E1 monobody CAR-T cells targeting EphA2 using this.
  • Gold microelectrodes attached to the bottom surface of a microtiter plate (E-Plate) well were used as a biosensor.
  • E-Plate electrically conductive solution
  • an electrically conductive solution eg, buffer or standard tissue culture medium
  • electrons leave the negative terminal.
  • These electrons pass through the bulk solution and are deposited at the anode terminal to complete the circuit.
  • adherent cells at the electrode-solution interface hinders the flow of electrons because the signal varies depending on the interaction between the bulk solution and the biosensor. Therefore, it is possible to automatically measure various cell responses (changes in cell number, proliferation rate, cell size, cell shape, and substrate attachment quality) through kinetics by measuring the resistance value called impedance generated during cell growth.
  • the resistance value detected by the cell is displayed as an indicator called Cell Index (CI), and the change in CI value shows the change in the shape of the cell.
  • CI Cell Index
  • VEC-1 or VEC-2 transduced E1 monobody CAR-T cells
  • control group untransduced human T cells
  • the prepared PBS, control T cells, VEC-1 and VEC-2 immune cells 1 x 10 7 /200ul were intravenously injected once. 5 to 10 mice were used per group, and tumor size and mouse weight were measured twice a week.
  • cancer cells eg, pancreatic cancer cell AsPC-1: 1x10 6 /10 mL were placed in a culture container and cultured.
  • Test materials PICO 5053 (Orient Bio), g-irradiated 18% beta-chip (Orient Bio), sterilized tap water and water bottle, high-pressure steam sterilizer, clipper (Jeongdo B&P), wet tissue, Ipran solution (Hana Pharmaceutical), Veet, respiratory anesthesia machine and chamber
  • mice The tumor size and body weight of the mice were measured, and the tumor size and body weight of the mice were similarly adjusted for each group.
  • the size of the tumor reached 100 ⁇ 150 mm 3
  • 200 ul of PBS and cells (1 x 10 7 /200 ul of control normal T cells and E1 monobody CAR-T cells) were intravenously injected into the tail vein of the mouse.
  • mice were respiratory anesthetized with 2-3% isoflurane, and tumor size and body weight were measured twice a week.
  • the size of the mouse tumor was calculated by measuring the long axis (L), short axis (W), and height (H) with a vernier caliper and multiplying by 0.52, and the weight of the mouse was measured using an electronic balance.
  • Prostate cancer cell line (PC-3) 1 x 10 7 cells/100ul and 1 x PBS were xenotransplanted into the subcutaneous tissue of the mouse's right back 12 days after tumor generation in a mouse model, PBS for each group, control T cells (transfected with virus) After intravenous injection of activated control normal T cells (Cont-T), VEC-1 cells and VEC-2 cells not introduced, the tumor size was measured using a scale bar, and the results are shown in FIG. 9 .
  • the size of tumors in mice injected with VEC-1 or VEC-2 significantly decreased after 22 days after tumor formation compared to mice injected with only control normal T cells or PBS.
  • mice administered with VEC-1 or VEC-2 recovered their health faster than mice administered with control normal T cells, and then normal T cells began to recover after 30 days, Mice fed with only PBS continued to lose weight in proportion to tumor size and deteriorated in health.
  • the survival rate of prostate cancer xenograft mouse models at the end of the experiment (50 days) was evaluated using the Kaplan-Meier formula, and the results are shown in FIG. 11 .
  • both groups of mice administered with VEC-1 and VEC-2 showed a high survival rate, which was significantly superior to that of normal T cells in the control group.
  • E1 monobody CAR-T cells (VEC-1 or VEC-2) were intravenously injected, and the size of the tumor was measured on the 28th day, and the results are shown in FIG. 12 .
  • FIG. 12 it was confirmed that the tumors in the mouse group administered with VEC-1 or VEC-2 were significantly smaller than those in the mice group administered with normal T cells and the mouse group administered only with PBS.
  • Pancreatic cancer cells (AsPC-1, 2 x 10 6 cells) were transplanted into the mouse peritoneal cavity, and 14 days later, PBS, normal T cells, VEC-1 and VEC-2 were intraperitoneally administered. At 4 weeks after administration, the degree of metastasis of pancreatic cancer cells was photographed using an in vivo imaging system (IVIS), and the results are shown in FIG. 13 . As shown in FIG. 13 , it was confirmed that tumors hardly proliferated or metastasized in mice administered with VEC-1 and VEC-2 compared to mice administered only with normal T cells and PBS.
  • IVIS in vivo imaging system
  • pancreatic cancer cells were transplanted into the peritoneal cavity of mice, and 14 days later, PBS, normal T cells (Con T), VEC-1 and VEC-2 were intraperitoneally administered and bioluminescence imaging (BLI) The size of the tumor was measured and the results are shown in FIG. 14 .
  • PBS normal T cells
  • Con T normal T cells
  • VEC-1 and VEC-2 were intraperitoneally administered and bioluminescence imaging (BLI)
  • FIG. 14 As shown in FIG. 14, compared to mice administered with normal T cells and mice administered only with PBS, tumors in mice administered with VEC-1 or VEC-2 hardly proliferated, which was until the 4th week after pancreatic cancer cell transplantation. continued to be maintained
  • the monobody-based chimeric antigen receptor and immune cells e.g., cytotoxic T cells
  • cytotoxic T cells e.g., cytotoxic T cells
  • the monobody-based chimeric antigen receptor and immune cells have an excellent anticancer effect that significantly inhibits the proliferation of prostate and pancreatic cancer cells and significantly increases the survival rate of mice. know what you have Therefore, various cancers including solid cancers can be prevented or treated using immune cells containing monobody-based chimeric antigen receptors.

Abstract

본 발명은 모노바디 기반 키메라 항원 수용체에 관한 것이다. 이러한 모노바디 기반 키메라 항원 수용체는 모노바디를 포함하는 세포외 리간드 결합 도메인을 포함하는 것이다. 또한, 본 발명은 모노바디 기반 키메라 항원 수용체를 세포 표면 막에 발현하는 면역 세포에 관한 것이다. 이러한 모노바디 기반 CAR-면역 세포는 1) 암 세포 표면에 발현되는 수용체를 타겟으로 하여 암을 예방 또는 치료하는 우수한 효과를 나타낼 수 있으며, 2) 동물 유래 scFv 기반 CAR-면역 세포와는 달리 인간 FN3를 기반으로 한 모노바디를 세포외 리간드 결합 도메인으로 사용하였기 때문에 인간에게 투여할 경우 낮은 면역원성을 나타내며, 3) scFv 보다 크기가 작아 조직에 대한 침투력이 높고, 4) 기존의 암 치료를 위한 항체 치료가 갖는 부작용(예: 비특이적 결합에 의한 자가 면역 질환의 발생) 등을 최소화할 수 있으며, 5) 이미 구축된 다양한 암 세포 항원에 대한 모노바디 라이브러리를 이용하여 다양한 모노바디 기반 CAR-면역 세포를 제작할 수 있으므로 다양한 항원을 가진 난치성 고형암을 예방 또는 치료하는 데 유용하게 사용할 수 있다.

