WO2022186661A1 - 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물 - Google Patents

돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물 Download PDF

Info

Publication number
WO2022186661A1
WO2022186661A1 PCT/KR2022/003112 KR2022003112W WO2022186661A1 WO 2022186661 A1 WO2022186661 A1 WO 2022186661A1 KR 2022003112 W KR2022003112 W KR 2022003112W WO 2022186661 A1 WO2022186661 A1 WO 2022186661A1
Authority
WO
WIPO (PCT)
Prior art keywords
porcine
vaccine composition
multivalent vaccine
mycoplasma
recombinant
Prior art date
Application number
PCT/KR2022/003112
Other languages
English (en)
French (fr)
Inventor
한태욱
김기주
신우성
Original Assignee
주식회사 이노백
강원대학교산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020210073554A external-priority patent/KR102646305B1/ko
Application filed by 주식회사 이노백, 강원대학교산학협력단 filed Critical 주식회사 이노백
Publication of WO2022186661A1 publication Critical patent/WO2022186661A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/02—Bacterial antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A61K39/295—Polyvalent viral antigens; Mixtures of viral and bacterial antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals

Definitions

  • the present invention relates to a multivalent vaccine composition for preventing porcine mycoplasma and porcine circovirus infection.
  • Mhp Mycoplasma hyopneumoniae
  • Mhr Mycoplasma hyorhinis
  • PCV2 Porcine circovirus type 2, PCV2
  • Mycoplasma hyopneumoniae is a respiratory pathogen related to porcine respiratory disease complex (PRDC) and porcine epidemic pneumonia (EP), and infection starts by colonizing respiratory ciliate cells. It is attracting attention as a causative agent of porcine mycoplasma pneumonia.
  • Mycoplasma hyopneumoniae exhibits only symptoms such as dry cough when infected with a single infection, but when it is combined with other respiratory pathogens, it causes severe respiratory symptoms, reduces macrophage activity, and protects against invasion of other pathogens. It further increases the risk of further pathogenic infections, such as loss of primary defenses.
  • Mycoplasma hyorhinis (Mhr) is emerging as a pathogen with a new role in respiratory infectious diseases in pigs following Mycoplasma hyopneumoniae, and it is believed that the mixed infection with the porcine genital respiratory tract virus exacerbates the disease. has been reported In addition, it is known that Mycoplasma hyopneumoniae alone can cause mycoplasma lesions expressed in Mycoplasma hyopneumoniae.
  • porcine circovirus type 2 is a causative agent of postweaning multisystemic wasting syndrome (PMWS) in weaning pigs. Infected pigs become chronically atrophied, pale skin, and enlarged lymph nodes. to be. In addition, it exhibits respiratory symptoms such as dyspnea and chronic pneumonia, and digestive symptoms such as diarrhea and gastric ulcer, and causes high economic loss worldwide because it shows a high mortality rate ( ⁇ 50%) in weaned pigs.
  • PCV2 accompanies many other infections, vaccination is known as the only alternative because it is not sterilized by common disinfectants due to its very strong resistance to the environment and organic compounds.
  • the existing commercial vaccine was produced with a PCV2a (or PCV2b) genotype virus, but a genotype shift has occurred since 2012 to the newly emerged PCV2d, and recently, more than 90% of the PCV2d genotype has been isolated. It is known that the PCV2a genotype has a sequence homology of 91.4% with PCV2b, 90.4% with PCV2d, and 93.9% with PCV2d genotype of PCV2b.
  • Mycoplasma hyopneumoniae Mycoplasma hyorinis
  • porcine circovirus type 2 have several types of subspecies, which have a very high possibility of interference.
  • the present inventors developed a multivalent vaccine composition for preventing infection with porcine mycoplasma and porcine circovirus, and completed the present invention by confirming that antibodies to each antigen were excellently generated in an animal model inoculated with the multivalent vaccine composition. .
  • an object of the present invention is to provide a multivalent vaccine composition for preventing infection with porcine mycoplasma and porcine circovirus.
  • Another object of the present invention is to provide a method for preventing infection with porcine mycoplasma and porcine circovirus.
  • Another object of the present invention is to provide a pharmaceutical composition for preventing diseases caused by infection with porcine mycoplasma and porcine circovirus.
  • the present invention is (i) pig Mycoplasma hyopneumoniae ( Mycoplasma hyopneumoniae , Mhp) strain; (ii) porcine Mycoplasma hyorhinis (Mhr) strain; (iii) recombinant P97 protein from porcine Mycoplasma hyopneumoniae; and (iv) a recombinant protein derived from Porcine circovirus type 2 (PCV2).
  • PCV2 Porcine circovirus type 2
  • the present invention provides a method for preventing porcine mycoplasma and porcine circovirus infection, comprising the step of inoculating a pig with the multivalent vaccine composition according to the present invention.
  • the present invention is (i) pig Mycoplasma hyopneumoniae ( Mycoplasma hyopneumoniae , Mhp) strain; (ii) porcine Mycoplasma hyorhinis (Mhr) strain; (iii) recombinant P97 protein from porcine Mycoplasma hyopneumoniae; And (iv) porcine circovirus type 2 (Porcine circovirus type 2, PCV2) derived recombinant protein; provides a pharmaceutical composition for preventing diseases caused by infection with porcine mycoplasma and porcine circovirus, including.
  • the multivalent vaccine composition of the Mhp+Mhr+recombinant P97 protein+recombinant PCV2 capsid antigen combination according to the present invention exhibited a complementary effect of immune responses in the experimental animal and the target animal, pig, so that no interference between antigens was observed, and the pig was inoculated.
  • high levels of antibody titers and neutralizing antibodies to each antigen were induced, and high levels of interferon-gamma for Mhp or PCV2 sensitization in peripheral blood mononuclear cells (PBMC). , IFN- ⁇ ) was generated, and it was confirmed that the target animal, pig, was inoculated and attacked, showed excellent protective ability without side effects.
  • PBMC peripheral blood mononuclear cells
  • 3 is a result of inoculating a mouse with the multivalent vaccine composition according to the present invention and confirming the antibody titer to the recombinant P97 protein.
  • FIG. 5 is a result of inoculating guinea pigs with the multivalent vaccine composition and PCV2 alone vaccine according to the present invention, and confirming the antibody titer to the recombinant PCV2d capsid protein antigen.
  • IFN- ⁇ interferon-gamma
  • FIG. 15 is a view showing the protective ability of the multivalent vaccine composition according to the present invention to the challenge inoculation, and the results of confirming the antibody titer of PCV2b-specific IgG (PCV2b-specific IgG) in the serum in pigs inoculated or not vaccinated with the multivalent vaccine composition. to be.
  • 17 is a view showing the protective ability of the multivalent vaccine composition according to the present invention against attack inoculation, and is the result of measuring the PCV2b neutralizing antibody titer in pigs inoculated with or not vaccinated with the multivalent vaccine composition.
  • FIG. 18 is a view showing the protective ability of the multivalent vaccine composition according to the present invention against attack inoculation, and is the result of measuring the PCV2d neutralizing antibody titer in pigs inoculated with or not vaccinated with the multivalent vaccine composition.
  • Figure 20 confirms the protective ability of the multivalent vaccine composition according to the present invention against the challenge, in pigs inoculated or not vaccinated with the multivalent vaccine composition, PCV2 DNA copy number quantification results of the serum samples of each experimental group.
  • Figure 21 confirms the protective ability of the multivalent vaccine composition according to the present invention against the challenge, in pigs inoculated or not vaccinated with the multivalent vaccine composition, the results of quantification of the number of PCV2 DNA copies in the nasal samples of each experimental group.
  • FIG. 22 is a view confirming the protective ability of the multivalent vaccine composition according to the present invention against attack, and is the result of quantification of the PCV2 DNA copy number of the rectal sample of each experimental group in pigs inoculated or not vaccinated with the multivalent vaccine composition.
  • 23 is a view confirming the protective ability of the multivalent vaccine composition according to the present invention against attack, and is the result of quantification of the PCV2 DNA copy number of the lung samples of each experimental group in pigs inoculated or not vaccinated with the multivalent vaccine composition.
  • 24 is a view showing the protective ability of the multivalent vaccine composition according to the present invention to the challenge inoculation, and is the result of quantification of the PCV2 DNA copy number of the lymph node samples of each experimental group in pigs inoculated or not vaccinated with the multivalent vaccine composition.
  • the present invention is (i) pig Mycoplasma hyopneumoniae ( Mycoplasma hyopneumoniae , Mhp) strain; (ii) porcine Mycoplasma hyorhinis (Mhr) strain; (iii) recombinant P97 protein from porcine Mycoplasma hyopneumoniae; and (iv) a recombinant protein derived from Porcine circovirus type 2 (PCV2).
  • PCV2 Porcine circovirus type 2
  • a 'vaccine' is a veterinary vaccine containing an antigenic substance, which is specific for Mhp, Mhr or PCV2 and is administered for the purpose of inducing active or passive immunity.
  • Adhesin P97 is a membrane surface protein of Mycoplasma hyopneumoniae and is known as an antigen with high immunogenicity.
  • R1 and R2 sites composed of repeating sections, of which the R1 site binds to the attachment site (AAKPV/E) of the host respiratory cilia.
  • the host may produce an antibody to prevent M.hyopneumoniae from attaching to the porcine cilia or to inhibit the growth of the attached pathogen.