Description

모노바디 기반 키메라 항원 수용체 및 이를 포함하는 면역 세포
본 발명은 모노바디 기반 키메라 항원 수용체에 관한 것이다. 상기 모노바디 기반 키메라 항원 수용체는 모노바디를 포함하는 세포외 리간드 결합 도메인을 포함하는 것이다. 또한, 본 발명은 모노바디 기반 키메라 항원 수용체를 세포 표면 막에 발현하는 면역 세포에 관한 것이다.
고형암을 치료함에 있어 외과적 절제만으로는 암 줄기 세포, 잔존해 있는 암세포, 또는 전이성 암세포를 완전히 제거하기 어렵기 때문에 외과적 절제술과 함께 방사선 요법(radiation therapy), 화학 요법(chemotherapy), 표적치료(target therapy) 및 면역치료(immunotherapy) 등을 병행한 복합치료법이 사용되고 있다. 특히 면역치료법은 체내의 면역계를 이용하기 때문에 방사선 치료나 화학요법에서 보이는 부작용이 거의 없다.
T 세포는 적응성 면역반응(adaptive immunity)을 매개하는 면역 세포로서 전체 림프구의 75%에 해당한다. T 세포는 대부분 혈액 내에 비활성 상태로 존재하지만 항원 자극을 받으면 활성 형태로 변하여 특정 항원을 가진 세포를 제거할 수 있게 된다. T 세포의 작용은 항원을 인지할 수 있는 수용체(T cell receptor; TCR), 공동자극인자(co-stimulatory molecules) 및 사이토카인(cytokine) 등에 의해 활성화될 수 있다.
그러나 T 세포의 TCR은 종양 관련 항원이 결합된 MHC(major histocompatibility complex) 분자에 결합하는데, 암세포는 이러한 MHC의 발현을 억제하거나, T 세포 표면에 발현된 CTLA-4, PD-1 등과 같은 면역관문(immune checkpoint)의 기능을 변화시켜 T 세포의 기능을 억제한다. 이에 따라 MHC 분자를 인식하는 것이 아니라 직접 종양 관련 항원을 인지할 수 있는 키메라 항원 수용체를 세포 내에 발현시킨 T 세포(Chimeric Antigen Receptor T cell; CAR-T), 또는 암 세포의 면역관문 수용체에 대한 특이적인 항체 서열을 세포 내에 발현시킨 T 세포가 개발되기 시작하였다.
현재 개발된 키메라 항원 수용체의 구조는 항원을 인지하는 scFv(single chain variable fragment) 부분, 막관통 도메인(transmembrane domain), 및 세포 내로 신호를 전달하는 신호전달 도메인(signaling domain)으로 나뉜다. 노바티스, 길리어드, 셀진, 앱클론 등의 제약회사들과 임상의들은 혈액암 치료법으로서 혈액암 세포의 CD19 항원에 특이적으로 결합하는 scFv를 이용한 CAR-T를 개발하였다(국제공개번호 WO201616473, WO2015157252, WO2018023025, WO2017211900, WO2017211900, WO2016028896).
고형암에 대해서도 다양한 유전자 조작 기술이 융합된 CAR 기반 면역 세포 치료가 절대적으로 요구되고 있지만, 고형암의 경우 환자마다 다른 항원들을 발현하는 이형질성(heterogeneity), 저산소환경(hypoxia) 등과 같은 종양 미세환경(tumor microenvironment)의 복잡한 특성, T 세포의 이동 및 활성의 제약 등으로 인해 진전이 없는 상태이다.
에프린 수용체(Ephrin receptor)는 크기가 108kDa의 막수용체 타이로신 키네이즈(Receptor Tyrosine Kinase, RTK)로서, 세 부분으로 분리되는데 세포막 바깥쪽에는 리간드 결합 도메인(ligand-binding domain), 시스테인 부위(cystein-rich region) 및 2개의 피브로넥틴 III 반복구조가 있고, 가운데 막투과 부분, 그리고 세포질쪽에는 키네이즈 활성 도메인을 갖는다(Labrador et al., 1997; Pasquale, 1997). 에프린 수용체는 리간드인 에프린과 결합하여 세포 외부신호를 인산화과정을 통해 세포 내로 전달하는 단백질이며, 세포증식, 세포이동, 분화 및 신경세포의 시냅스전달, 조직 재형성, 골세포분화와 혈관형성에 관여한다(Pasquale EB. Cell. 133:38-52, 2008; Barquilla A et al., Annu. Rev. Pharmacol. Toxicol. 55:465-487, 2015). 에프린 수용체의 구조와 리간드-수용체 간의 결합특이성(ligand-receptor specificity)에 따라 9가지 타입의 A그룹(EphA1-8 및 EphA10)과 5가지 타입의 B그룹(EphB1-4 및 EphB6)으로 구별된다(Ieguchi K. Endocr Metab Immune Disord Drug Targets. 15:119-128, 2015; Eph Nomenclature Committee. Cell. 90:403-404, 1997; Lindberg RA et al., Mol Cell Biol. 10(12):6316-6324, 1990; Davis S et al., Science. 266(5186):816-819, 1994). 이 중 에프린 수용체 A2(Ephrin receptor A2, EphA2)는 정상세포에서는 극히 소량으로 발현되나, 간암, 전립선암, 췌장암, 두경부암, 위암, 대장암, 폐암, 자궁경부암, 난소암 등 대부분의 암세포에서 비특이적으로 과발현되며 암의 진행(carcinogenesis), 전이(metastasis), 혈관형성(angiogenesis), 암의 내성(resistance of tumors) 등을 촉진한다. EphA2는 EphA1과 약 65%의 단백질 상동성을 갖고 있으며 쥐의 폐에서 거의 동일한 위치에서 발견되고 비세포폐암을 비롯한 여러 악성종양에서 EphA1 및 리간드인 Ephrin-A1과 함께 과발현되며, EphA2/A1-Ephrin-A1과의 상호작용을 통해 발암 및 악성화 진행에 관여한다(Naj AC et al., Nat Genet. 43:436-441, 2011; Finney AC et al., Circulation. 136:566-582, 2017).
[선행기술문헌]
[특허문헌]
(특허문헌 1) KR10-2020-0105840 A
(특허문헌 2) KR10-2018-0121904 A
(특허문헌 3) KR10-2018-0127344 A
(특허문헌 4) KR10-2007-0107721 A
(특허문헌 5) KR10-1528939 B1
(특허문헌 6) KR10-1521668 B1
(특허문헌 7) KR10-1636882 B1
(특허문헌 8) KR10-2018-0134347 A
(특허문헌 9) KR10-2157197 B1
[비특허문헌]
(비특허문헌 1) Park SH, Park S, Kim DY, Pyo A, Kimura RH, Sathirachinda A, Choy HE, Min JJ, Gambhir SS, Hong Y. Isolation and Characterization of a Monobody with a Fibronectin Domain III Scaffold That Specifically Binds EphA2. PLoS One. 2015 Jul 15;10(7):e0132976. doi: 10.1371/journal.pone.0132976. eCollection 2015.PMID: 26177208
(비특허문헌 2) Kim MA, Yoon HS, Park SH, Kim DY, Pyo A, Kim HS, Min JJ, Hong Y. Engineering of monobody conjugates for human EphA2-specific optical imaging. PLoS One. 2017 Jul 7;12(7):e0180786. doi: 10.1371/journal.pone.0180786. eCollection 2017.PMID: 28686661
(비특허문헌 3) Pyo A, You SH, Sik Kim H, Young Kim J, Min JJ, Kim DY, Hong Y. Production of(64)Cu-labeled monobody for imaging of human EphA2-expressing tumors. Bioorg Med Chem Lett. 2020 Jul 15;30(14):127262. doi: 10.1016/j.bmcl.2020.127262. Epub 2020 May 15. PMID: 32527560
종래 항체의 단일 가닥 가변부(single chain variable fragment, scFv)를 세포외 리간드 결합 도메인으로 사용한 CAR-면역 세포(예: CAR-T 세포)에서는 다음과 같은 문제점이 있었다.
1) 마우스의 단일 클론 항체로부터 수득한 동물 유래 단백질이므로 암 항원에 대한 강한 결합으로 인해 사이토카인 폭풍(cytokine release syndrome, CRS), 이식편대숙주질환, 및 종양용해증후군과 같은 심각한 부작용이 발생하며, 면역계의 과도한 활성으로 인해 신속한 면역계 수축이 일어나 장기적으로는 종양 억제 효과가 낮아진다.
2) CD19를 단일항원으로 하는 혈액암과 달리, 고형암은 환자마다 다른 다양한 항원(heterogeneity)을 가지고 있으며, 이러한 암 항원에 대한 다양한 라이브러리를 구축하기 위해서는 동물-기반 항체 정보를 사용해야 하므로 많은 비용, 오랜 시간 및 많은 노력이 요구된다.
3) 항체, 이중 항체 및 scFv는 크기가 커서 고형암의 치료에 사용할 경우 조직 내 침투력이 낮아 충분한 치료 효과를 나타내기 어렵다.
4) 바이시스트로닉(bicistronic) scFv, 즉 2 개의 항원 인식 부위를 T 세포 또는 NK 세포에서 발현시켰을 때 scFv의 항원에 대한 친화도가 떨어져 치료 효과가 낮거나 비특이적 결합으로 인한 부작용이 발생할 수 있다.
5) scFv 기반 CAR-면역 세포 치료제가 투여되더라도, CAR의 타겟이 되는 암세포 에피토프에서 돌연변이가 발생하여 항원 회피 발생율이 높다.
이러한 scFv의 문제점을 해결하기 위해, 모노바디가 개발되었다. 모노바디는 scFv와 유사하여 항원을 인지할 수 있고, scFv에 비하여 크기가 작아 조직에 대한 침투력이 높은 장점을 가지나, 암세포를 치료하는데 사용하기에는 다음과 같은 문제점이 있다.
1) 항원에 대한 결합력이 항체 및 scFv에 비해 상대적으로 낮다.
2) 모노바디 자체로는 암세포에 대한 독성이 없으므로, 암 치료제로 사용하기 위해서는 다양한 조작(예: 항암제를 결합시키거나, T세포 또는 NK세포를 융합시키는 방식 등)이 요구된다.
3) 모노바디 자체로는 혈청에서 안정성이 낮으며, 예를 들어 조영제 용도로 모노바디를 사용하기 위해서는 상대적으로 많은 양을 투여해야 한다(예: 약 60 ug 초과).
4) 모노바디는 체내 반감기가 짧아(<24h) 자주 주입해야 한다.
본 발명자들은 상기의 문제점을 해결하기 위하여, 암세포를 선택적으로 인식하고 결합할 수 있고, 생체 내 침투력이 우수하여 높은 효과를 가지며, 많은 양을 투여하여도 유해하지 않고, 조직 내에서 지속적으로 머물면서 면역 기억을 유도해 낼 수 있는 신규한 모노바디 기반 CAR-면역 세포를 완성하였다.
본 발명은 전술한 종래 기술의 문제점을 해결하기 위하여 모노바디 기반 키메라 항원 수용체 및 이를 세포 표면 막에 발현하는 면역 세포를 제공하는 것을 목적으로 한다.
본 발명은 모노바디를 포함하는 세포외 리간드 결합 도메인을 포함하는 모노바디 기반 키메라 항원 수용체에 관한 것이다.
상기 모노바디는 CRL1, 에프린 수용체, EphA2, β-갈락토시데이스, RAS, Abl 키네이스, VEGFR2, MBP, SARS-CoV-2, Bcr-Abl 키네이스, STAT3, EGFR, VEGFR2, 인간 Lyn 티로신 키네이스의 SH3 도메인, MLKL, Fluc 동종체(homologues), 미토겐-활성 단백질 키네이스(MAPK), ERK2, MAPK14, 키네이스 SH2 도메인, SUMO, AurA, WDR5, Fluc 패밀리, GFP, SARS-CoV-2의 수용체 결합 도메인, FYN의 SH3 도메인, ABL의 SH2 도메인, SUMO1, Bcr-Abl, GPR56 ECR, PD-L1, 글리피칸-3, PCSK9, Gp41, CD4, 및 IL-23로 이루어진 군으로부터 선택된 단백질에 특이적으로 결합하는 것일 수 있다.
상기 모노바디는 에프린 수용체, EphA2, 또는 인간 EphA2에 특이적으로 결합하는 것일 수 있다.
상기 모노바디는 서열번호 8의 아미노산 서열을 포함하는 것일 수 있다.
상기 모노바디 기반 키메라 항원 수용체는 막관통 도메인; 및 세포내 신호전달 도메인을 추가로 포함하는 것일 수 있다.
상기 막관통 도메인은 T-세포 수용체 알파 사슬, T-세포 수용체 베타 사슬, T-세포 수용체 제타 사슬, CD8 알파 사슬, CD8 베타 사슬, CD28, CD3엡실론, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, 이들의 일부, 및 이들의 조합으로 이루어진 군으로부터 선택된 하나 이상일 수 있다.
상기 세포내 신호전달 도메인은 TCR제타, FcR감마, FcR베타, FcR엡실론, CD3감마, CD3델타, CD3엡실론, CD3제타, CD5, CD22, CD79a, CD79b 및 CD66d으로 이루어진 군으로부터 선택된 하나 이상의 신호전달 도메인을 포함하는 것일 수 있다.
상기 세포내 신호전달 도메인은 OX40 도메인, CD2 도메인, CD27 도메인, CD28 도메인, CDS 도메인, ICAM-1 도메인, LFA-1 도메인 및 4-1BB 도메인으로 이루어진 군으로부터 선택된 하나 이상을 포함하는 것일 수 있다.
본 발명의 모노바디 기반 키메라 항원 수용체는 힌지를 추가로 포함할 수 있다.
본 발명의 모노바디 기반 키메라 항원 수용체를 코딩하는 핵산 서열을 포함하는 폴리뉴클레오티드에 관한 것일 수 있다.
본 발명은 상기 폴리뉴클레오티드를 포함하는 발현 벡터에 관한 것일 수 있다.
본 발명은 상기 모노바디 기반 키메라 항원 수용체를 세포 표면 막에서 발현하는 조작된 면역 세포에 관한 것일 수 있다.
상기 면역 세포는 백혈구, 호중구, 호산구, 호염기구, 단핵구, 림프구, T 세포, 세포독성 T 세포, 자연살상 T 세포, 수지상세포, 또는 이들의 조합일 수 있다.
본 발명은 상기 면역 세포를 포함하는, 암을 치료하기 위한 약학적 조성물에 관한 것일 수 있다.
본 발명에 따른 모노바디 기반 키메라 항원 수용체, 이를 세포 표면 막에서 발현하는 면역 세포, 및 이를 이용하여 암을 예방 또는 치료하는 조성물은 다음과 같은 효과를 나타낼 수 있다.
1) 빠른 세포 증식만을 억제하는 기존 방식의 방사선 치료법 또는 DNA 뉴클레오티드 유사체(시스플라틴 계열 및 5-FU 계열) 등의 화학치료법에서 정상 세포의 성장까지 억제함으로써 발생하는 부작용(예: 탈모와 소화장애)을 낮출 수 있다.
2) 인간 FN3 기반의 작은 크기의 모노바디를 사용하므로 동물에서 유래한 항체 기반 항암 치료법으로 사용되고 있는 표적 항체 치료법과 마우스 단일클론 항체의 라이브러리에서 얻은 scFv를 이용한 키메라 T-세포 치료법에서 발생하는 자가 면역질환 부작용 및 항암제 내성으로 인한 암세포 전이 등을 최소화할 수 있다.
3) 암에 살상능력이 없고, 불안정하며, 수명이 짧아 진단용으로만 사용되었던 모노바디의 한계를 넘어 암 항원(예: EphA2)을 발현하는 고형암들을 효과적으로 억제 또는 제거할 수 있으므로, 암의 진단과 치료가 동시에 가능하다.
4) 모노바디 기반 CAR-면역 세포는 종래의 T-세포를 단독으로 투여하는 고형암 치료에 비하여 우수한 항암 효과를 나타낼 수 있으며, 예를 들어 EphA2를 항원으로 발현하는 췌장암, 전립선암, 난소암과 같은 고형암을 치료 또는 예방하기 위한 면역 항암제로 사용될 수 있다.
5) FN3 모노바디는 타겟 항원에 대한 다양한 종류의 모노바디를 제조할 수 있다는 장점을 가진다. 이로 인해 다양한 항원에 대해 특이적인 모노바디 기반 CAR-면역 세포를 제조할 수 있으므로 암을 치료하는 데 매우 효과적이다.
6) 모노바디 기반 CAR-면역 세포는 다른 CAR-면역 세포에 비하여 크기가 작아(예를 들면, 모노바디의 크기는 scFv 크기의 1/3 정도) 암 조직 내 침투가 scFv 기반 CAR 보다 용이하며, multivalent CAR를 바이러스벡터에 제작하고자 할 때 바이러스패킹(viral packing)을 고려하여 최대 4개까지 암항원을 인식하는 모노바디 서열을 벡터에 실을 수 있어 고형암의 특성인 암항원의 다양성(heterogeneity)을 극복할 수 있는 장점이 된다. 또한, 암 항원에 대한 충분한 선택성 및 특이성을 가지므로, 암의 면역 세포 회피 등을 차단하고 암을 효과적으로 예방 또는 치료할 수 있다.
도 1은 모노바디 기반 키메라 항원 수용체를 발현하는 벡터의 구조를 나타낸 것이다.
도 2a 및 2b는 모노바디 기반 키메라 항원 수용체를 발현하는 벡터를 제조하는 방법을 도식화한 것이다.
도 3은 모노바디 기반 키메라 항원 수용체가 세포막 표면에 발현된 구조를 나타낸 것이다.
도 4는 E1 모노바디 키메라 항원 수용체를 발현하는 벡터가 도입된 면역 세포에서 벡터의 발현 정도를 FACS로 분석한 결과를 나타낸 것이다.
도 5는 VEC-1 및 VEC-2 면역 세포에서 T 세포 활성 인자인 CD25 및 CD69의 활성 정도를 FACS로 분석한 결과를 나타낸 것이다.
도 6은 고형암 세포(위암, 대장암, 췌장암, 난소암 및 전립선암)에서 EphA2 단백질의 발현 정도를 FACS로 분석한 결과를 나타낸 것이다.
도 7은 RTCA를 이용하여 분석한 VEC-1 및 VEC-2 면역 세포의 암세포 살해능을 나타낸 것이다.
도 8은 3D 공배양법을 이용한 E1 모노바디 CAR-T(VEC-1) 면역세포의 암세포 살해능을 나타낸 것이다.
도 9는 이종이식 마우스 모델에서의 종양 크기 변화를 나타낸 것이다.
도 10은 이종이식 마우스 모델에서 마우스의 몸무게 변화를 나타낸 것이다.
도 11은 이종이식 마우스 모델에서 카플란 마이어 공식을 이용해 도시한 마우스 생존 곡선 그래프를 나타낸다.
도 12는 이종이식 마우스 모델에서 종양 이식 후 44일 째의 마우스 종양 크기를 비교한 사진이다.
도 13은 췌장암 이종 이식 마우스 모델에서 췌장암 종양의 전이 및 증식 정도를 비교한 IVIS 촬영 결과이다.
도 14는 바이오루미네선스 이미징으로 분석한 췌장암 이종 이식 모델에서의 췌장암 종양 성장 곡선을 나타낸다.
본 발명에서 상세하게 정의하지 않는 한, 본 발명에 사용되는 모든 기술 용어 및 과학 용어는 유전자 치료법, 생화학, 유전학, 및 분자 생물학의 분야에서 통상의 기술자가 일반적으로 이해하는 것과 동일한 의미를 가질 수 있다.
본 발명을 실시하는 것은 달리 명시하지 않는 한, 세포 생물학, 세포 배양, 분자 생물학, 미생물학, 재조합 DNA 및 면역학의 통상적인 기술을 이용할 수 있으며, 이는 해당 분야의 기술 내에 속하는 것일 수 있다.
모노바디 기반 키메라 항원 수용체
본 발명의 모노바디 기반 키메라 항원 수용체 (CAR)에 관한 것이다.
본 발명의 모노바디 기반 키메라 항원 수용체는 세포외 리간드 결합 도메인을 포함하는 것일 수 있다.
본 발명에서 사용되는 용어 "세포외 리간드 결합 도메인"은 리간드를 결합시킬 수 있는 올리고펩티드 또는 폴리펩티드를 의미할 수 있다. 바람직하게, 도메인은 세포 표면 분자와 상호작용할 수 있다. 예를 들어, 세포외 리간드 결합 도메인은 임의의 질환과 관련된 타겟 세포 상에서 세포 표면 마커로 작용하는 리간드를 인식하기 위해 선택될 수 있다.
본 발명에서 사용되는 용어 "모노바디(monobody)"는 타겟 세포의 표면에 존재하는 리간드 또는 항원에 특이적으로 결합하는 것일 수 있다. 모노바디는 원하는 표적에 따라 다양하게 선택될 수 있다. 예를 들어, 모노바디는 CRL1, 에프린 수용체, EphA2, β-갈락토시다아제(β-galatosidase), RAS, Abl 키네이스, VEGFR2, MBP, SARS-CoV-2, Bcr-Abl 키네이스, STAT3, EGFR, VEGFR2, 인간 Lyn 티로신 키네이스의 SH3 도메인, MLKL, Fluc 동종체(homologues), 미토겐-활성 단백질 키네이스(MAPK), ERK2, MAPK14, 키네이스 SH2 도메인, SUMO, AurA, WDR5, Fluc 패밀리, GFP, SARS-CoV-2의 수용체 결합 도메인, FYN의 SH3 도메인, ABL의 SH2 도메인, SUMO1, Bcr-Abl, GPR56 ECR, PD-L1, 글리피칸-3, PCSK9, Gp41, CD4, 및 IL-23로 이루어진 군으로부터 선택된 단백질에 특이적으로 결합하는 것일 수 있으나, 이에 제한되지는 않는다.
또한, 모노바디는 공지된 것일 수 있다.
모노바디는 에프린 수용체, EphA2, 또는 인간 EphA2에 특이적으로 결합하는 것일 수 있다.
모노바디는 서열번호 8의 아미노산 서열과 적어도 70%, 바람직하게 적어도 80%, 더욱 바람직하게 적어도 90%, 95%, 97% 또는 99% 서열 동일성을 가지는 것일 수 있다.
모노바디 기반 CAR는 힌지, 막관통 도메인, 및 세포내 신호전달 도메인으로 이루어진 군으로부터 선택된 하나 이상을 더 포함할 수 있다.
또한, 모노바디 기반 CAR는 세포의 표면 막 상에서 발현된다. 이에 따라, 모노바디 기반 CAR은 막관통 도메인을 포함할 수 있다. 적절한 막관통 도메인의 구별되는 특징은 세포, 바람직하게 본 발명에서 면역 세포(특히 림프구 세포 또는 NK 세포)의 표면에서 발현되고, 미리 정해진 타겟 세포에 대해 면역 세포의 세포 반응을 유도하기 위해 함께 상호작용하는 능력을 포함한다. 막관통 도메인은 천연 공급원으로부터 또는 합성 공급원으로부터 유래될 수 있다. 막관통 도메인은 임의의 막-결합 또는 막관통 단백질로부터 유래될 수 있다.
막관통 도메인은 T-세포 수용체 알파 사슬, T-세포 수용체 베타 사슬, T-세포 수용체 제타 사슬, CD8 알파 사슬, CD8 베타 사슬, CD28, CD3엡실론, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, 이들의 일부, 및 이들의 조합으로 이루어진 군으로부터 선택된 하나 이상일 수 있다.
힌지 및 막관통 도메인은 인간 CD8 알파 사슬 또는 그 일부를 포함할 수 있다. 힌지 및 막관통 도메인은 서열번호 9의 아미노산 서열을 포함하는 것일 수 있으며, 바람직하게 서열번호 9의 아미노산 서열과 적어도 70%, 바람직하게 적어도 80%, 더욱 바람직하게 적어도 90%, 95%, 97% 또는 99% 서열 동일성을 가지는 아미노산 서열을 포함하는 것일 수 있다.
모노바디 기반 CAR의 세포내 신호전달 도메인은 면역 세포 및 면역 반응의 활성화를 야기시키는 타겟에 세포외 리간드 결합 도메인을 결합시킨 후 세포내 신호전달의 원인이 될 수 있다. 신호전달 도메인은 모노바디 기반 CAR를 발현시키는 면역 세포의 정상 이펙터 기능들 중 적어도 하나의 활성화의 원인이 될 수 있다. 예를 들어, T 세포의 이펙터 기능은 사이토카인의 분비를 포함하는 세포독성 활성 또는 헬퍼 활성일 수 있다.
본 발명에서 사용되는 용어 "신호전달 도메인"은 면역 세포 내의 이펙터 기능 신호를 변환시키고 특별한 기능을 수행하기 위해 세포를 유도하는 단백질의 일부를 의미할 수 있다.
세포내 신호전달 도메인은 TCR제타, FcR감마, FcR베타, FcR엡실론, CD3감마, CD3델타, CD3엡실론, CD3제타, CD5, CD22, CD79a, CD79b 및 CD66d으로 이루어진 군으로부터 선택된 하나 이상을 포함하는 것일 수 있다.
세포내 신호전달 도메인은 OX40 도메인, CD2 도메인, CD27 도메인, CD28 도메인, CDS 도메인, ICAM-1 도메인, LFA-1 도메인 및 4-1BB 도메인으로 이루어진 군으로부터 선택된 하나 이상을 포함하는 것일 수 있다.
세포내 신호전달 도메인은 CD28 도메인, 4-1BB 도메인, 및 CD3 제타 도메인으로 이루어진 군으로부터 하나 이상을 포함할 수 있으며, 바람직하게는 CD28 도메인 및 CD3 제타 도메인, 또는 4-1BB 도메인 및 CD3 제타 도메인을 포함할 수 있다.
CD28 도메인은 서열번호 10의 아미노산 서열 또는 이와 적어도 70%, 바람직하게 적어도 80%, 더욱 바람직하게 적어도 90%, 95%, 97% 또는 99% 서열 동일성을 갖는 아미노산 서열을 포함할 수 있다.
4-1BB 도메인은 서열번호 11의 아미노산 서열 또는 이와 적어도 70%, 바람직하게 적어도 80%, 더욱 바람직하게 적어도 90%, 95%, 97% 또는 99% 서열 동일성을 갖는 아미노산 서열을 포함할 수 있다.
CD3 제타 도메인은 서열번호 12의 아미노산 서열 또는 이와 적어도 70%, 바람직하게 적어도 80%, 더욱 바람직하게 적어도 90%, 95%, 97% 또는 99% 서열 동일성을 갖는 아미노산 서열을 포함할 수 있다.
폴리뉴클레오티드 및 벡터
본 발명은 모노바디 기반 CAR를 코딩하는 핵산 서열을 포함하는 폴리뉴클레오티드, 또는 이러한 핵산 서열 또는 폴리뉴클레오티드를 포함하는 벡터에 관한 것일 수 있다. 여기서 벡터는 발현 벡터를 의미할 수 있다.
폴리뉴클레오티드는 서열번호 2의 핵산 서열을 포함할 수 있다. 폴리뉴클레오티드는 서열번호 2의 핵산 서열과 적어도 70%, 바람직하게 적어도 80%, 더욱 바람직하게 적어도 90%, 95%, 97% 또는 99% 서열 동일성을 가지는 핵산 서열을 포함할 수 있다.
폴리뉴클레오티드는 서열번호 1 내지 6 중 하나 이상의 핵산 서열을 포함할 수 있으며, 또는 서열번호 1 내지 6의 핵산 서열과 적어도 70%, 바람직하게 적어도 80%, 더욱 바람직하게 적어도 90%, 95%, 97% 또는 99% 서열 동일성을 가지는 각각의 핵산 서열을 하나 이상 포함할 수 있다.