  • M.hyopneumoniae M.hyopneumoniae from attaching to the porcine cilia or to inhibit the growth of the attached pathogen.
  • conventional commercial vaccines cannot induce antibodies to P97.
  • the multivalent vaccine composition of the present invention is characterized in that it is capable of inducing an antibody against P97 including the recombinant P97 protein.
  • the recombinant P97 protein included in the vaccine composition is a fusion of the P97 gene derived from porcine Mycoplasma hyopneumoniae and the E. coli heat-labile enterotoxin subunit B (eltb) gene. can be manufactured. More specifically, the eltb of E.
  • the recombinant P97 protein may be characterized in that it consists of an amino acid sequence represented by SEQ ID NO: 1.
  • the recombinant P97 protein of the present invention may include all of the polypeptides having at least 70%, 80%, 90%, 95%, 98% and preferably at least 99% homology to the amino acid sequence of SEQ ID NO: 1.
  • homology is meant a measure of the similarity between protein or polynucleotide sequences.
  • These polypeptides may have deletions, additions or substitutions of at least one amino acid compared to the amino acid sequence of SEQ ID NO: 1. The degree of homology between the two sequences scored is based on preserving the percentage of identities and/or substitution of the sequences.
  • the recombinant protein derived from the porcine circovirus type 2 can be prepared as follows.
  • the ORF2 gene of PCV2d DNA isolated from pig serum was inserted into the pFastBac1 vector (Gibco, USA) to prepare recombinant Bacmid DNA, and then transfected into ExpiSf9 cell (Gibco) to produce recombinant baculovirus.
  • the PCV2-derived recombinant protein of the present invention may be characterized in that it consists of the amino acid sequence represented by SEQ ID NO: 2.
  • the PCV2-derived recombinant protein of the present invention may include all polypeptides having at least 70%, 80%, 90%, 95%, 98% and preferably at least 99% homology to the amino acid sequence of SEQ ID NO: 2 .
  • homology is meant a measure of the similarity between protein or polynucleotide sequences.
  • These polypeptides may have deletions, additions or substitutions of at least one amino acid compared to the amino acid sequence of SEQ ID NO:2. The degree of homology between the two sequences scored is based on preserving the percentage of identities and/or substitution of the sequences.
  • the recombinant proteins of the present invention When used for the production of a vaccine, they may be added to the vaccine in the form of a purified protein or may be expressed in E. coli and included in an unrefined lysate state.
  • the Mycoplasma hyopneumoniae strain and the porcine Mycoplasma hyopneumoniae strain included in the multivalent vaccine composition according to the present invention may be isolated from a pig individual with mycoplasma lung lesions, or a known strain may be used without limitation, each Alternatively, it may be characterized in that all of them are inactivated, and inactivation may be performed using methods known in the art without limitation.
  • Mycoplasma hyopneumoniae may be included in the vaccine at a concentration of 1 ⁇ 10 8 to 1 ⁇ 10 9 CCU (Colour-changing units)/mL, preferably 1.5 ⁇ 10 It may be included at a concentration of 8 to 5 ⁇ 10 8 CCU/mL, more preferably 2 ⁇ 10 8 CCU/mL. At this time, it is preferable that the vaccination amount is 2 mL.
  • Mycoplasma hyolinis may be included in the vaccine at a concentration of 1 ⁇ 10 8 to 1 ⁇ 10 9 CCU (Colour-changing units)/mL, preferably 1.5 ⁇ 10 8 to 5 ⁇ 10 8 CCU/mL, more preferably 2 ⁇ 10 8 CCU/mL. At this time, it is preferable that the vaccination amount is 2 mL.
  • the recombinant P97 protein derived from porcine Mycoplasma hyopneumoniae may be included in the vaccine at a concentration of 10 to 100 ⁇ g/dose, preferably 20 to 50 ⁇ g/dose, more preferably may be included at a concentration of at least 25 ⁇ g/dose. At this time, it is preferable that the vaccination amount is 2 mL.
  • the recombinant protein derived from porcine circovirus type 2 may be included in the vaccine at a concentration of 0.1 to 1000 ⁇ g/dose, preferably 10 to 30 ⁇ g/ A dose, more preferably, may be included at a concentration of 20 ⁇ g/dose.
  • the vaccination amount is 2 mL.
  • the multivalent vaccine composition of the present invention is an immunopotentiator capable of inducing protective immunity with minimal administration by enhancing the immunogenicity of the vaccine.
  • pharmaceutically or veterinary acceptable refers to a composition that is physiologically acceptable and does not normally cause allergic reactions such as gastrointestinal disorders, dizziness, or similar reactions when administered to animals.
  • Examples of such carriers, excipients and diluents include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, and mineral oil.
  • fillers, anti-agglomeration agents, lubricants, wetting agents, fragrances, emulsifiers and preservatives may be further included.
  • Suitable carriers for use include, but are not limited to, aqueous media including, but not limited to, saline, phosphate buffered saline, minimal essential medium (MEM) or MEM in HEPES buffer.
  • aqueous media including, but not limited to, saline, phosphate buffered saline, minimal essential medium (MEM) or MEM in HEPES buffer.
  • MEM minimal essential medium
  • IMS1313 an IMS-based excipient, was used in consideration of safety and immunity.
  • the multivalent vaccine composition of the present invention may include one or more adjuvants suitable for constituting the vaccine composition.
  • the adjuvant that may be included in the composition of the present invention refers to a substance that enhances the immune response of an injected animal, and a number of different adjuvants are known to those skilled in the art.
  • the adjuvant includes Freund's complete and incomplete immune enhancers, vitamin E, nonionic blocking polymer, muramyl dipeptide, Quil A, mineral and non-mineral oils and Carbopol, water-in-oil type emulsion adjuvants, and the like, but is limited thereto. it's not going to be
  • the multivalent vaccine compositions of the present invention may be formulated using methods known in the art to provide rapid, sustained or delayed release of the active ingredient after administration to a mammal.
  • Formulations may be in the form of powders, granules, tablets, emulsions, syrups, aerosols, soft or hard gelatin capsules, sterile injectable solutions, sterile powders, and the like.
  • the multivalent vaccine composition of the present invention may be administered by an intramuscular, subcutaneous, transdermal, intravenous, intranasal, intraperitoneal or oral route, preferably by an intramuscular or subcutaneous route.
  • the dose of the vaccine may be appropriately selected according to various factors such as the route of administration, the age, sex, weight and severity of the animal.
  • the multivalent vaccine composition of the present invention may be prepared by standard methods in the art, except for methods specific to the present invention, such as the production of recombinant proteins derived from recombinant proteins P97 and PCV2.
  • a culture medium such as complete medium
  • CCU color change units
  • the stock may be further concentrated or lyophilized by conventional methods prior to inclusion in a vaccine for formulation.
  • the present invention also provides a method for preventing porcine mycoplasma and porcine circovirus infection, comprising the step of inoculating a pig with the multivalent vaccine composition according to the present invention.
  • the pig may include, without limitation, an individual likely to be infected with mycoplasma and/or porcine circovirus, and such an infection prevention method may be used in combination with other treatment methods or prevention methods known in the art.
  • infection prevention method means providing a given composition of the present invention to an individual by any suitable method.
  • the multivalent vaccine composition according to the present invention may be inoculated once at 1 to 5 weeks of age, and more preferably, may be inoculated once at 3 weeks of age.
  • the preventive method of the present invention aims to prevent the onset of infectious diseases that may be caused by the porcine mycoplasma bacteria and/or porcine circovirus in pigs.
  • the present invention is (i) pig Mycoplasma hyopneumoniae ( Mycoplasma hyopneumoniae , Mhp) strain; (ii) porcine Mycoplasma hyorhinis (Mhr) strain; (iii) recombinant P97 protein from porcine Mycoplasma hyopneumoniae; And (iv) porcine circovirus type 2 (Porcine circovirus type 2, PCV2) derived recombinant protein; provides a pharmaceutical composition for preventing diseases caused by infection with porcine mycoplasma and porcine circovirus, including.
  • the diseases caused by the swine mycoplasma and porcine circovirus infection are porcine respiratory complex syndrome (PRDC), swine epidemic pneumonia (EP), postweaning multisystemic wasting syndrome (PMWS), porcine dermatitis and nephropathy syndrome (PDNS), sow abortion and mortality syndrome (SAMS), Porcine Reproductive and Respiratory Syndrome (PRRS), pseudorabies (pseudorabies), Glasser Glasser's disease, streptococcal meningitis, salmonellosis, postweaning colibacillosis, dietetic hepatosis, suppurative bronchopneumonia, Eustachian tube It may be at least one selected from the group consisting of inflammation, polyserositis, mycoplasma pneumonia, and pleural pneumonia, but is not limited thereto.
  • PRDC porcine respiratory complex syndrome
  • EP swine epidemic pneumonia
  • PMWS postweaning multisystemic wasting syndrome
  • PDNS porcine dermatitis
  • the pharmaceutical composition of the present invention is preferably administered orally or parenterally.
  • the pharmaceutical composition of the present invention includes, but is not limited to, pills, dragees, capsules, solutions, gels, syrups, slurries, suspensions, and any orally acceptable formulations. It can also be administered orally in the form.
  • ком ⁇ онент For oral tablets, commonly used carriers include lactose and corn starch. Lubricants such as magnesium stearate are also typically added. Useful diluents for oral administration in capsule form include lactose and dried corn starch. When aqueous suspensions are administered orally, the active ingredient is combined with emulsifying and suspending agents. If desired, sweetening and/or flavoring and/or coloring agents may be added.
  • the pharmaceutical composition for oral administration may be prepared by mixing the active ingredient with a solid excipient, and may be prepared in the form of granules for preparation in the form of tablets or dragees.
  • Suitable excipients include, but are not limited to, sugar form such as lactose, sucrose, mannitol and sorbitol or starch from corn, wheat flour, rice, potato or other plants, cellulose such as methyl cellulose, hydroxypropylmethyl-cellulose or sodium carboxymethylcellulose; Carbohydrates such as gums including gum arabic and tagacanth or protein fillers such as gelatin and collagen may be used.
  • disintegrants or solubilizers in the form of cross-linked polyvinylpyrrolidone, agar and their respective salts such as alginic acid or sodium alginic acid may be added.
  • parenteral includes subcutaneous, intradermal, intravenous, intramuscular, intraarticular, intrasynovial, intrasternal, intrathecal, intralesional and intracranial injection or infusion techniques.
  • the pharmaceutical composition of the present invention is a sterile injectable aqueous or oleaginous suspension, and may be in the form of a sterile injectable preparation.
  • This suspension may be formulated according to techniques known in the art using suitable dispersing or wetting agents (eg, Tween 80) and suspending agents.
  • the sterile injectable preparation may also be a sterile injectable solution or suspension (eg, a solution in 1,3-butanediol) in a non-toxic parenterally acceptable diluent or solvent.
  • Vehicles and solvents that can be used permissibly include mannitol, water, Ringel's solution and isotonic sodium chloride solution.
  • sterile, nonvolatile oils are conventionally employed as the solvent or suspending medium.
  • any non-volatile oil with less irritation may be used, including synthetic mono or diglycerides.
  • Fatty acids such as oleic acid and its glyceride derivatives are useful in injectable formulations as are pharmaceutically acceptable natural oils (eg olive oil or castor oil), especially their polyoxyethylated ones.
  • the pharmaceutical composition of the present invention can be prepared as an aqueous solution.
  • a physically suitable buffer solution such as Hank's solution, Ringer's solution or physically buffered saline may be used.
  • Aqueous injection suspensions may contain a substrate capable of increasing the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol or dextran.
  • suspensions of the active ingredient may be prepared as suitable oily injection suspensions.
  • suitable lipophilic solvents or carriers include fatty acids such as sesame oil or synthetic fatty acid esters such as ethyl oleate, triglycerides or liposomes.
  • Polycationic amino polymers may also be used as carriers.
  • the suspension may use suitable stabilizers or agents to increase the solubility of the compound and to prepare solutions of high concentration.
  • compositions of the present invention may also be administered in the form of a suppository for rectal administration.
  • These compositions of the present invention (i) porcine Mycoplasma hyopneumoniae ( Mycoplasma hyopneumoniae , Mhp) strain; (ii) porcine Mycoplasma hyorhinis (Mhr) strain; (iii) recombinant P97 protein from porcine Mycoplasma hyopneumoniae; and (iv) a mixture of a recombinant protein derived from Porcine circovirus type 2 (PCV2), and a suitable non-irritating excipient that is solid at room temperature but liquid at rectal temperature.
  • Such materials include, but are not limited to, cocoa butter, beeswax, and polyethylene glycol.
  • the pharmaceutical composition of the present invention When the pharmaceutical composition of the present invention is applied topically to the skin, the pharmaceutical composition should be formulated as a suitable ointment containing the active ingredient suspended or dissolved in a carrier.
  • porcine Mycoplasma hyopneumoniae Mycoplasma hyopneumoniae , Mhp
  • porcine Mycoplasma hyorhinis (Mhr) strain (ii) recombinant P97 protein from porcine Mycoplasma hyopneumoniae
  • a carrier for topical administration of a mixture of a recombinant protein derived from Porcine circovirus type 2 (PCV2) including, but not limited to, mineral oil, liquid paraffin, white petrolatum, propylene glycol, poly oxyethylene, polyoxypropylene compounds, emulsifying waxes and water.
  • PCV2 Porcine circovirus type 2
  • the pharmaceutical composition of the present invention may also be formulated as a suitable lotion or cream containing the active compound suspended or dissolved in a carrier.
  • Suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl ester wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
  • the pharmaceutical compositions of the present invention may also be topically applied to the lower intestinal tract by rectal suppository and with a suitable enema. Topically applied transdermal patches are also included in the present invention.
  • compositions of the present invention may be administered by nasal aerosol or inhalation.
  • Such compositions are prepared according to techniques well known in the art of pharmaceuticals and are prepared in saline with benzyl alcohol or other suitable preservatives, absorption enhancers to increase bioavailability, fluorocarbons and/or other solubilizing or dispersing agents known in the art. It can be prepared as a solution.
  • a particular effective amount for a particular subject may include (i) the porcine Mycoplasma hyopneumoniae (Mhp) strain used; (ii) porcine Mycoplasma hyorhinis (Mhr) strain; (iii) recombinant P97 protein from porcine Mycoplasma hyopneumoniae; and (iv) the activity, age, weight, general health, sex, diet, administration time, route of administration, excretion rate, drug formulation and It can vary depending on several factors, including the severity of the particular disease being prevented or treated.
  • Mycoplasma hyopneumoniae M. hyopneumoniae , hereinafter Mhp
  • Mycoplasma hyorhinis Mycoplasma hyorhinis , hereinafter Mhr strains were isolated from the lungs showing mycoplasmic lung lesions of pigs, and each strain was isolated by PCR sympathized.
  • the separated Mhp and Mhr strains were cultured for 3 days at 5% CO 2 , 37° C. using Friis' medium. It was confirmed that the isolated strain was Mhp or Mhr through protein pattern analysis and random amplification of polymorphic DNA (RAPD) analysis.
  • the bacterial solution cultured for 3 days had a number of bacteria of approximately 0.1 to 5.0 ⁇ 10 9 CCU/mL.
  • the inactivation was performed for 20 to 24 hours at a final concentration of 4 mM using an inactivation reagent such as BEI (binary ethyleneimine).
  • BEI was prepared by adding BEA (L-bromoethylaminehydrobromide (Sigma-Aldrich, St.
  • Recombinant P97 protein was prepared by fusing the eltb gene to the P97 gene of Mycoplasma hyopneumoniae, and then using the pET-30a(+) (Novagen, USA) expression system. Briefly, E. coli BL21 codon-plus RIL competent cells (Novagen) were transformed with a recombinant plasmid using heat shock and then cultured in 1L of LB (Luria-Bertani) medium supplemented with 50 ⁇ g/mL kanamicin. did.
  • LB Lia-Bertani
  • IPTG isopropyl- ⁇ -D-1-thiogalactopyranoside
  • the obtained protein antigen was purified by the following two methods. First, after binding the lysate containing the recombinant protein to the Ni-NTA column using affinity, use a purification buffer (50 mM NaH 2 PO 4 , 300 mM NaCl) for 5 CV (column resin volume) 5 times ) to remove unbound proteins. Thereafter, the non-specifically bound protein was removed as much as 5 CV with a purification buffer containing 40 mM imidazole, and the recombinant P97 protein antigen was eluted and recovered with a purification buffer containing 400 mM imidazole. The recovered protein was concentrated by filtration according to the capacity. The purified protein antigen was quantified by BCA (Bicinchoninic acid) method, and purity was confirmed by SDS-PAGE (sodium dodecyl sulphate-polyacrylamide gel electrophoresis) method.
  • the pH of the lysate containing the recombinant protein was adjusted to 6.0, and the reaction was stirred for about 2 hours. Thereafter, the protein antigen was precipitated by centrifugation, and phosphate buffer saline (PBS) of pH 7.2 was added to recover the protein.
  • PBS phosphate buffer saline
  • the purified protein was quantified by the BCA method, and the purity was confirmed by the SDS-PAGE method.
  • amino acid sequence of the recombinant P97 protein purified as described above is shown in SEQ ID NO: 1.
  • PCV-free PK-15 cells were prepared by DMEM (Dulbecco's modified Eagle medium (GenDEPOT, Katy, TX) supplemented with 10% FBS (fetal bovine serum (GenDEPOT)) and 1% antibiotic-antimycotic solution (Gibco). , USA)) in the medium at 37° C., 5% CO 2 and cultured under conditions.
  • Insect cells (ExpiSf9, Gibco) used for protein expression were cultured with shaking using ExpiSf CD medium (Gibco) at 28°C and 100 rpm.
  • the ORF2 sequence of the PCV2d genotype was amplified using the viral DNA of PCV2d isolated from a pig farm located in Nonsan, Chungcheongnam-do in 2017 as a template. and subcultured.
  • PCV2d Baculovirus Expression System
  • Recombinant pFB-2dCP was inserted into competent Escherichia coli DH10Bac TM (Gibco) for transformation, and nucleotide sequence analysis was performed.
  • Recombinant bacmid DNA was transfected into ExpiSf9 cells using ExpiFectamine reagent (Gibco).
  • Recombinant baculovirus (Bac-2dCP) expressing PCV2d ORF2 was obtained by culturing it with shaking at 28° C. and 100 rpm for 5 days.