모노바디 기반 CAR를 코딩하는 핵산 서열은 인간 세포에서의 발현을 위해 코돈-최적화된 것일 수 있다.
본 발명에 사용된 "벡터"는 숙주 세포 내에 1개 이상의 관심 유전자(들) 또는 서열(들)을 전달할 수 있는, 바람직하게는 이를 발현시킬 수 있는 구축물을 의미할 수 있다. 예를 들어, 바이러스 벡터, 네이키드 DNA 또는 RNA 발현 벡터, 플라스미드, 코스미드 또는 파지 벡터, 양이온성 축합제와 회합된 DNA 또는 RNA 발현 벡터, 리포솜 내에 캡슐화된 DNA 또는 RNA 발현 벡터, 및 특정 진핵 세포, 예를 들어 생산자 세포를 포함하나, 이에 제한되지는 않는다.
바이러스 벡터는 레트로바이러스, 아데노바이러스 파르보바이러스(예를 들어, 아데노 관련 바이러스), 코로나바이러스, 네거티브 가닥 RNA 바이러스, 예를 들어, 오르소-믹소바이러스(예를 들어, 인플루엔자 바이러스), 라브도바이러스(예를 들어, 광견병 및 수포성 구내염 바이러스), 파라믹소바이러스(예를 들어, 홍역 및 센다이), 포지티브 가닥 RNA 바이러스, 예를 들어 피노르나바이러스 및 알파바이러스, 및 아데노바이러스, 헤르페스바이러스(예를 들어, 헤르페스 심플렉스 바이러스 타입 1 및 2, 엡스테인-바르 바이러스, 시토메갈로바이러스), 및 폭스바이러스(예를 들어, 백시니아, 계두, 및 카나리아 두창)를 포함하는 이중 가닥 DNA 바이러스를 포함할 수 있다. 벡터로 사용될 수 있는 다른 바이러스는 예를 들어, 노워크 바이러스, 토가바이러스, 플라비바이러스, 레오바이러스, 파포바바이러스, 헤파드나바이러스, 및 간염 바이러스일 수 있다. 레트로바이러스의 예는 새의 백혈증 육종(avian leukosis-sarcoma), 포유동물 C-타입, B-타입 바이러스 D 타입 바이러스, HTLV-BLV 그룹, 렌티바이러스, 스푸마바이러스를 포함할 수 있다.
면역 세포를 조작하는 방법
본 발명은 면역 세포에 모노바디 기반 CAR을 도입하고, 상기 세포를 확대시키는 것을 포함하는 면역 치료를 위한 면역 세포를 제조하는 방법에 관한 것일 수 있다.
본 발명은 면역 세포를 제공하는 단계; 및 상기 면역 세포 내로 폴리뉴클레오티드를 도입하는 단계를 포함하는 면역 세포를 조작하는 방법에 관한 것일 수 있다.
본 발명은 면역 세포를 제공하고, 상기 세포의 표면에 모노바디 기반 CAR을 발현시키는 것을 포함하는 면역 세포를 조작하는 방법에 관한 것일 수 있다.
본 발명은 면역 세포를 모노바디 기반 CAR를 코딩하는 적어도 하나의 폴리뉴클레오티드로 변형시키고, 상기 폴리뉴클레오티드를 상기 세포로 발현시키는 것을 포함할 수 있다. 본 발명의 면역 세포를 제조 또는 조작하는 방법은 시험관내 또는 생체외 방법일 수 있다. 상기 폴리뉴클레오티드는 세포에서의 안정적인 발현을 위해 렌티바이러스 벡터에 포함될 수 있다.
조작된 면역 세포
본 발명은 상기 면역 세포의 제조 방법 또는 조작 방법에 의해 얻어질 수 있는 단리된 세포 또는 세포주에 관한 것일 수 있다. 여기서 단리된 세포는 모노바디 기반 CAR를 포함할 수 있다.
본 발명의 단리된 세포는 서로 다른 세포외 리간드 결합 도메인을 포함하는 CAR의 집단을 포함할 수 있다. 특히, 상기 단리된 세포는 CAR을 코딩하는 외인성 폴리뉴클레오티드 서열을 포함할 수 있다.
본 발명의 면역 세포는 선천성 및/또는 후천성 면역 반응의 개시 및/또는 실행에서 기능적으로 포함되는 조혈 기원의 세포를 의미할 수 있다. 본 발명의 면역 세포는 줄기 세포로부터 유래될 수 있다. 줄기 세포는 성인 줄기 세포, 비-인간 배아 줄기 세포, 비-인간 줄기 세포, 제대혈 줄기 세포, 전구 세포, 골수 줄기 세포, 유도다능성 줄기 세포, 전분화 줄기 세포 또는 조혈 줄기 세포일 수 있다.
본 발명의 면역 세포는 인간 CD3+ T 세포일 수 있다. 일 실시태양에서, 단리된 세포는 수지상 세포, 킬러 수지상 세포, 비만 세포, NK-세포, B-세포 또는 염증성 T-림프구, 세포독성 T-림프구, 조절 T-림프구 또는 헬퍼 T-림프구로 이루어진 군으로부터 선택된 T-세포일 수 있다. 일 실시태양에서, 상기 세포는 CD4+ T-림프구 및 CD8+ T-림프구로 이루어진 군으로부터 유래될 수 있다.
세포는 다양한 비제한적인 방법을 통해 피검체로부터 얻어질 수 있다. 세포는 말초혈 단핵 세포, 골수, 림프절 조직, 제대혈, 가슴샘 조직, 감염증 부위로부터의 조직, 복수, 흉막 삼출액, 비장 조직, 및 종양을 포함하는 다수의 비-제한적인 공급원으로부터 얻어질 수 있다.
통상의 기술자에게 이용 가능하고 알려진 임의의 T 세포주가 사용될 수 있다. 상기 세포는 건강한 기증자로부터, 암 진단을 받은 환자로부터, 또는 감염증 진단을 받은 환자로부터 유래될 수 있다. 상기 세포는 상이한 표현형 특징을 나타내는 세포의 혼합 집단의 일부일 수 있다. 전술된 방법에 따라 조작된 T 세포로부터 얻어진 세포주가 사용될 수 있으며, 본 발명에 따른 면역 세포는 면역억제 처리에 대해 내성을 가지는 것일 수 있다.
상기 면역 세포는 백혈구, 호중구, 호산구, 호염기구, 단핵구, 림프구, T 세포, 세포독성 T 세포, 자연살상 T 세포, 수지상세포, 또는 이들의 조합일 수 있으나, 이에 제한되는 것은 아니다.
모노바디 기반 CAR-면역 세포를 이용한 치료
모노바디 기반 CAR-면역 세포, 조작된 면역 세포 또는 이들 세포의 집단은 암을 예방 또는 치료하기 위한 약학적 조성물로 사용될 수 있다.
본 발명은 모노바디 기반 CAR-면역 세포 또는 조작된 면역 세포를 포함하는, 암을 예방 또는 치료하기 위한 약학적 조성물에 관한 것일 수 있다.
본 발명은 모노바디 기반 CAR-면역 세포를 이를 필요로 하는 대상체에 투여하는 단계를 포함하는, 이를 필요로 하는 대상체에서 암을 예방 또는 치료하는 방법에 관한 것일 수 있다.
본 발명은 암을 예방 또는 치료하기 위한 약제의 제조를 위한 모노바디 기반 CAR-면역 세포의 용도에 관한 것일 수 있다.
본 발명은 암을 예방 또는 치료하는 데 사용하기 위한 모노바디 기반 CAR-면역 세포일 수 있다.
본 발명에서 사용되는 용어 "대상체"는 포유동물, 보다 바람직하게는 인간이다. 포유동물은 가축, 애완 동물, 영장류, 말, 개, 고양이, 마우스 및 래트 등을 포함하나 이에 제한되지는 않는다.
본 발명에서 상기 치료는 자가 면역치료의 일부 또는 동종이계 면역치료 요법 중 일부일 수 있다. 자가(autologous)는 대상체를 치료하기 위해 사용되는 세포, 세포주 또는 세포의 집단이 상기 대상체로부터 또는 인간 백혈구 항원(HLA)과 양립 가능한 기증자로부터 수득된 것임을 의미할 수 있다. 동종이계(allogeneic)는 대상체를 치료하기 위해 사용되는 세포 또는 세포의 집단이 상기 대상체로부터 수득된 것이 아니라 기증자로부터 수득된 것을 의미할 수 있다.
암은 흑색종, 편평세포암종, 유방암, 두경부암, 갑상선암, 연부조직육종, 골육종, 고환암, 전립선암, 난소암, 방광암, 피부암, 뇌암, 혈관육종, 비만세포종, 백혈병, 림프종, 간암, 폐암, 췌장암, 위암, 신장암, 대장암, 조혈 종양 또는 이의 전이암일 수 있으며 이에 제한되지 않는다. 또한, 암은 비고형 종양 또는 고형암일 수 있다.
비고형 종양 또는 비고형암은 골수종, 림프종, 또는 백혈병일 수 있으나, 이에 제한되지는 않는다.
고형암은 췌장암, 전립선암, 난소암, 유방암, 자궁경부암, 피부암, 결장직장암, 신장암, 간암, 뇌암, 및 폐암으로 이루어진 군으로부터 선택된 하나 이상일 수 있으나, 이에 제한되지는 않는다.
하기 실시예는 단지 예시적 목적으로 제공되고, 어떠한 방식으로든 본 발명의 범주를 제한하지 않는다. 실제로, 본 발명에 제시되고 기재된 것에 더하여 본 발명의 다양한 변형이 상기 기재로부터 관련 기술분야의 통상의 기술자에게 명백할 것이고, 이는 첨부된 청구범위의 범위 내에 속한다.
기존 항암 면역 치료는 마우스기반 항체분자, 구체적으로 항체단편(scFv)에 의해 인간 암항원을 인식하고 결합한 후 다양한 사이토카인 분비 또는 주변 면역 세포들의 공격에 의해 암세포가 제거되는 혈액암 치료법으로 알려져 있지만, 동물기반 항체에 의한 부작용, scFv의 크기로 인해 조직내 낮은 침투력, 및 고형암의 경우 환자마다 다른 항원들을 발현하는 특성(Heterogeneity)으로 최소 2가지 이상의 항원을 동시에 인지할 수 있어야 하는 문제점을 가진다.
본 발명에서는 이러한 scFv의 단점을 보완하기 위하여 인간 피브로넥틴 FN3를 기반으로 한 모노바디를 키메라 항원 수용체의 세포외 리간드 결합 부위로 사용할 경우 우수한 고형암 예방 및 치료 효과를 갖는 점을 확인하였다.
[실시예 1]
모노바디 기반 키메라 항원 수용체를 발현하는 벡터의 제조
1. 재조합 렌티바이러스 벡터의 제조를 위한 준비
모노바디 기반 키메라 항원 수용체를 발현하는 재조합 플라스미드 벡터의 제조를 위해 다음의 균주 및 벡터를 준비하였다.
(1) 복제 대상이 되는 벡터
인간 EphA2에 특이적으로 결합하는 모노바디(이하 E1 모노바디)를 발현하는 핵산 서열(서열번호 2)을 포함하는 pETh-E1GSE1 벡터를 전남대학교 산학협력단 소속 홍영진 교수 연구팀으로부터 분양받아, 키메라 항원 수용체를 발현하는 벡터를 준비하였다. 구체적으로 발현 벡터는 인비트로젠사의 pLenti7.3/V5-DESTTM GatewayTM Vector를 이용하였으며, 상기 pLenti7.3/V5-DEST 벡터의 5' UTR과 3' UTR 사이에 CD8α 리더 서열-MSLN scFv-CD8 H&TM-CD28-CD3ζ 또는 CD8α 리더 서열-MSLN scFv-CD8 H&TM-4-1BB-CD3ζ로 구성되는 키메라 항원 수용체를 발현하는 핵산 서열을 포함하도록 하였다. 이렇게 두 개의 렌티바이러스 벡터를 준비하였다(pLenti7.3::CD8α 리더 서열-MSLN scFv-CD8 H&T-CD28-CD3ζ 벡터 및 pLenti7.3:: CD8α 리더 서열-MSLN scFv-CD8 H&T-4-1BB-CD3ζ 벡터).
재조합 플라스미드 벡터에서 모노바디 기반 키메라 항원 수용체를 구성하는 핵산 서열은 하기 표 1과 같다.
서열번호 서열이름 서열 내용
서열번호 1 CD8α signal sequence nucleotide ATGGCCCTGCCTGTGACAGCTTTGCTGCTGCCTCTGGCTCTGCTGCTGCATGCTGCTAGACCT Human CD8α의 신호서열 도메인 아미노산 서열(1-21, NCBI accession # NP_741969.1)을 코돈 최적화시킨 염기서열
서열번호 2 E1 monomer nucleotide GTTTCTGATGTTCCGAGGGACCTGGAAGTTGTTGCTGCGACCCCCACCAGCCTACTGATCAGCTGGTATTATCCGTTTTGTGCGTTTTATTACAGGATCACTTACGGAGAAACAGGAGGAAATAGCCCTGTCCAGGAGTTCACTGTGCCTCGTCCGTCTGACACTGCTACCATCAGCGGCCTTAAACCTGGAGTTGATTATACCATCACTGTGTATGCTGTCACGTGTCTGGGCTCGTATTCTCGCCCAATTTCCATTAATTACCGAACA -
서열번호 3 CD8α H&TM nucleotide ACCACCACACCAGCTCCACGGCCTCCAACACCAGCACCTACAATTGCCTCTCAGCCCCTGTCTCTGAGGCCAGAAGCTTGTAGACCTGCTGCAGGCGGAGCCGTGCATACCAGAGGACTGGATTTCGCCTGCGACATCTACATTTGGGCCCCTCTGGCTGGAACATGTGGCGTCCTGCTGCTGTCTCTCGTGATCACCCTGTACTGC Human CD8α의 힌지와 막통과단백질도메인 아미노산 서열(138-206, NCBI accession # NP_001139345.1)을 코돈 최적화시킨 염기서열
서열번호 4 CD28 nucleotide AGAAGCAAGAGAAGCCGGCTGCTGCACAGCGACTACATGAACATGACCCCTAGACGGCCCGGACCTACCAGAAAGCACTACCAGCCTTACGCTCCTCCTCGGGACTTTGCCGCCTATAGATCC CD28 유래의 세포 내 신호전달 도메인 아미노산 서열 (83-123, NCBI accession # NP_001230006.1)을 최적화시킨 염기서열
서열번호 5 4-1BB nucleotide AAGCGGGGCAGAAAGAAGCTGCTGTACATCTTCAAGCAGCCCTTCATGCGGCCCGTGCAGACCACACAAGAGGAAGATGGCTGCTCCTGCAGATTCCCCGAGGAAGAAGAAGGCGGCTGCGAGCTG 4-1BB 유래의 세포 내 신호전달 도메인 아미노산 서열 (214-255, NCBI accession # NP_001552.2)을 최적화시킨 염기서열