  • ExpiSf9 cells were infected with recombinant baculovirus at a multiplicity of infection (MOI) concentration of 5 and then cultured. On day 5 of culture, cells were harvested by centrifugation at a speed of 1,000 x g for 5 minutes. The expressed recombinant protein was purified using an anion exchange chromatography column. Briefly, harvested cells were treated with 50 mM NaH 2 PO 4.2H 2 O (sodium dihydrogen phosphate dihydrate), 300 mM NaCl (sodium chloride), 1% IGEPAL CA-630 (Sigma-Aldrich, St. Louis, MO, USA). It was resuspended in a dissolution buffer containing this.
  • MOI multiplicity of infection
  • SDS-PAGE was performed by injecting the purified recombinant protein into a 12% gel, and a high-bond polyvinylpyrrolidone membrane (Hybond) was performed using a semi-dry transfer apparatus (Bio-Rad, Hercules, CA, USA). It was transferred to a polyvinylpyrrolidone membrane (Amersham Biosciences, Freiburg, Germany).
  • Hybond polyvinylpyrrolidone membrane
  • Porcine anti-PCV2 antibody (1:500 dilution) and HRP-conjugated goat anti-porcine IgG antibody (HRP (horseradish peroxidase)-conjugated goat anti-porcine IgG antibody (1:5,000 dilution) (Bethyl Laboratories, Montgomery, TX, USA)) was used to confirm a protein band of about 28 kDa as a result of performing western blot.
  • mice weighing 15 g were inoculated with the multivalent vaccine composition according to the present invention (Mhp+Mhr+recombinant P97 protein+recombinant PCV2 capsid protein combination).
  • the multivalent vaccine according to the present invention 200 ⁇ L/dose, which is 1/10 of the pig dose) was inoculated into the thigh muscles of both hind legs of mice. Blood samples were collected at 0, 2, 4, and 6 weeks after inoculation and stored at -70 °C for serological analysis before being used in the experiment.
  • guinea pigs weighing 300-350 g were inoculated with the multivalent vaccine composition (Mhp+Mhr+recombinant P97 protein+recombinant PCV2 capsid protein combination) according to the present invention.
  • 4 guinea pigs were inoculated with PCV2 alone, a control group.
  • Each vaccine 1/2 of the pig dose, 1 mL/dose was inoculated into the thigh muscle of the hind leg of each experimental group of guinea pigs.
  • Blood samples were collected at 0, 2, 4, and 6 weeks after inoculation and stored at -70 °C for serological analysis before being used in the experiment.
  • PBMC peripheral blood mononuclear cells
  • Indirect ELISA was performed for serological analysis following inoculation of the multivalent vaccine composition according to the present invention. More specifically, IgG antibody titers specific to Mhp (identified in mice (recombinant P46 protein)), recombinant P97 protein (identified in pigs and mice), and PCV2 (identified in guinea pigs and pigs) were investigated. Briefly, recombinant P97 protein (100 ng/well), recombinant P46 protein (125 ng/well) or recombinant PCV2 capsid protein (100 ng/well) was diluted in 0.05 M carbonate buffer (pH 9.6) at each concentration.
  • TMB One Component HRP Microwell Substrate (Surmodics, Inc., Eden Prairie, MN, USA)) was dispensed and darkly reacted for 5 minutes, and the reaction was stopped with 2N H 2 SO 4 Epoch microplate reader (Epoch microplate reader ( BioTek, Winooski, VT, USA)) was used to measure the absorbance (optical density, OD) of each plate at a wavelength of 450 nm.
  • a sandwich ELISA was performed to examine the IgG antibody titer specific to the Mhr P37 protein (confirmed in mice and pigs).
  • the recombinant P37 protein was diluted to 500 ng/mL in the blocking solution, 100 ⁇ L of this was dispensed into each well, and the recombinant P37 protein and anti-P37 IgG were reacted for 1 hour at 37°C.
  • mouse or pig serum was diluted 1/100 in 10% FBS solution (with 100 ng E. coli lysate) and reacted at 37° C. for 1 hour to prepare test serum.
  • the recombinant P37 protein solution was removed and washed 3 times with 0.05% PBS-T.
  • test serum 90 ⁇ L of test serum was dispensed into each well of the plate reacted with the recombinant P37 protein, and then reacted at 37° C. for 1 hour. The test serum was removed and washed 3 times with 0.05% PBS-T.
  • Anti-mouse (or anti-porcine) IgG HRP conjugate was diluted 1/2000 in 10% FBS solution, and 100 ⁇ L was added to each well. After reacting at 37 °C for 1 hour, the solution was removed and washed 4 times with 0.05% PBS-T. Then, 100 ⁇ L of TMB solution was put into each well and darkly reacted at room temperature for 5 minutes. 100 ⁇ L of stop solution was dispensed into each well, and absorbance was measured at 450 nm immediately.
  • VN test Virus Neutralization test
  • PCV2 neutralizing antibody was measured using immunofluorescence assay (IFA). After vaccination, 0, 2, 4, and 6 weeks sera of guinea pigs or pigs were inactivated by heating at 56 °C for 30 minutes, followed by binary serial dilution in DMEM, and the same volume of PCV2b or PCV2d virus (200 x 50% tissue). Tissue culture infective dose (TCID50) was inoculated into PK-15 cells having a density of 70-80%, and then cultured at 5% CO 2 , 37°C.
  • IFA immunofluorescence assay
  • the infected cells were fixed with 90% acetone and reacted by adding FITC (fluorescein isothiocyanate)-labeled anti-guinea pig (or anti-pig) IgG (Bethyl Laboratories).
  • FITC fluorescein isothiocyanate
  • the neutralizing antibody titer was determined as the dilution factor of the highest serum that showed more than 90% virus neutralization under a fluorescence microscope.
  • the amount of IFN- ⁇ secretion was investigated.
  • PBMCs isolated from blood were reacted for 72 hours by inactivation of Mhp or sensitization with PCV2 antigen.
  • the supernatant was separated and the amount of IFN- ⁇ secretion was measured using a pig IFN- ⁇ ELISA kit (Invitrogen, Lofer, Austria) according to the manufacturer's instructions.
  • Pig Mycoplasma Vaccine Assay Mice were inoculated with the multivalent vaccine composition according to the present invention, and blood was collected at 0, 2, and 4 weeks to confirm the antibody titer to the recombinant P97 protein. As a result, as shown in FIG. 3 , it was confirmed that the antibody against the recombinant P97 protein was normally formed as in the previous results, the antibody production rapidly increased at the 2nd week, and the antibody titer was also high at the 4th week.
  • the multivalent vaccine composition of the Mhp+Mhr+recombinant P97 protein+recombinant PCV2 capsid protein combination of the present invention did not exhibit mutual interference in mice, which are pig mycoplasma vaccine assay animals, and produced antibodies to each antigen. It was confirmed that it can be formed effectively.
  • Guinea pigs were inoculated with the multivalent vaccine composition or PCV2 alone vaccine according to the present invention and blood was collected at 0, 2, 4, and 6 weeks, and then the antibody titer to the recombinant PCV2 capsid protein antigen was confirmed.
  • the multivalent vaccine composition according to the present invention exhibited a significantly higher level of IgG antibody titer compared to the PCV2 alone vaccination group at the second week of inoculation.
  • all experimental groups showed the highest peak value, and the experimental group vaccinated with the multivalent vaccine according to the present invention during the entire period showed a higher antibody titer. Therefore, it was confirmed that the antibody titer to the recombinant PCV2 capsid protein antigen was more effectively generated when the multivalent vaccine composition according to the present invention was inoculated than the PCV2 alone vaccine.
  • Pigs were inoculated with the multivalent vaccine composition according to the present invention and blood was collected at 0, 4, 9, 14, and 17 weeks to confirm the antibody titer to Mhp. As a result, as shown in FIG. 8, it was confirmed that the multivalent vaccine composition according to the present invention started to increase the antibody titer from 9 weeks after inoculation, and induces a very high antibody titer until 17 weeks.
  • Pigs were inoculated with the multivalent vaccine composition according to the present invention and blood was collected at 0, 4, 9, 14, and 17 weeks to confirm the antibody titer to the recombinant P97 protein.
  • FIG. 9 it was confirmed that the antibody was formed by showing a very high level of OD value within 4 weeks of inoculation.
  • the phenomenon of interfering with the antibody titer to the P97 antigen by adding the PCV2 antigen did not appear.
  • the antibody titer to the recombinant P37 protein was checked to confirm the formation of antibodies to Mhr. As a result, as shown in FIG. 10, it was confirmed that the antibody against Mhr-derived recombinant P37 protein was excellently formed when the multivalent vaccine composition according to the present invention was inoculated.
  • Pigs were inoculated with the multivalent vaccine composition according to the present invention and blood was collected at weeks 0, 4, 9, and 14, and then IFN- ⁇ secretion according to Mhp sensitization was confirmed. As a result, as shown in FIG. 11 , it was confirmed that the IFN- ⁇ secretion increased from the 9th week after inoculation and continued to increase until the 14th week.
  • Pigs were inoculated with the multivalent vaccine composition according to the present invention and blood was collected at 0, 4, 9, and 14 weeks, and then IFN- ⁇ secretion according to PCV2 sensitization was confirmed.
  • the amount of IFN- ⁇ secretion increased from the 9th week after inoculation and showed a tendency to steadily increase until the 14th week.
  • high levels of IFN- ⁇ were observed 14 weeks after vaccination.
  • the inoculation dose and inoculation route were set with reference to the national shipping test standards, and more specifically, the multivalent vaccine composition according to the present invention was inoculated once (2 mL/dose) into the right neck muscle of piglets.
  • 2 mL of PCV2d isolate was injected by 1 mL each through both nasal passages.
  • 5 mL of blood was collected through the jugular vein to separate serum
  • 4 WPV 8 mL of blood was collected through the jugular vein to separate PBMC and serum.
  • ADWG Average daily weight gain
  • ADWG Average daily weight gain
  • multivalent vaccination group As a result of weight measurement, as shown in FIG. 13 and Table 2 below, all groups before vaccination (0 WPV) had an average body weight of 2.82 to 3.33 Kg, and 4 WPV inoculated with the multivalent vaccine composition according to the present invention (hereinafter , multivalent vaccination group) showed an average body weight of 5.14 kg, slightly lower than that of the aggressive control group (5.87 kg) and the negative control group (6.10 kg). However, the weight of the challenge vaccinated control group was the lowest at 4 weeks (8 WPV) after the challenge, with an average of 9.05 Kg, and the multivalent vaccination group had an average of 9.29 Kg, which was similar to that of the negative control group.
  • ADWG measurement results As shown in FIG. 14 and Table 3 below, the average ADWG of the multivalent vaccination group from vaccination to challenge (0-4 WPV) was 82.86 g, compared to the aggressive control group (90.48 g) and the negative control group (108.93 g). ) did not show a significant difference compared to However, from post-challenge to the end of the study (5-8 WPV), the average ADWG of the control group was 113.69 g, and the average ADWG of the multivalent vaccine group was 148.21 g, which was higher than that of the negative control group (119.64 g). showed an increase in Therefore, it was confirmed that there was no side effect such as lack of appetite (reduction) by inoculation of the multivalent vaccine composition according to the present invention.
  • Rectal body temperature was measured 0, 4, 24, and 48 hours after inoculation of the multivalent vaccine composition according to the present invention.
  • side effects at the inoculation site and clinical side effects were observed for 7 days.
  • the clinical side effects were anorexia, decreased vitality, cough, dyspnea, suffocation, shock, vomiting, and diarrhea.
  • the multivalent vaccination group according to the present invention did not show any clinical symptoms according to vaccination. Therefore, it was confirmed that the multivalent vaccine composition according to the present invention does not have any effect on body temperature and clinical symptoms.
  • PCV2b-specific IgG and PCV2d-specific (PCV2d-specific IgG) antibody titers in the serum of each experimental group were confirmed using an indirect fluorescent antibody test (IFA).
  • IFA indirect fluorescent antibody test
  • DMEM containing 1% antibiotic-antimycotic solution (Gibco) was dispensed at 200 ⁇ L/well and cultured for 4 days. The supernatant was removed and washed once with PBS. After dispensing 100 ⁇ L/well of 80% acetone, it was fixed at 4° C. for 1 hour.
  • the plate After discarding the fixative and washing once with PBS, the plate was stored at -20 °C and used for antibody titer test.
  • Pig serum samples were prepared by binary dilution with DMEM, and 100 ⁇ L/well was dispensed on a fixed plate, followed by reaction at 37°C for 1 hour. Thereafter, it was washed three times with PBS.
  • Pig IgG-heavy and light chain antibody (Pig IgG-heavy and light chain antibody, Goat polyclonal, FITC conjugate[Bethyl]) was diluted 1:200 in PBS on the plate, dispensed at 100 ⁇ L/well, and reacted at 37 ° C for 30 minutes. did it After that, it was washed once with PBS and observed under a fluorescence microscope.
  • the multivalent vaccination group according to the present invention induced an IgG antibody titer specific to PCV2b significantly (P ⁇ 0.01) compared to the other experimental groups from 2 WPV.
  • the antibody titer continued to rise even after the challenge inoculation, resulting in a fairly high level of IgG antibody titer until the end of the test.
  • the attack control group induced the antibody titer from 6 WPV, but showed a significantly (P ⁇ 0.05) lower level compared to the multivalent vaccination group according to the present invention, and the negative control group showed a low level of antibody titer in all sections of the test showed
  • the multivalent vaccination group according to the present invention induced an IgG antibody titer specific to PCV2d significantly (P ⁇ 0.001) compared to the other experimental groups from 2 WPV. In particular, it continued to increase even after the challenge inoculation, showing a fairly high level of IgG antibody titer until the end of the test.
  • the attack control group induced the antibody titer from 6 WPV, it showed a significantly (P ⁇ 0.001) lower level compared to the multivalent vaccine inoculation group according to the present invention, and the negative control group showed a low level of antibody titer in all sections of the test .
  • the neutralizing antibody in the serum of each experimental group was confirmed as follows. First, the sera of each experimental group were non-assimilated at 56 °C for 30 minutes. After diluting 50 ⁇ L of the serum and 150 ⁇ L of DMEM into the first well of a 96-well plate, 100 ⁇ L/well of DMEM was dispensed into the remaining wells for binary dilution. After diluting the retained PCV2b (HID9029) or PCV2d (HID9071) virus to 400 TCID 50 /mL, the same amount (100 ⁇ L/well) was dispensed into the wells containing the binary diluted serum and reacted at 37°C for 1 hour. .
  • PK-15 cells which are PCV1-free porcine kidney cells, were seeded into each well at 2 ⁇ 10 4 cells/100 ⁇ L/well. After culturing for 24 hours in an incubator at 37 ° C., 5% CO 2 conditions, 300 mM glucosamine was treated with 200 ⁇ L/well of each for 30 minutes. After that, the supernatant was removed and washed 3 times with PBS. Then, DMEM with 1% antibiotic-antifungal solution was added at 200 ⁇ L/well and cultured for 2 days. After incubation, immunofluorescence assay was performed as follows.
  • the culture solution was discarded, washed once with PBS, and the plate was placed in an incubator at 37° C. and dried for 30 minutes. 100 ⁇ L/well of 80% acetone was dispensed on the dried plate, and then fixed at 4°C for 1 hour. After that, the fixative was discarded and washed once with PBS.
  • Pig anti-PV2 antiserum (anti-PCV2 antiserum) diluted 1:500 in PBS was dispensed at 100 ⁇ L/well and reacted at 37° C. for 1 hour. Thereafter, it was washed three times with PBS.
  • Pig IgG-heavy and light chain antibody (Pig IgG-heavy and light chain antibody, Goat polyclonal, FITC conjugate[Bethyl]) was diluted 1:200 in PBS on the plate, dispensed at 100 ⁇ L/well, and reacted at 37 ° C for 30 minutes. did it After that, it was washed once with PBS and observed with a fluorescence microscope. At this time, the reciprocal of the highest serum dilution factor that inhibited virus proliferation (90% inhibition in 1 well) was determined as the neutralizing antibody titer. The measurement results of the PCV2b neutralizing antibody confirmed through this are shown in FIG. 17 and Table 7 below. In FIG. 17 and Table 7 below. In FIG.
  • the multivalent vaccination group according to the present invention showed an average of 9.6 or more neutralizing antibodies against PCV2b from 2 WPV, indicating that neutralizing antibodies against PCV2b started to be generated.
  • 6 WPV showed a high neutralizing antibody titer of 921.6 or more on average.
  • neutralizing antibody titers continued to increase from 4 WPV after the challenge inoculation, and 8 WPV showed a high level of neutralizing antibody titer of 1,433.6 or more on average.
  • PBMCs were isolated to confirm the amount of IFN- ⁇ secretion, and the antigen was sensitized thereto.
  • Ficoll was prepared by dispensing 4 mL each in a conical tube. 4 mL of blood and 4 mL of PBS from each experimental group were mixed in a new tube (conical tube) and prepared. The blood and PBS mixture was slowly transferred to a tube containing Ficoll and centrifuged for 30 minutes at room temperature at a speed of 840 x g.
  • PBMC floating between Ficoll and serum was separated using a pipet and transferred to a new tube (conical tube) containing 4 mL of PBS. This was centrifuged for 10 minutes at room temperature at a speed of 210 x g.
  • the recombinant PCV2d protein purified antigen in RPMI was dispensed at a concentration of 10 ⁇ g/mL by 100 ⁇ L/well to sensitize, incubated for 72 hours, and centrifuged at 15,800 x g for 10 minutes to separate the supernatant. did. The separated supernatant was recovered and stored at -70 °C.
  • IFN- ⁇ secretion was measured using an IFN- ⁇ porcine ELISA kit (IFN- ⁇ Porcine ELISA kit (Invitrogen, #KSC4021) according to the manufacturer's instructions. The measurement results of IFN- ⁇ secretion are shown in Figs. Table 9 shows.
  • IFN- ⁇ specific for PCV2d antigen was secreted at 30.62 pg/mL in the group vaccinated according to the present invention in 4WPV, and there was no significant difference in all experimental sections.
  • IFN- ⁇ was not measured in the challenge inoculation control group and the negative control group.
  • the challenge inoculation virus DNA was quantitatively evaluated for serum, nasal specimens (swab), rectal specimens (swab), lungs and lymph nodes of each experimental group.
  • serum was separated from the blood of all individuals in each group, and nasal and rectal samples were collected using cotton swabs. Each sample was placed in a 2 mL E-tube and thoroughly vortexed with 1 mL of PBS to mix the sample and PBS. At this time, the lung and lymph node tissues were disrupted using TissueLyser II together with beads by mixing PBS in a 2 mL round-bottom E-tube.