서열번호 6 CD3ζ nucleotide AGAGTGAAGTTCTCTAGATCTGCCGACGCTCCTGCCTACCAGCAGGGACAGAATCAGCTGTACAACGAGCTGAATCTGGGGCGCAGAGAAGAGTACGACGTGCTGGATAAGAGAAGAGGCAGAGATCCCGAGATGGGCGGCAAGCCCCAGAGAAGAAAGAATCCCCAAGAGGGCCTGTATAATGAGCTGCAGAAAGACAAGATGGCCGAGGCCTACAGCGAGATCGGAATGAAGGGCGAACGCAGAAGAGGAAAGGGCCACGACGGACTGTATCAGGGCCTGAGCACAGCCACCAAGGATACCTATGATGCCCTGCACATGCAGGCCCTGCCACCTAGG CD3ζ 유래의 세포 내 신호전달 도메인 아미노산 서열(60-172, NCBI accession# XP_011508446.1)을 최적화시킨 염기서열
상기 표 1의 핵산 서열은 면역 세포 내에서 발현되어 하기 표 2의 아미노산 서열로 이루어진 모노바디 기반 키메라 항원 수용체가 세포 표면 막에 발현될 수 있다.
서열번호 서열이름 서열 내용
서열번호 7 CD8α signal sequence amino acid MALPVTALLLPLALLLHAARP 서열번호 1에 대응하는 아미노산 서열(1-21 아미노산서열, NCBI accession # NP_741969.1)
서열번호 8 E1 monomer amino acid VSDVPRDLEVVAATPTSLLISWYYPFCAFYYRITYGETGGNSPVQEFTVPRPSDTATISGLKPGVDYTITVYAVTCLGSYSRPISINYRT 서열번호 2에 대응하는 아미노산 서열
서열번호 9 CD8α H&TM amino acid TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYC 서열번호 3에 대응하는 아미노산 서열(138-206, NCBI accession # NP_001139345.1)
서열번호 10 CD28 amino acid RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS 서열번호 4에 대응하는 아미노산 서열(83-123, NCBI accession # NP_001230006.1)
서열번호 11 4-1BB amino acid KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL 서열번호 5에 대응하는 아미노산 서열(214-255, NCBI accession # NP_001552.2)
서열번호 12 CD3ζ amino acid RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 서열번호 6에 대응하는 아미노산 서열(60-172, NCBI accession# XP_011508446.1)
(2) 벡터 복제를 위한 세포의 준비
pETh-E1GSE1 벡터를 위한 숙주 세포: E. coli DH5α(F- endA1 glnV44 thi-1 recA1 relA1 gyrA96 deoR nupG purB20 φ80dlacZΔM15 Δ(lacZYA-argF)U169, hsdR17(rK-mK+), λ-)
p렌티바이러스 벡터를 위한 숙주 세포: E. coli Stbl3(F-mcrB mrrhsdS20(rB-, mB-) recA13 supE44 ara-14 galK2 lacY1 proA2 rpsL20(StrR) xyl-5 λleumtl-1), InvitrogenTM
상기 숙주 세포를 LB(Luria-Bertani) 고체 배지(Difco Laboratories사, USA)를 사용하여 37 ℃ 200 rpm 조건 하에 배양하였으며, 모든 배지에는 100 μg/ml 카나마이신 또는 앰피실린을 첨가하여 숙주 세포를 준비하였다. 이후 배양된 각 숙주세포의 단일 콜로니를 LB 액체 배지(Difco Laboratories사, USA)에 접종하여 전 배양하고, 이를 SOB(Super Optimal Broth) 배지에 1 % 접종하여 18 ℃에서 24 시간 배양한 후 Inoue TB 버퍼로 세척하여 준비하였다.
(3) 벡터 대량 생산을 위한 형질 전환 세포의 제조
상기 준비한 각각의 벡터들과 숙주 세포를 혼합한 후, 얼음에 10 분간 정치하고 42 ℃에서 90초, 얼음에서 3 분간 처리하여 각 벡터가 도입된 형질 전환 세포를 제조하였다. 상기 제조된 형질 전환 세포를 항생제가 포함된 상기 LB 고체 배지에 도말한 후 37 ℃에서 배양하였다. 이를 통해 각 벡터를 대량으로 준비하였다.
2. E1 모노바디-키메라 항원 수용체를 발현하는 재조합 렌티바이러스 벡터의 제조
상기 준비된 두 개의 렌티바이러스 벡터(pLenti7.3::CD8α 리더 서열-MSLN scFv-CD8 H&T-CD28-CD3ζ 벡터 및 pLenti7.3:: CD8α 리더 서열-MSLN scFv-CD8 H&T-4-1BB-CD3ζ 벡터)에서 scFv 서열을 제외한 렌티바이러스 벡터를 제조하였다. 먼저 2 종류의 벡터를 주형으로 하여, 하기 표 3의 CPL-F 프라이머, CPL-R 프라이머, 및 CloneAmp HiFi PCR 프리믹스(Takara사)를 이용하여 인버스 PCR을 수행하였다. 이렇게 증폭된 벡터를 분리 및 정제하여 2 종류의 MSLN scFv-free 키메라 항원 수용체 벡터를 준비하였다.
E1 모노바디 서열은 pETh-E1GSE1 벡터를 하기 표 3의 E1-F 프라이머 및 E1-R 프라이머를 이용하여 PCR을 수행하여 증폭한 후, 분리 및 정제하여 준비하였다.
서열번호 서열이름 서열 내용
서열번호 13 CPL F ACCACCACACCAGCTCC 플라스미드 선형화 및 ScFv 서열 제거
서열번호 14 CPL R AGGTCTAGCAGCATGCAG 플라스미드 선형화 및 ScFv 서열 제거
서열번호 15 E1 F CATGCTGCTAGACCTGTTTCTGATGTTCCGAGGGAC E1 monomer, E1 dimer 증폭
서열번호 16 E1 R AGCTGGTGTGGTGGTTGTTCGGTAATTAATGGAAATTGGGC E1 monomer, E1 dimer 증폭
준비된 벡터 및 E1 모노바디 서열을 Overlap cloner DNA cloning kit(Elpisbio사)를 사용하여 상동 재조합(homologous recombination) 방법을 통해 scFv 서열이 존재하던 부위에 E1 모노바디 서열을 삽입하여, E1 모노바디를 포함하는 키메라 항원 수용체를 발현하는 재조합 렌티바이러스 벡터(pLenti7.3-EphA2 모노바디 키메라 항원 수용체 벡터)를 제조하였다. 제조된 재조합 렌티바이러스 벡터를 각각 EphA2 mCAR-1와 EphA2 mCAR-2로 명명하고 그 구조를 도 1에 나타내었으며, 상기 벡터 제조방법의 모식도를 도 2a 및 2b에 나타내었다.
[실시예 2]
E1 모노바디-키메라 항원 수용체를 세포막 표면에 발현하는 면역 세포의 제조(VEC-1 및 VEC-2) 및 평가
1. 재조합 렌티바이러스 벡터를 포함하는 렌티바이러스의 제조
실시예 1에서 제조한 EphA2 mCAR-1 및 EphA2 mCAR-2를 포함하는 렌티바이러스를 준비하였다.
2. 면역 세포의 준비 및 바이러스 감염을 통한 형질 도입
(1) PBMC로부터 CD3+ T 세포의 분리
인간 공여자 혈액으로부터 말초혈 단핵세포(PBMC)를 림포프렙(LymphoprepTM, STEMCELL)으로 분리하였다. 이후 CD3 마이크로비드(Miltenyi Biotech사)를 이용하여 양성 선택(Positive selection) 방법으로, 분리된 PBMC로부터 인간 CD3+ T 세포를 분리하였다.
(2) CD3+ T 세포의 활성화
항-CD3/항-CD28 마그네틱 비드(anti-CD3/CD28 Dynabead; Gibco사)와 분리된 인간 CD3+ T 세포를 1:1으로 혼합하였다. 혼합 24시간 후 활성화 마그네틱 비드를 MACSiMAG 세퍼레이터 기구를 이용하여 제거하였다. 이후 RPMI-1640을 이용하여 세포를 세척하였다.
(3) 렌티바이러스로의 형질도입
폴리브렌(polybrene, Sigma Aldrich사)을 이용한 바이러스 감염 방법으로 렌티바이러스로 감염된 T 세포를 제조하였다. 구체적으로 활성화된 인간 CD3+ T 세포에 EphA2 mCAR-1 및 EphA2 mCAR-2를 각각 포함하는 렌티바이러스를 감염 시키고, 24 시간 후에 바이러스 배지를 교체하였다. 감염 48 시간 이후부터 세포의 증식이 시작된다. 이렇게 제조한 조작된 면역 세포를 각각 VEC-1 및 VEC-2로 명명하였다(각각 EphA2 mCAR-1 및 EphA2 mCAR-2를 포함). 모노바디 기반 키메라 항원 수용체가 세포막 표면에 발현된 구조를 도 3에 나타내었다.
3. 조작된 면역 세포의 평가
상기에서 제조된 VEC-1 및 VEC-2 면역 세포에서 도입한 EphA2 mCAR-1 및 EphA2 mCAR-2 벡터가 제대로 발현되는지 여부와, 이러한 면역 세포의 활성 상태를 FACS(Fluorescence-activated cell sorting)를 이용하여 확인하였다.
실험에는 Attune NxT 유세포 분석기(Thermo Fisher Scientific사)를 사용하였다. 각 면역 세포에 대해 항 GFP(Green Fluorescent Protein; 녹색 형광 단백질) 항체를 이용하여 도입된 벡터의 발현여부를 확인하였다. 해당 벡터에는 GFP 발현 부위가 함께 존재하므로 이러한 벡터를 많이 발현하는 면역 세포에서는 항 GFP 항체에 의한 분석 결과가 높게 측정될 것이다. 또한 항 CD25-PE항체(PE Mouse Anti-Human CD25, BD PharmingenTM)와 항 CD69-APC항체(APC Mouse Anti-Human CD69, BD PharmingenTM)로 T 세포로의 활성화여부를 확인하였다.
도입된 벡터(즉 E1 모노바디-키메라 항원 수용체 서열)의 발현율을 FACS로 비교 분석한 결과, 벡터를 도입하지 않는 대조군에 비해 VEC-1 면역 세포는 약 40%의 발현율을 나타내고 VEC-2 면역 세포는 약 30%의 발현율을 나타내었다(도 4 참조). 이러한 결과로부터 면역 세포에 도입된 벡터가 잘 발현되는 것을 확인할 수 있으며, 조작된 면역 세포 VEC-1 및 VEC-2 내에서 E1 모노바디-키메라 항원 수용체가 제대로 발현되는 것을 확인할 수 있었다.
또한 조작된 면역 세포 VEC-1 및 VEC-2에서는 세포 성장 활성 마커인 CD25가 대조군과 유사하게 발현되는 것을 확인할 수 있었고, 세포 독성 T 세포의 활성 마커인 CD69가 대조군에 비해서 더 많이 발현되는 것을 확인할 수 있었다(도 5 참조). 따라서 VEC-1 및 VEC-2는 모두 활성 상태임을 확인하였다.
[실시예 3]
시험관 내 암세포 살해능 평가
E1 모노바디-키메라 항원 수용체를 발현하는 조작된 면역 세포 VEC-1 및 VEC-2의 EphA2 특이적 암항원에 대한 항암능력을 평가하기 위하여, EphA2를 발현하는 암세포(난소암세포주 OVCAR-3; 췌장암세포주 CAPAN-2 및 AsPC-1; 전립선암세포주 PC-3, MSI-H 위암세포주 SNU638 및 MSI-H 대장암세포주 DLD1, Lovo, HCT8, HCT15, 도 6 참조)와 E1 모노바디 CAR-T 세포(즉 VEC-1 및 VEC-2 세포)를 공 배양하고 조작된 면역 세포의 암세포 살해능을 측정하였다(도 7, 도 8 참조).
(1) 한국세포주은행(Korean Cell Line Bank)으로부터 난소암세포주 OVCAR-3; 췌장암세포주 Capan-2 및 AsPC-1; 및 전립선암세포주 PC-3; 위암세포주 SNU638, 대장암세포주 DLD1, LoVo, HCT-8, HCT-15를 구입하여 사용하였다.
이러한 세포주에서 EphA2가 발현되는지 여부를 확인하기 위하여 항 EphA2 항체를 사용하여 EphA2 항원의 발현여부 및 발현정도를 FACS로 분석하였다. 그 결과 이러한 암세포주는 모두 EphA2를 높은 정도로 발현하는 것을 확인하였으며(도 6 참조), 이를 이용하여 EphA2를 타겟으로 하는 E1 모노바디 CAR-T 세포의 암세포 살해능을 확인할 수 있을 것이다.
(2) 상기에서 EphA2 항원의 발현이 확인된 암세포주들을 각 웰에 1x104 개씩 96 웰 플레이트에 시딩하고 BSC에 30분간 둔 후, 암세포들을 37℃ 5% CO2조건으로 세포배양기에서 24시간 배양하였다. 이후 각 웰 당 4x104 개의 E1 모노바디 CAR-T 세포(즉 VEC-1 및 VEC-2 세포)를 처리하고 72 내지 90 시간 동안 공 배양하면서 RTCA로 세포들의 생존 여부 및 세포 운동 활동을 아래와 같이 분석하였다.
(3) RTCA(xCELLigence, ACEA Biosciences, Inc.)에 의한 운동학 분석
마이크로타이터 플레이트(E-Plate) 웰(well)의 바닥 표면에 부착된 골드 미세전극(gold microelectrodes)을 바이오 센서로 사용하였다. 전기 전도성 용액(예: 완충액 또는 표준 조직 배양 배지)에 담그고 이러한 전극(바이오 센서 양단)에 전위를 인가하면 전자가 음극 단자를 떠난다. 이 전자는 벌크 용액을 통과하고 양극 단자에 증착되어 회로를 완성한다. 전극-용액 계면에 부착 세포가 있으면 전자 흐름의 방해를 받는데, 벌크 용액과 바이오 센서의 상호 작용에 따라 신호가 달라지기 때문이다. 따라서 세포가 자라는 동안 발생하는 임피던스라는 저항값을 측정하여 다양한 세포 반응(세포 수, 증식속도, 세포크기, 세포모양 및 기질 부착 품직의 변화)을 운동학(kinetic)으로 자동 측정할 수 있게 된다. 세포에 의해 감지된 저항값은 Cell Index(CI)라는 지표로 나타나게 되고, CI 값의 변화는 세포의 모양 변화를 보여준다.
(4) 형질도입된 E1 모노바디 CAR-T 세포(VEC-1 또는 VEC-2)와 형질도입 되지 않은 인간 T 세포(대조군)들의 암세포에 대한 살해능을 비교하여 분석한 결과, VEC-1과 VEC-2의 살해능이 대조군보다 훨씬 증가(20~100%)하는 것을 RTCA에 의한 분석을 통해 확인하였다(도 7 참조). 이러한 결과로부터 본 발명에 따른 조작된 면역 세포가 우수한 암세포 살해능을 갖는 것을 알 수 있다.
(5) 3D 공배양법을 이용한 E1 모노바디 CAR-T(VEC-1) 면역세포의 암세포 살해능을 대조군과 비교하여 평가하였다.
1 x 103 세포수로 전립선암세포(PC-3)를 96웰 플레이트(96 well plate)에 심은 후 3일간 배양 후 형성된 구형(sphere)에 2 x 103 세포수의 VEC-1을 배지에 넣어 공배양한 후, Sartorius사의 IncuCyte® S3 Live-Cell Analysis System을 이용하여 cytotoxic-T세포 대조군(Control-T)과 VEC-1의 암세포 살상능력을 비교하여 분석한 결과, 대조군보다 앞서 VEC-1이 공배양 58분후부터 전립선암세포주(PC-3) 구형구조물 내로 침투하여 구형의 구조를 파괴하고 세포주들에 대한 살해가 진행되는 것이 관찰되었다. 공배양 14시간 58분에는 VEC-1이 전립선암세포(PC-3)의 구형(sphere)구조를 완전히 소멸시킴이 관찰되는 반면에 cytotoxic-T세포 대조군은 구형구조의 형태를 파괴함이 없이 구형을 유지한 채 구형형태중앙에서 관찰되었다(도 8 참조).
[실시예 4]
이종이식 마우스 모델에서 면역 세포의 항종양능 평가
모든 동물실험은 생명윤리위원회(IACUC, 전남대학교, 대한민국)의 승인을 받아 진행하였다. 4 주령 암컷 NSG(NOD SCID gamma) 마우스는 화순 백신센터 SPF 동물실험실로부터 공급받았다.
췌장암 세포 AsPC-1/luc은 PBS(Welgene사)와 고농도 마트리겔(Corning사)를 1:1로 섞은 용액에 4 x 106 cells/200ul ~ 8x 106 cells/200ul 농도로 부유되었다. PC-3 세포는 PBS(Welgene사)와 고농도 마트리겔(Corning사)을 1:1로 섞은 용액에 3 x 106 cells/100ul ~ 1 x 107 cells/100ul 농도로 부유되었다. 실험에서는 마우스의 오른쪽 옆구리에 AsPC-1/luc(2 x 106 cells), PC-3(3 x 106 cells)를 피하 주사하였다.
종양의 크기가 100 ~ 150 mm3에 도달하였을 때, 준비된 PBS, 대조군 T 세포, VEC-1, VEC-2 면역 세포 1 x 107/200ul을 정맥내 1회 주사하였다. 마우스는 그룹별 5~10 마리를 사용하였으며, 종양의 크기와 마우스 몸무게는 1주일에 2번 측정하였다.
1. 세포해동(Cell thawing) 및 세포배양(Cell culture)
실험재료: RPMI 1640(Gibco사), FBS(Gibco사), P/S(Gibco사), L-글루타민 200mM(Gibco사), 100∮ 세포배양 플라스크, 바스켓, 종양 세포주(AsPC-1 및 PC-3), Solution 18 AO·DAPI(ChemoMetec사), PBS(Welgene사), TrypLETM(Gibco사). 인간 췌장암 세포주 AsPC-1과 인간 전립선암 세포주 PC-3는 ATCC(American Type Culture Collection)로부터 공급받아 사용하였다. 루시퍼레이즈를 발현하는 인간 췌장암 세포주 AsPC-1/luc은 JCRB(Cell bank, Austrailia)로부터 공급받아 사용하였다.
세포해동: 액체질소 탱크에서 종양 세포주를 37℃ 항온수조에 넣고 빠르게 녹인 후, 살얼음이 떠있을 때, 클린벤치로 가서 15 mL 원뿔모양 튜브에 넣었다. 세포배양배지(RPMI 1640 + 10 % FBS + 1% P/S +2mM L-글루타민) 9 mL을 15 ml 튜브에 넣고 350g, 3분 조건으로 원심 분리하였다. 상층액을 제거하고 1 mL의 세포 배양액을 넣고 완전히 재부유 시킨 후 9 mL 세포 배양액을 넣어서 10 mL을 맞춰 재부유 시켰다. 세포수 카운트 용액(PBS: Solution 18 = 90 : 5)을 이용하여 세포수를 계산하여 세포 밀도를 0.5 x 106 /10 mL 및 1 x 106 /10 mL(각각 PC-3 및 AsPC-1에 대해)으로 맞춰서 100∮ 플라스크에 세포를 깔아주었다. 이후 3 일 간격으로(세포밀도가 70~80 % 될 경우) 계대배양하였다.
계대배양: 플라스크에 있는 상층액을 제거한 후, 10 mL의 PBS를 넣어서 세포 찌꺼기 등의 불순물을 제거하도록 씻은 후 상층액을 버렸다. 세포를 플라스크에서 떼어내기 위해 TrypLETM(2 mL 또는 4 mL)를 각각 100∮ 및 150∮ 플라스크에 넣었다. 현미경으로 관찰하여 세포가 동그란 형태를 띠며 부유하면 10 mL 또는 30 mL 세포 배양 배지(RPMI 1640 + 10 % FBS + 1% P/S +2mM L-글루타민)를 넣어 세포들을 50ml 원뿔모양 튜브에 담아 500g, 3 내지 5 분간 원심분리하였다. 상층액을 제거한 후 1 mL 세포 배양액을 넣어 재부유 시킨후 9 mL의 세포배양액을 넣었다. 세포수 카운트 용액(PBS : Solution 18 = 90 : 5)을 이용하여 세포수를 측정한 후 암세포(예를 들면, 췌장암세포 AsPC-1: 1x106/10 mL)를 배양용기에 넣어 배양하였다.
2. 마우스 준비
실험재료: PICO 5053(오리엔트 바이오), g-irradiated 18 % beta-chip(오리엔트 바이오), 멸균된 수돗물과 물병, 고압증기 멸균기, 클리퍼(정도비앤피), 물티슈, 아이프란액(하나제약), 제모제(veet), 호흡마취 기계 및 챔버
실험방법: 일주일에 두 번씩 사료(PICO 5053), 깔짚(r-irradiated 18 % 베타-칩), 멸균된 수돗물, 케이지를 교체하였다. 털은 종양을 심기 3일 전에는 제거를 해주며, 실험 중에는 종양이 잘 안보일만큼 자랐을 경우 제거하였다. 마우스는 이소플루란의 농도가 2~3 % 되도록 하여 호흡 마취시켜 마우스의 오른쪽 옆구리 털을 클리퍼로 제거하고 제모제를 바르고 1분정도 두고, 물티슈로 제모제를 닦아주었다.
3. 인간 종양 이종 이식 마우스 모델 제조
실험재료: 세포, 1 ml 주사기(한국백신사), 25 ½ G 바늘(한국백신사), 고농도 마트리겔(Corning사), 아이스박스, EP 튜브, 호흡마취 기계 및 챔버, 아이프란액(하나제약사). 마트리겔의 경우 이종 이식 하루 전날 냉장실에서 오버나잇 하였다. 마트리겔은 상온에서 젤화가 되기 때문에 항상 얼음에 꽂아서 실험 진행하였다.
실험방법: 2~3% 이소플루란으로 호흡마취 시킨 마우스의 오른쪽 옆구리에 AsPC-1/luc(2 x 106 cells) 및 PC-3(3 x 106 cells)와 마트리겔이 1:1로 섞인 용액 100 ul를 피하 주사하였다. 또한 마우스 복강에 각각 종양 세포주(4 x 106 cells/100ul의 PBS)와 matrigel이 1:1로 섞인 용액 100 ul를 피하 주사하였다.
4. 키메라 항원 수용체 T 세포 주입
실험재료: 27 ½ G 바늘(정림사), 1ml 주사기(한국백신사), PBS, 정상 T 세포(대조군), E1 모노바디 CAR-T 세포(VEC-1 및 VEC-2), 마우스 보정기(정도비앤피사), 열 조사기(정도비앤피사), 70 % 알콜솜, 버니어 캘리퍼(정도비앤피사), 체중계, 카메라.
실험방법: 마우스의 종양 크기 및 체중을 측정하여 그룹별로 마우스의 종양 크기 및 체중을 비슷하게 조절하였다. 종양의 크기가 100 ~ 150 mm3에 도달하였을 때, 200 ul의 PBS와 세포(1 x 107/200ul의 대조군 정상 T 세포 및 E1 모노바디 CAR-T 세포)를 마우스의 꼬리 정맥에 정맥내 주사하였다.
5. 마우스 모니터링(종양 크기 및 체중 측정)
실험재료: 호흡마취 기계 및 챔버, 아이프란액(하나제약사), 버니어 캘리퍼(정도비앤피사), 체중계, 카메라.
실험방법: 마우스를 2~3 % 이소플루란으로 호흡 마취시킨 후 일주일에 두 번 종양크기와 체중을 측정하였다. 마우스 종양의 크기는 버니어 캘리퍼로 장축(L), 단축(W), 및 높이(H)를 측정한 후 0.52를 곱하여 계산하며, 전자 저울을 사용하여 마우스의 체중을 측정하였다.
6. 실험 결과
(1) 전립선암 세포주를 이용한 실험
전립선암 세포주(PC-3) 1 x 107 cells/100ul 및 1 x PBS를 마우스 오른쪽 등 피하조직에 이종이식 한 마우스 모델에 종양 생성 12일 후, 각 그룹 별로 PBS, 대조군 T 세포(바이러스로 형질도입 하지 않은 활성화된 대조군 정상 T 세포; Cont-T), VEC-1 세포 및 VEC-2 세포를 정맥 내 주사한 후 종양크기를 스케일바로 측정하여 그 결과를 도 9에 나타내었다.
도 9에 나타낸 바와 같이, VEC-1 또는 VEC-2를 주입한 마우스에서 종양 생성 22일 이후부터는 대조군 정상 T 세포 또는 PBS만 주입한 마우스보다 종양의 크기가 현저히 감소하였다.
E1 모노바디 CAR-T 세포를 정맥 투여한 후 마우스의 몸 상태 회복 여부 및 투여에 따른 부작용 여부를 파악하기 위해 마우스의 몸무게를 측정하여 그 결과를 도 10에 나타내었다.
도 10에 나타낸 바와 같이, VEC-1 또는 VEC-2를 투여한 마우스가 대조군 정상 T 세포를 투여한 마우스보다 건강 상태가 빠르게 회복되었고, 그 다음 정상 T 세포가 30일 이후 회복세를 보이기 시작했으며, PBS만을 넣은 마우스는 종양 크기에 비례하여 지속적으로 몸무게가 감소하면서 건강 상태가 악화되었다.
실험의 종료시점(50일)에서의 전립선암 이종이식 마우스모델들의 생존율을 카플란-마이어 공식을 통해 평가하여 그 결과를 도 11에 나타내었다. 도 11에 나타낸 바와 같이, VEC-1과 VEC-2를 투여한 마우스 그룹은 모두 높은 생존율을 보였으며, 이는 대조군 정상 T 세포에 비해 월등하게 우수하였다.
마우스의 오른쪽 등에 종양을 심은지 44일 후, E1 모노바디 CAR-T 세포(VEC-1 또는 VEC-2)를 정맥주사한 후 28일째에 종양의 크기를 측정하여 그 결과를 도 12에 나타내었다. 도 12에 나타낸 바와 같이, VEC-1 또는 VEC-2를 투여한 마우스 그룹에서는 종양이 정상 T 세포를 투여한 마우스 및 PBS만을 투여한 마우스 그룹에 비하여 현저히 작은 것을 확인하였다.
(2) 췌장암 세포주를 이용한 실험
췌장암 세포(AsPC-1, 2 x 106 개 세포)를 마우스 복강 내에 이식하고, 14일 후 PBS, 정상 T 세포, VEC-1 및 VEC-2를 복강내 투여하였다. 투여 후 4주차에 생체 내 이미징 시스템(In Vivo Imaging System; IVIS)을 이용하여 췌장암 세포의 전이 정도를 촬영하여 그 결과를 도 13에 나타내었다. 도 13에 나타낸 바와 같이, 정상 T 세포와 PBS만을 투여한 마우스와 비교하여 VEC-1 및 VEC-2를 투여한 마우스에서는 종양이 거의 증식 또는 전이되지 않는 것을 확인하였다.
마우스의 복강 내에 2 x 106 개의 췌장암 세포를 이식하고 14일 후 PBS, 정상 T 세포(Con T), VEC-1 및 VEC-2를 복강내 투여하고 바이오루미네선스 이미징(Bioluminescence Imaging; BLI)로 종양의 크기를 측정하여 그 결과를 도 14에 나타내었다. 도 14에 나타낸 바와 같이, 정상 T 세포를 투여한 마우스와 PBS만을 투여한 마우스에 비하여, VEC-1 또는 VEC-2를 투여한 마우스에서는 종양이 거의 증식하지 않았으며 이는 췌장암 세포 이식 후 4주차까지 계속 유지되었다.
본 발명에 따른 모노바디 기반 키메라 항원 수용체 및 이를 세포막 표면에 발현하는 면역 세포(예: 세포독성 T 세포)는 전립선암 및 췌장암 세포의 증식을 현저히 억제하고 마우스의 생존율을 현저히 증가시키는 우수한 항암 효과를 갖는 것을 알 수 있다. 따라서, 모노바디 기반 키메라 항원 수용체를 포함하는 면역 세포를 이용하여 고형암을 비롯한 다양한 암을 예방 또는 치료할 수 있다.