  • RT-qPCR was performed using primers for PCV2 (forward primer (5'-AACCACATACTGGAAACCAC-3' (SEQ ID NO: 5)) and reverse primer (5'-TTGAGGAGTACCATTCCAAC-3' (SEQ ID NO: 6))). carried out.
  • the reagent composition for PCV2 detection is shown in Table 10, and RT-qPCR was performed according to the conditions in Table 11.
  • PCV2 DNA was not detected in the serum of all experimental groups from after vaccination to before challenge inoculation (4 WPV).
  • viremia was not observed in the multivalent vaccination group according to the present invention even after the challenge inoculation, as in the negative control group.
  • the challenge inoculation control group showed 5.63 (Log 10 ) copies/mL of viremia 2 weeks after the challenge inoculation (6 WPV). From 7 WPV to 8 WPV, viremia was not observed in any experimental group.
  • FIGS. 21 and 22 The results of quantification of PCV2 in the nasal cavity and rectum are shown in FIGS. 21 and 22, and Tables 13 and 14 below.
  • *** is the result compared with the negative control group (P ⁇ 0.001).
  • * indicates a result compared with a negative control group (P ⁇ 0.05), and *** indicates a result compared with a negative control group (P ⁇ 0.001).
  • Table 13 shows the results of quantifying the number of PCV2 DNA copies in the nasal cavity
  • Table 14 shows the results of quantifying the number of PCV2 DNA copies in the rectum.
  • PCV2 DNA was not detected in the serum of all experimental groups from after vaccination to before challenge inoculation (4 WPV). From 6 WPV, PCV2 DNA was detected only in the challenge control group, and significantly higher levels of DNA were detected at 6.88 (Log 10 ) and 8.36 (Log 10 ) copies/mL in the nasal cavity and rectum, respectively, a significant difference compared with other groups. DNA showed a tendency to gradually decrease up to 8 WPV.
  • FIGS. 23 and 24 The results of PCV2 DNA copy number counts in lung and inguinal lymph node tissues collected after all experimental groups were euthanized at 8 WPV at the end of the test are shown in FIGS. 23 and 24 and Tables 15 and 16 below.
  • FIG. 23 ## is the result of comparison with the challenge inoculation control group (P ⁇ 0.01).
  • Table 15 shows the results of quantifying the PCV2 DNA copy number in the lungs
  • Table 16 shows the results of quantifying the PCV2 DNA copy number in the lymph nodes.
  • the challenge control group showed a fairly high level of DNA copy number at 8.56 (Log 10 ) copies/mL, but the multivalent vaccine according to the present invention was 5.59 (Log10) copies/mL, and the challenge control group The more DNA copy number decreased by 1/10 3 indicating a significantly lower DNA copy number.
  • the challenge control group showed a DNA copy number of 5.17 (Log 10 ) copies/mL, but the PCV2 DNA copy number was not confirmed in the multivalent vaccine group. On the other hand, PCV2 DNA was not detected in the lungs and lymph nodes in the negative control group.
  • NBF neutral buffered formalin
  • the fixed tissue was trimmed so that the cross-section of each organ could be observed, and according to the general tissue processing method, paraffin-embedded and sliced to a thickness of about 3 to 4 ⁇ m to prepare a tissue slide.
  • the slides were stained with hematoxylin & eosin (H&E) and then microscopically examined using an optical microscope (Olympus BX53, Japan).
  • lymphoid depletion and histiocytic replacement were observed in some lymph nodes.
  • the above findings show a decrease in the number of lymphocytes due to degeneration and necrosis of lymphocytes in the lymph follicle, and infiltration of cells such as histiocytes into the space as part of an inflammatory response.
  • the above findings are one of histopathological findings that can be judged as porcine circovirus-associated disease (PCVAD) in piglets after weaning. have.
  • PCVAD porcine circovirus-associated disease
  • peri-bronchiolar connective tissue hyperplasia is a finding in which cells constituting connective tissue such as fibroblasts grow around the bronchi. .
  • lymph node findings were observed only in the aggressive inoculation control group. Lymphocyte depletion and histiocytic replacement were observed at a weak level only in the first subject of the challenge inoculation control group, and lymph node lesions judged to be PCV2 infection were not significant in any of the experimental subjects.
  • mild or less vascular and peri-organ inflammatory cell infiltration was observed in all subjects in the multivalent vaccination group according to the present invention.
  • subjects 2 and 3 of the multivalent vaccination group according to the present invention mild or less BALT increase was confirmed.
  • the challenge inoculation control group moderate or more vascular and peribronchiolar inflammatory cell infiltration was confirmed in all subjects.
  • Subject 1 of the attack inoculation control group had moderate suppurative bronchointerstitial pneumonia centered on the anterior lateral lobe, and some alveoli were accompanied by mild pulmonary edema, showing the most severe findings among all subjects.
  • Subject No. 2 was accompanied by severe inflammatory cell infiltration around the airways and mild peri-bronchiolar connective tissue growth, and the lumen of some bronchioles was deformed and segmented.
  • Moderate pulmonary edema was also confirmed in the alveoli.
  • Subject 3 showed the weakest change among the three subjects of the attack inoculation control group, as only moderate vascular and peri-organ inflammatory cell infiltration and weak BALT growth were observed.
  • the negative control group only mild vascular and peri-organ inflammatory cell infiltration was observed in both subjects.
  • the kidney local to multifocal infiltration of inflammatory cells in the interstitium of less than moderate degree was observed only in the challenge inoculation control group. The lesion was the most pronounced at moderate level in subject No. 1 of the challenge inoculation control group.
  • PCV2 antigen was not detected in all organs in the multivalent vaccination group according to the present invention as a result of IHC of PCV2 in inguinal superficial lymph nodes, lungs and kidneys.
  • a positive reaction limited to a small number of cells was confirmed in the lymph nodes 1 and 2, and a mild positive reaction was confirmed in some cells infiltrating the lesion of the 1 lung.
  • kidney tissue all subjects in the challenge inoculation control group showed a positive reaction, and most of the cells constituting the inflammatory lesion in the interstitium showed a positive reaction.
  • a positive reaction was observed at a mild level in kidney #1 and at a localized mild level in the rest of the subjects.
  • PCV2 antigen was not detected in any organs.
  • the multivalent vaccine composition of the Mhp+Mhr+recombinant P97 protein+recombinant PCV2 capsid protein combination according to the present invention exhibited a complementary effect on the immune response when inoculated into mice and guinea pigs.
  • High levels of antibody titer and neutralizing antibody titer were induced at the level, and high levels of IFN- ⁇ were produced in PBMC against Mhp or PCV2 sensitization. Therefore, it can be usefully used to prevent infection with porcine mycoplasma and porcine circovirus.

Abstract

본 발명은 돼지마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물 및 이를 이용한 감염 예방 방법에 대한 것으로, 본 발명에 따른 다가 백신 조성물은 실험동물과 목적동물인 돼지에서 면역반응의 상호 보완 효과를 나타내 항원 간의 간섭현상이 나타나지 않았으며, 돼지에 접종하였을 시 혈청학적인 수준에서 높은 수준의 항체가 및 중화항체가를 유도하였고, PBMC에서 Mhp 또는 PCV2 감작에 대해 높은 수준의 IFN-γ를 생성하였으므로 이를 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위하여 유용하게 활용할 수 있다.

Description

돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물
본 발명은 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물에 대한 것이다.
돼지 농가의 생산 저하를 야기하는 감염성 질환에 대한 여러 가지 원인 중 마이코플라스마 하이오뉴모니애(Mycoplasma hyopneumoniae, Mhp), 마이코플라스마 하이오라이니스(Mycoplasma hyorhinis, Mhr) 및 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2)은 가장 위험성이 높은 원인으로 알려져 있다.
마이코플라스마 하이오뉴모니애(Mycoplasma hyopneumoniae, Mhp)는 돼지 호흡기 복합증후군(Porcine respiratory disease complex, PRDC) 및 돼지유행성폐렴(enzootic pneumonia, EP)과 관련된 호흡기병원체이며, 호흡기 섬모세포에 집락화를 시작으로 감염을 일으키므로 돼지 마이코플라스마성 폐렴의 원인균으로 주목받고 있다. 마이코플라스마 하이오뉴모니애는 단일 감염되었을 때는 건성 기침 등의 증상만을 나타내나, 다른 호흡기 병원체와 복합 감염되는 경우 심각한 호흡기 증상을 유발하며 대식세포의 활성을 떨어뜨리고, 다른 병원체의 침입을 방어하는 1차 방어 기능을 상실하게 하는 등 추가 병원균 감염의 위험성을 더욱 증가시킨다.
마이코플라스마 하이오라이니스(Mycoplasma hyorhinis, Mhr)는 마이코플라스마 하이오뉴모니애에 뒤이어 돼지의 호흡기 전염병에서 새로운 역할을 하는 병원체로 대두되고 있으며, 돼지 생식기호흡기증 바이러스와 혼합 감염으로 병증을 더욱 악화시키는 것으로 보고되어 있다. 또한 마이코플라스마 하이오라이니스는 단독으로도 마이코플라스마 하이오뉴모니애에서 발현되는 마이코플라스마성 병변을 유발할 수 있는 것으로 알려져 있다.