Claims (16)

  1. 모노바디를 포함하는 세포외 리간드 결합 도메인을 포함하는 모노바디 기반 키메라 항원 수용체.
  2. 제1항에 있어서, 상기 모노바디는 CRL1, 에프린 수용체, EphA2, β-갈락토시데이스, RAS, Abl 키네이스, VEGFR2, MBP, SARS-CoV-2, Bcr-Abl 키네이스, STAT3, EGFR, VEGFR2, 인간 Lyn 티로신 키네이스의 SH3 도메인, MLKL, Fluc 동종체(homologues), 미토겐-활성 단백질 키네이스(MAPK), ERK2, MAPK14, 키네이스 SH2 도메인, SUMO, AurA, WDR5, Fluc 패밀리, GFP, SARS-CoV-2의 수용체 결합 도메인, FYN의 SH3 도메인, ABL의 SH2 도메인, SUMO1, Bcr-Abl, GPR56 ECR, PD-L1, 글리피칸-3, PCSK9, Gp41, CD4, 및 IL-23로 이루어진 군으로부터 선택된 단백질에 특이적으로 결합하는 것인 모노바디 기반 키메라 항원 수용체.
  3. 제2항에 있어서, 상기 모노바디는 에프린 수용체, EphA2, 또는 인간 EphA2에 특이적으로 결합하는 것인 모노바디 기반 키메라 항원 수용체.
  4. 제3항에 있어서, 상기 모노바디는 서열번호 8의 아미노산 서열을 포함하는 것인, 모노바디 기반 키메라 항원 수용체.
  5. 제1항에 있어서, 막관통 도메인; 및 세포내 신호전달 도메인으로 이루어진 군으로부터 선택된 하나 이상을 추가로 포함하는 것을 특징으로 하는, 모노바디 기반 키메라 항원 수용체.
  6. 제5항에 있어서, 상기 막관통 도메인은 T-세포 수용체 알파 사슬, T-세포 수용체 베타 사슬, T-세포 수용체 제타 사슬, CD8 알파 사슬, CD8 베타 사슬, CD28, CD3엡실론, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, 이들의 일부, 및 이들의 조합으로 이루어진 군으로부터 하나 이상 선택되는 것을 특징으로 하는 모노바디 기반 키메라 항원 수용체.
  7. 제5항에 있어서, 상기 세포내 신호전달 도메인은 TCR제타, FcR감마, FcR베타, FcR엡실론, CD3감마, CD3델타, CD3엡실론, CD3제타, CD5, CD22, CD79a, CD79b 및 CD66d으로 이루어진 군으로부터 하나 이상 선택되는 것을 특징으로 하는 모노바디 기반 키메라 항원 수용체.
  8. 제5항에 있어서, 상기 세포내 신호전달 도메인은 OX40 도메인, CD2 도메인, CD27 도메인, CD28 도메인, CDS 도메인, ICAM-1 도메인, LFA-1 도메인 및 4-1BB 도메인으로 이루어진 군으로부터 하나 이상 선택되는 것을 특징으로 하는 모노바디 기반 키메라 항원 수용체.
  9. 제5항에 있어서, 힌지를 추가로 포함하는 것을 특징으로 하는, 모노바디 기반 키메라 항원 수용체.
  10. 제1항 내지 제9항 중 어느 한 항의 모노바디 기반 키메라 항원 수용체를 코딩하는 핵산 서열을 포함하는 폴리뉴클레오티드.
  11. 제10항에 따른 폴리뉴클레오티드를 포함하는 발현 벡터.
  12. 제1항 내지 제9항에 따른 모노바디 기반 키메라 항원 수용체를 세포 표면 막에서 발현하는 면역 세포.
  13. 제12항에 있어서, 상기 면역 세포는 백혈구, 호중구, 호산구, 호염기구, 단핵구, 림프구, T 세포, 세포독성 T 세포, 자연살상 T 세포, 수지상세포, 또는 이들의 조합인 것을 특징으로 하는 면역 세포.
  14. 제12항에 따른 면역 세포를 포함하는, 암을 예방 또는 치료하기 위한 약학적 조성물.
  15. 제14항에 있어서, 상기 암이 흑색종, 편평세포암종, 유방암, 두경부암, 갑상선암, 연부조직육종, 골육종, 고환암, 전립선암, 난소암, 방광암, 피부암, 뇌암, 혈관육종, 비만세포종, 백혈병, 림프종, 간암, 폐암, 췌장암, 위암, 신장암, 대장암, 조혈 종양 및 이의 전이암로 이루어진 군에서 하나 이상 선택된 것을 특징으로 하는, 암을 예방 또는 치료하기 위한 약학적 조성물.
  16. 제15항에 있어서, 상기 암이 췌장암, 전립선암, 또는 난소암인 것을 특징으로 하는 암을 예방 또는 치료하기 위한 약학적 조성물.
PCT/KR2022/007379 2021-05-25 2022-05-24 모노바디 기반 키메라 항원 수용체 및 이를 포함하는 면역 세포 WO2022250431A1 (ko)