한편 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2)은 이유자돈 전신성 소모성 증후군(Postweaning multisystemic wasting syndrome, PMWS)의 원인체로, 감염 돼지는 만성적으로 위축돈이 되고, 피부가 창백하며, 림프절이 커지는 것이 특징이다. 또한 호흡곤란, 만성폐렴 등의 호흡기 증상과 설사, 위궤양과 같은 소화기 증상을 나타내며, 이유자돈에서 높은 폐사율(~50%)을 나타내기 때문에 전세계적으로 높은 경제적 손실을 초래하고 있다. PCV2는 이외에도 다수의 다른 감염을 동반하지만 환경과 유기화합물에 대한 저항성이 매우 강하여 일반적인 소독제에 살균이 되지 않기 때문에 백신 접종만이 유일한 대안으로 알려져 있다.
특히 기존의 상용화 백신은 PCV2a (또는 PCV2b) 유전형 바이러스로 제작되었으나, 2012년 이후부터 새롭게 출현한 PCV2d로 유전형 이동이 발생하였고, 최근에는 PCV2d 유전형이 90% 이상 분리되고 있다. PCV2a 유전형은 PCV2b와 91.4%, PCV2d와 90.4%, PCV2b 유전형은 PCV2d와 93.9%의 염기서열 상동성을 가지는 것으로 알려져 있다.
이러한 양돈 농가에 큰 피해를 유발하는 마이코플라스마 하이오뉴모니애, 마이코플라스마 하이오라이니스 또는 돼지 써코바이러스 2형의 감염을 막기 위해 현재 불활화 형태의 단일(single) 또는 다가(multivalent) 백신이 상용화되어 사용되고 있다. 특히 돼지 마이코플라스마성 폐렴 예방에 있어서, 이러한 불활화 백신은 이용될 수 있는 유일한 백신이다. 그러나 상용화된 마이코플라스마 하이오뉴모니애 불활화 백신은 대부분 접종 후 항체를 형성하지 못하고, 임상 증상은 완화시킬 수 있으나 자연 감염균의 전파 및 호흡기 섬모 집락화를 예방할 수 없다는 점에서 기술적 한계점을 나타내고 있다. 더불어 다가 백신의 경우 혼합되어 있는 개별 항원이 서로 간섭현상을 일으켜 효능을 감소시킬 수 있는 문제가 있다.
특히 마이코플라스마 하이오뉴모니애, 마이코플라스마 하이오라이니스 및 돼지 써코바이러스 2형은 여러 종류의 아종이 존재하여 이로 인한 간섭현상의 발생 가능성이 매우 높다.
따라서 돼지 마이코플라스마 감염, 특히 마이코플라스마 하이오뉴모니애 및 마이코플라스마 하이오라이니스와 기존에 유행하고 있는 PCV2b 및 최근에 유행하고 있는 돼지 써코바이러스 2d 유전형(PCV2d)을 포함한 PCV2의 자연 감염을 동시에 예방하고 효과적으로 항체를 형성할 수 있도록 하는 새로운 다가 백신 개발이 요구되고 있다.
본 발명자들은 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물을 개발하고, 상기 다가 백신 조성물을 접종한 동물모델에서 각 항원에 대해 항체가 우수하게 생성된 것을 확인하여 본 발명을 완성하였다.
따라서 본 발명의 목적은 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물을 제공하는 것이다.
본 발명의 다른 목적은 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방 방법을 제공하는 것이다.
본 발명의 또 다른 목적은 돼지 마이코플라스마균 및 돼지 써코바이러스 감염에 의한 질환 예방용 약학적 조성물을 제공하는 것이다.
상기 목적을 달성하기 위하여, 본 발명은 (i) 돼지 마이코플라스마 하이오뉴모니애 (Mycoplasma hyopneumoniae, Mhp) 균주; (ii) 돼지 마이코플라스마 하이오라이니스(Mycoplasma hyorhinis, Mhr) 균주; (iii) 돼지 마이코플라스마 하이오뉴모니애 유래 재조합 P97 단백질; 및 (iv) 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질;을 포함하는, 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물을 제공한다.
또한 상기 다른 목적을 달성하기 위하여, 본 발명은 본 발명에 따른 다가 백신 조성물을 돼지에 접종하는 단계;를 포함하는 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방 방법을 제공한다.
또한 상기 또 다른 목적을 달성하기 위하여, 본 발명은 (i) 돼지 마이코플라스마 하이오뉴모니애 (Mycoplasma hyopneumoniae, Mhp) 균주; (ii) 돼지 마이코플라스마 하이오라이니스(Mycoplasma hyorhinis, Mhr) 균주; (iii) 돼지 마이코플라스마 하이오뉴모니애 유래 재조합 P97 단백질; 및 (iv) 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질;을 포함하는, 돼지 마이코플라스마균 및 돼지 써코바이러스 감염에 의한 질환 예방용 약학적 조성물을 제공한다.
본 발명에 따른 Mhp+Mhr+재조합 P97 단백질+재조합 PCV2 캡시드 항원 조합의 다가 백신 조성물은 실험동물과 목적동물인 돼지에서 면역반응의 상호 보완 효과를 나타내 항원 간의 간섭현상이 나타나지 않았으며, 돼지에 접종하였을 시 혈청학적인 수준에서 각 항원에 대한 높은 수준의 항체가 및 중화항체가가 유도되었고, 말초혈액단핵세포(peripheral blood mononuclear cells, PBMC)에서 Mhp 또는 PCV2 감작에 대해 높은 수준의 인터페론 감마(interferon-gamma, IFN-γ)를 생성하였으며, 목적 동물인 돼지에 접종하고 공격접종시, 부작용없이 우수한 방어능을 보임을 확인한 바, 이를 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위하여 유용하게 활용할 수 있다.
도 1은 본 발명에 따른 재조합 PCV2d 캡시드 단백질을 투과전자현미경으로 확인한 결과이다.
도 2는 마우스에 본 발명에 따른 다가 백신 조성물을 접종하고 Mhp에 대한 항체가를 확인한 결과이다.
도 3은 마우스에 본 발명에 따른 다가 백신 조성물을 접종하고 재조합 P97 단백질에 대한 항체가를 확인한 결과이다.
도 4는 마우스에 본 발명에 따른 다가 백신 조성물을 접종하고 Mhr에 대한 항체가를 확인한 결과이다.
도 5는 기니피그에 본 발명에 따른 다가 백신 조성물 및 PCV2 단독 백신을 접종하고 재조합 PCV2d 캡시드 단백질 항원에 대한 항체가를 확인한 결과이다.
도 6은 기니피그에 본 발명에 따른 다가 백신 조성물 및 PCV2 단독 백신을 접종하고 PCV2b에 대한 중화항체가를 확인한 결과이다.
도 7은 기니피그에 본 발명에 따른 다가 백신 조성물 및 PCV2 단독 백신을 접종하고 PCV2d에 대한 중화항체가를 확인한 결과이다.
도 8은 돼지에 본 발명에 따른 다가 백신 조성물을 접종하고 Mhp에 대한 항체가를 확인한 결과이다.
도 9는 돼지에 본 발명에 따른 다가 백신 조성물을 접종하고 재조합 P97 단백질에 대한 항체가를 확인한 결과이다.
도 10은 돼지에 본 발명에 따른 다가 백신 조성물을 접종하고 Mhr에 대한 항체가를 확인한 결과이다.
도 11은 돼지에 본 발명에 따른 다가 백신 조성물을 접종하고 Mhp 감작에 따른 인터페론 감마(interferon-gamma, IFN-γ) 분비를 확인한 결과이다.
도 12는 돼지에 본 발명에 따른 다가 백신 조성물을 접종하고 PCV2 감작에 따른 IFN-γ의 분비를 확인한 결과이다.
도 13은 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, 체중 변화를 확인한 결과이다.
도 14는 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, 일당증체량(Average daily weight gain, ADWG)을 확인한 결과이다.
도 15는 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, 혈청 내 PCV2b-특이적 IgG(PCV2b-specific IgG) 항체가를 확인한 결과이다.
도 16은 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, 혈청 내 PCV2d-특이적(PCV2d-specific IgG) 항체가를 확인한 결과이다.
도 17은 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, PCV2b 중화항체가를 측정한 결과이다.
도 18은 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, PCV2d 중화항체가를 측정한 결과이다.
도 19는 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, IFN-γ 분비량을 확인한 결과이다.
도 20은 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, 각 실험군의 혈청 검체의 PCV2 DNA 카피(copy) 수 정량 결과이다.
도 21은 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, 각 실험군의 비강 검체의 PCV2 DNA 카피 수 정량 결과이다.
도 22는 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, 각 실험군의 직장 검체의 PCV2 DNA 카피 수 정량 결과이다.
도 23은 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, 각 실험군의 폐 검체의 PCV2 DNA 카피 수 정량 결과이다.
도 24는 본 발명에 따른 다가 백신 조성물의 공격접종에 대한 방어능을 확인한 것으로, 다가 백신 조성물 접종 또는 미접종 돼지에 있어서, 각 실험군의 림프절 검체의 PCV2 DNA 카피 수 정량 결과이다.
이하, 본 발명에 대해 상세히 설명한다.
본 발명은 (i) 돼지 마이코플라스마 하이오뉴모니애 (Mycoplasma hyopneumoniae, Mhp) 균주; (ii) 돼지 마이코플라스마 하이오라이니스(Mycoplasma hyorhinis, Mhr) 균주; (iii) 돼지 마이코플라스마 하이오뉴모니애 유래 재조합 P97 단백질; 및 (iv) 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질;을 포함하는, 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물을 제공한다.