Priority Applications (2)

Application Number Priority Date Filing Date Title
EP22811624.0A EP4349857A1 (en) 2021-05-25 2022-05-24 Monobody-based chimeric antigen receptor and immune cell including same
CN202280037489.2A CN117693519A (zh) 2021-05-25 2022-05-24 基于单体拟抗体的嵌合抗原受体和包含其的免疫细胞

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2021-0067276 2021-05-25
KR20210067276 2021-05-25

Publications (1)

Publication Number Publication Date
WO2022250431A1 true WO2022250431A1 (ko) 2022-12-01

Family

ID=84228821

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/007379 WO2022250431A1 (ko) 2021-05-25 2022-05-24 모노바디 기반 키메라 항원 수용체 및 이를 포함하는 면역 세포

Country Status (4)

Country Link
EP (1) EP4349857A1 (ko)
KR (1) KR20220159289A (ko)
CN (1) CN117693519A (ko)
WO (1) WO2022250431A1 (ko)

Citations (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20070107721A (ko) 2005-02-04 2007-11-07 레이븐 바이오테크놀로지스, 인코퍼레이티드 Ｅｐｈａ2에 결합하는 항체 및 그것의 사용방법
KR101521668B1 (ko) 2007-08-30 2015-05-28 다이이찌 산쿄 가부시키가이샤 항ｅｐｈａ２ 항체
KR101528939B1 (ko) 2006-07-18 2015-06-15 사노피 암 치료를 위한 ｅｐｈａ2에 대한 길항제 항체
WO2015157252A1 (en) 2014-04-07 2015-10-15 BROGDON, Jennifer Treatment of cancer using anti-cd19 chimeric antigen receptor
WO2016016473A1 (fr) 2014-08-01 2016-02-04 Sagem Defense Securite Procédé de vérification de traçabilité de premières instructions en un langage de programmation procédurale générées à partir de secondes instructions en un langage de modélisation
WO2016028896A1 (en) 2014-08-19 2016-02-25 Novartis Ag Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment
KR101636882B1 (ko) 2015-06-25 2016-07-06 전남대학교 산학협력단 인간 피브로넥틴 도메인 Ⅲ 기본 골격의 신규 인간 ＥｐｈＡ2 특이적 결합 단백질 및 그의 용도
WO2017211900A1 (en) 2016-06-07 2017-12-14 Max-Delbrück-Centrum für Molekulare Medizin Chimeric antigen receptor and car-t cells that bind bcma
WO2018023025A1 (en) 2016-07-28 2018-02-01 Novartis Ag Combination therapies of chimeric antigen receptors adn pd-1 inhibitors
KR20180121904A (ko) 2016-03-16 2018-11-09 메리맥 파마슈티컬즈, 인크. 에프린 수용체 A2 (EphA2)-표적화된 도세탁셀-생성 나노-리포좀 조성물
KR20180127344A (ko) 2016-03-16 2018-11-28 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 단백질 A 결합 펩타이드, 항-EphA2 항체 및 이의 사용 방법
KR20180134347A (ko) 2016-04-15 2018-12-18 제넨테크, 인크. 암의 진단 및 치료 방법
KR20190052697A (ko) * 2016-09-28 2019-05-16 가비쉬-가릴리 바이오 어플리케이션스 리미티드. 암의 신규한 항원 지표를 표적화하는 ｃａｒ 요법을 위한 보편적 플랫폼
WO2020070290A1 (en) * 2018-10-05 2020-04-09 St. Anna Kinderkrebsforschung A group of chimeric antigen receptors (cars)
KR20200105840A (ko) 2017-12-19 2020-09-09 바이사이클티엑스 리미티드 EphA2에 특이적인 바이사이클릭 펩티드 리간드
KR102157197B1 (ko) 2016-12-05 2020-09-21 상하이 유니카-테라피 바이오-메디슨 테크놀로지 컴퍼니 리미티드 일종의 pdl1 차단을 통한 면역회피 억제에 사용되는 car-t 형질전환 벡터 및 그의 구축방법과 용도
KR20210012263A (ko) * 2019-07-24 2021-02-03 전남대학교산학협력단 신규 암 치료 및 진단용 방사성 화합물이 결합된 인간 EphA2 특이적 모노바디 제조법 및 그의 용도
WO2021048850A1 (en) * 2019-09-11 2021-03-18 Migal Galilee Research Institute, Ltd. Chimeric antigen receptor comprising cd40 cytoplasmic domain and uses thereof

Patent Citations (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20070107721A (ko) 2005-02-04 2007-11-07 레이븐 바이오테크놀로지스, 인코퍼레이티드 Ｅｐｈａ2에 결합하는 항체 및 그것의 사용방법
KR101528939B1 (ko) 2006-07-18 2015-06-15 사노피 암 치료를 위한 ｅｐｈａ2에 대한 길항제 항체
KR101521668B1 (ko) 2007-08-30 2015-05-28 다이이찌 산쿄 가부시키가이샤 항ｅｐｈａ２ 항체
WO2015157252A1 (en) 2014-04-07 2015-10-15 BROGDON, Jennifer Treatment of cancer using anti-cd19 chimeric antigen receptor
WO2016016473A1 (fr) 2014-08-01 2016-02-04 Sagem Defense Securite Procédé de vérification de traçabilité de premières instructions en un langage de programmation procédurale générées à partir de secondes instructions en un langage de modélisation
WO2016028896A1 (en) 2014-08-19 2016-02-25 Novartis Ag Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment
KR101636882B1 (ko) 2015-06-25 2016-07-06 전남대학교 산학협력단 인간 피브로넥틴 도메인 Ⅲ 기본 골격의 신규 인간 ＥｐｈＡ2 특이적 결합 단백질 및 그의 용도
KR20180121904A (ko) 2016-03-16 2018-11-09 메리맥 파마슈티컬즈, 인크. 에프린 수용체 A2 (EphA2)-표적화된 도세탁셀-생성 나노-리포좀 조성물
KR20180127344A (ko) 2016-03-16 2018-11-28 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 단백질 A 결합 펩타이드, 항-EphA2 항체 및 이의 사용 방법
KR20180134347A (ko) 2016-04-15 2018-12-18 제넨테크, 인크. 암의 진단 및 치료 방법
WO2017211900A1 (en) 2016-06-07 2017-12-14 Max-Delbrück-Centrum für Molekulare Medizin Chimeric antigen receptor and car-t cells that bind bcma
WO2018023025A1 (en) 2016-07-28 2018-02-01 Novartis Ag Combination therapies of chimeric antigen receptors adn pd-1 inhibitors
KR20190052697A (ko) * 2016-09-28 2019-05-16 가비쉬-가릴리 바이오 어플리케이션스 리미티드. 암의 신규한 항원 지표를 표적화하는 ｃａｒ 요법을 위한 보편적 플랫폼
KR102157197B1 (ko) 2016-12-05 2020-09-21 상하이 유니카-테라피 바이오-메디슨 테크놀로지 컴퍼니 리미티드 일종의 pdl1 차단을 통한 면역회피 억제에 사용되는 car-t 형질전환 벡터 및 그의 구축방법과 용도
KR20200105840A (ko) 2017-12-19 2020-09-09 바이사이클티엑스 리미티드 EphA2에 특이적인 바이사이클릭 펩티드 리간드
WO2020070290A1 (en) * 2018-10-05 2020-04-09 St. Anna Kinderkrebsforschung A group of chimeric antigen receptors (cars)
KR20210012263A (ko) * 2019-07-24 2021-02-03 전남대학교산학협력단 신규 암 치료 및 진단용 방사성 화합물이 결합된 인간 EphA2 특이적 모노바디 제조법 및 그의 용도
WO2021048850A1 (en) * 2019-09-11 2021-03-18 Migal Galilee Research Institute, Ltd. Chimeric antigen receptor comprising cd40 cytoplasmic domain and uses thereof

Non-Patent Citations (12)

* Cited by examiner, † Cited by third party
Title
"Eph Nomenclature Committee", CELL, vol. 90, 1997, pages 403 - 404
BARQUILLA A ET AL., ANNU. REV. PHARMACOL. TOXICOL., vol. 55, 2015, pages 465 - 487
DAVIS S ET AL., SCIENCE, vol. 266, no. 5186, 1994, pages 816 - 819
FINNEY AC ET AL., CIRCULATION, vol. 136, 2017, pages 566 - 582
IEGUCHI K., ENDOCR METAB IMMUNE DISORD DRUG TARGETS, vol. 15, 2015, pages 119 - 128
KIM MAYOON HSPARK SHKIM DYPYO AKIM HSMIN JJHONG Y: "Engineering of monobody conjugates for human EphA2-specific optical imaging", PLOS ONE, vol. 12, no. 7, 7 July 2017 (2017-07-07), pages e0180786
LINDBERG RA ET AL., MOL CELL BIOL., vol. 10, no. 12, 1990, pages 6316 - 6324
NAJ AC ET AL., NAT GENET., vol. 43, 2011, pages 436 - 441
PARK SHPARK SKIM DYPYO AKIMURA RHSATHIRACHINDA ACHOY HEMIN JJGAMBHIR SSHONG Y: "Isolation and Characterization of a Monobody with a Fibronectin Domain III Scaffold That Specifically Binds EphA2", PLOS ONE, vol. 10, no. 7, 15 July 2015 (2015-07-15), pages e0132976, XP055568415, DOI: 10.1371/journal.pone.0132976
PASQUALE EB, CELL, vol. 133, 2008, pages 38 - 52
PYO AYOU SHSIK KIM HYOUNG KIM JMIN JJKIM DYHONG Y: "Production of(64)Cu-labeled monobody for imaging of human EphA2-expressing tumors", BIOORG MED CHEM LETT., vol. 30, no. 14, 15 May 2020 (2020-05-15), pages 127262, XP086177745, DOI: 10.1016/j.bmcl.2020.127262
SEUNG-HWAN PARK, PARK SUKHO, KIM DONG-YEON, PYO AYOUNG, KIMURA RICHARD H., SATHIRACHINDA ATAYA, CHOY HYON E., MIN JUNG-JOON, GAMBH: "Isolation and Characterization of a Monobody with a Fibronectin Domain III Scaffold That Specifically Binds EphA2", PLOS ONE, vol. 10, no. 7, pages e0132976, XP055568415, DOI: 10.1371/journal.pone.0132976 *

Also Published As

Publication number Publication date
CN117693519A (zh) 2024-03-12
EP4349857A1 (en) 2024-04-10
KR20220159289A (ko) 2022-12-02

Similar Documents

Publication Publication Date Title
JP7300763B2 (ja) Ｃａｒ発現ベクター及びｃａｒ発現ｔ細胞
EP4166655A1 (en) Engineered immune cell and use thereof
EP3039040B1 (en) Anti cd30 chimeric antigen receptor and its use
KR20180012762A (ko) 세포
WO2019182425A1 (ko) 신규 키메라 항원 수용체 암호화 유전자가 형질도입된 유전자 변형 nk 세포주 및 그의 용도
KR20180021137A (ko) 키메라 항원 수용체 (car), 조성물 및 이의 사용 방법
WO2018217064A2 (ko) 형질전환된 t세포를 이용한 자연살해세포의 배양방법
JP2018509148A (ja) 患者における持続性および／または生着を増加させるために同種ｔ細胞を改変する方法
EP3682000B1 (en) A grna targeting hpk1 and a method for editing hpk1 gene
WO2020101361A1 (ko) 형질전환된 t세포를 이용한 제대혈 유래 자연살해세포의 배양방법
US20230248825A1 (en) T-cells expressing immune cell engagers in allogenic settings
Wei et al. Localized interleukin‐12 delivery for immunotherapy of solid tumours
JP2022512450A (ja) Ｇｐｃ３を標的とする免疫エフェクター細胞およびその応用
WO2019097083A1 (en) Modified k562 cell
WO2022025638A1 (ko) 면역시냅스를 안정화시키는 키메라 항원 수용체(car) t 세포
WO2022250431A1 (ko) 모노바디 기반 키메라 항원 수용체 및 이를 포함하는 면역 세포
JP2023507525A (ja) 固形腫瘍の癌免疫療法のための新規メソテリン特異性キメラ抗原受容体（ｃａｒ）
Coccoris et al. Long-term functionality of TCR-transduced T cells in vivo
CN114163532A (zh) 包含新型共刺激结构域的嵌合抗原受体及其用途
WO2023172077A1 (ko) Pd-l1 특이적 키메라 항원 수용체 및 이를 포함하는 면역세포
WO2023027471A1 (ko) 기능이 강화된 신규 키메라 항원 수용체(car)
WO2023090780A1 (ko) 자연살해세포-특이적 키메릭항원수용체 및 이의 용도
Mole Development and characterisation of anti-MCAM chimeric antigen receptor T cells
WO2024040138A1 (en) Universal natural killer cells derived from human pluripotent stem cells and method of use
CN115785279A (zh) 包含新型共刺激结构域的嵌合抗原受体及其用途

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22811624

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2023572755

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 18563931

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2022811624

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2022811624

Country of ref document: EP

Effective date: 20240102