본 발명에 있어서, '백신'은 항원 물질을 포함하는 수의학용 백신으로, Mhp, Mhr 또는 PCV2에 대하여 특이적이고 능동 또는 수동의 면역성을 유도하기 위한 목적으로 투여된다.
한편, 마이코플라스마 하이오뉴모니애의 감염은 병원체가 호흡기 상피세포의 섬모에 부착하면서 개시된다. 부착인자(Adhesin) P97은 마이코플라스마 하이오뉴모니애의 막 표면 단백질로 면역원성이 높은 항원으로 알려져 있다. P97의 C말단에는 반복되는 구간으로 구성된 R1과 R2 부위가 존재하며, 그 중 R1 부위는 숙주 호흡기 섬모의 부착부위(AAKPV/E)에 결합한다. 결합된 마이코플라스마 하이오뉴모니애는 성장에 필요한 아미노산을 숙주로부터 얻을 수 있으며, 상처난 조직에 침입하기 위하여 숙주의 분자들을 다양하게 배열할 수 있게 된다. 한편, 숙주는 항체를 생산하여 돼지 섬모에 마이코플라스마 하이오뉴모니애가 부착하는 것을 방해하거나 부착된 병원체의 성장을 저해할 수 있다. 그러나, 선행 연구에 따르면 기존의 상용 백신은 P97에 대한 항체를 유도할 수 없는 것으로 보고된 바 있다.
이에 있어 본 발명의 다가 백신 조성물은 재조합 P97 단백질을 포함하여 P97에 대한 항체를 유도할 수 있는 것을 특징으로 한다. 본 발명에 있어서, 백신 조성물에 포함되는 상기 재조합 P97 단백질은 돼지 마이코플라스마 하이오뉴모니애 유래 P97 유전자와 대장균 이열성 엔테로톡신 서브유닛 B(E. coli heat-labile enterotoxin subunit B, eltb) 유전자를 융합하여 제조될 수 있다. 보다 구체적으로, E. coli의 eltb와 마이코플라스마 하이오뉴모니애 P97 유전자의 C-말단 반복 서열인 R1과 R1R2를 융합시키고, LTB와 융합된 P97 유전자인 ltbR1과 ltbR1R2를 중합효소연쇄반응(PCR)에 의해 증폭하여 제조될 수 있다. 상기 재조합 P97 단백질은 하기 서열번호 1로 표시되는 아미노산 서열로 이루어진 것을 특징으로 할 수 있다.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFAPQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTETKIDKLCVWNNKTPNSIAAISLEGIPTKEGKREEVDKKVKELDNKIKGILPQPPAAKPEAAKPVAAKPEAAKPVAAKPEAAKPEAAKPVAAKPEAAKPVAAKPEAAKPVATNEGTPNQGKKAEGAPNQGKKAEGAPSQGKKAEGASNQQSPTTELTNYLPELGKKIDEIIKKQGKNWKTEVELIEDNIAGDAKLLYFVLRDDSKSGDPKKSSLKVKITVKQSNNNQELKSK (서열번호 1).
본 발명의 재조합 P97 단백질은 서열번호 1의 아미노산 서열과 적어도 70%, 80%, 90%, 95%, 98% 또한 바람직하게는 적어도 99%의 상동성을 가지는 폴리펩타이드를 모두 포함할 수 있다. "상동성 (homology)"은 단백질 또는 폴리뉴클레오티드 서열들 간 유사도의 측정을 의미한다. 이들 폴리펩타이드는 서열번호 1의 아미노산 서열과 비교하여 적어도 하나의 아미노산의 결실, 부가 또는 치환을 가질 수 있다. 점수로 매겨진 두 가지 서열들 간 상동성의 정도는 일치도의 퍼센트(percentage of identities) 및/또는 서열의 치환을 보존하는 것에 근거한다.
더불어 상기 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질은 하기와 같이 제조할 수 있다. 돼지의 혈청에서 분리한 PCV2d DNA의 ORF2 유전자를 pFastBac1 vector(Gibco, USA)에 삽입하여 재조합 Bacmid DNA를 제조한 후, 이를 ExpiSf9 cell(Gibco)에 트랜스펙션(Transfection)하여 재조합 베큘로바이러스를 제작할 수 있다. 본 발명의 PCV2 유래 재조합 단백질은 서열번호 2로 표시되는 아미노산 서열로 이루어진 것을 특징으로 할 수 있다.
MTYPRRRFRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTIGYTVKKTTVRTPSWNVDMMRFNINDFLPPGGGSNPLTVPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKANALTYDPYVNYSSRHTITQPFSYHSRYFTPKPVLDRTIDYFQPNNKRNQLWLRLQTTGNVDHVGLGTAFENSIYDQGYNIRITMYVQFREFNLKDPPLNPK (서열번호 2).
본 발명의 PCV2 유래 재조합 단백질은 서열번호 2의 아미노산 서열과 적어도 70%, 80%, 90%, 95%, 98% 또한 바람직하게는 적어도 99%의 상동성을 가지는 폴리펩타이드를 모두 포함할 수 있다. "상동성 (homology)"은 단백질 또는 폴리뉴클레오티드 서열들 간 유사도의 측정을 의미한다. 이들 폴리펩타이드는 서열번호 2의 아미노산 서열과 비교하여 적어도 하나의 아미노산의 결실, 부가 또는 치환을 가질 수 있다. 점수로 매겨진 두 가지 서열들 간 상동성의 정도는 일치도의 퍼센트(percentage of identities) 및/또는 서열의 치환을 보존하는 것에 근거한다.
본 발명의 재조합 단백질들은 백신의 제조에 사용되는 경우, 정제된 단백질 형태로 백신에 첨가되거나 대장균에서 발현하여 정제되지 않은 상태인 용균액 상태로 포함될 수 있다.
본 발명에 따른 다가 백신 조성물에 포함되는 마이코플라스마 하이오뉴모니애 균주 및 돼지 마이코플라스마 하이오라이니스 균주는 마이코플라스마성 폐 병변을 가진 돼지 개체로부터 분리하거나, 공지된 균주를 제한없이 사용할 수 있고, 각각 또는 모두 불활화된 것을 특징으로 할 수 있으며, 불활화는 당 분야에 공지된 방법을 제한없이 사용할 수 있다.
본 발명에 따른 다가 백신 조성물에 있어서, 마이코플라스마 하이오뉴모니애는 1×108 내지 1×109 CCU (Colour-changing units)/mL의 농도로 백신에 포함될 수 있으며, 바람직하게는 1.5×108 내지 5×108 CCU/mL, 더욱 바람직하게는 2×108 CCU/mL의 농도로 포함될 수 있다. 이 때, 백신 접종량은 2mL인 것이 바람직하다.
본 발명에 따른 다가 백신 조성물에 있어서, 마이코플라스마 하이오라이니스는 1×108 내지 1×109 CCU (Colour-changing units)/mL의 농도로 백신에 포함될 수 있으며, 바람직하게는 1.5×108 내지 5×108 CCU/mL, 더욱 바람직하게는 2×108 CCU/mL의 농도로 포함될 수 있다. 이 때, 백신 접종량은 2mL인 것이 바람직하다.
본 발명에 따른 다가 백신 조성물에 있어서, 돼지 마이코플라스마 하이오뉴모니애 유래 재조합 P97 단백질은 10 내지 100 μg/dose의 농도로 백신에 포함될 수 있으며, 바람직하게는 20 내지 50 μg/dose, 더욱 바람직하게는 최소 25 μg/dose의 농도로 포함될 수 있다. 이 때, 백신 접종량은 2mL인 것이 바람직하다.
본 발명에 따른 다가 백신 조성물에 있어서, 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질은 0.1 내지 1000 μg/dose의 농도로 백신에 포함될 수 있으며, 바람직하게는 10 내지 30 μg/dose, 더욱 바람직하게는 20 μg/dose의 농도로 포함될 수 있다. 이 때, 백신 접종량은 2mL인 것이 바람직하다.
본 발명의 다가 백신 조성물은 상기 백신의 면역원성을 증진시켜 최소한의 투여로도 보호 면역을 유도할 수 있는 면역강화제로서, 보조제 혼합물 및 하나 이상의 약제학적 또는 수의학적으로 허용되는 담체, 부형제 또는 희석제를 포함할 수 있다. 상기 “약제학적 또는 수의학적으로 허용되는” 이란 생리학적으로 허용되고 동물에게 투여될 때, 통상적으로 위장장애, 현기증과 같은 알레르기 반응 또는 이와 유사한 반응을 일으키지 않는 조성물을 말한다. 상기 담체, 부형제 및 희석제의 예로는, 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다. 또한, 충진제, 항응집제, 윤활제, 습윤제, 향료, 유화제 및 방부제 등을 추가로 포함할 수 있다. 사용하기에 적합한 담체로는 식염수, 인산염 완충 식염수, 최소 필수 배지(MEM) 또는 HEPES 완충액의 MEM을 포함하는 수성 매질을 들 수 있으나, 이에 제한되는 것은 아니다. 본 발명의 일 실시예에서는 안전성 및 면역지속성을 고려하여 IMS 계열 부형제인 IMS1313을 사용하였다.
더불어 본 발명의 다가 백신 조성물은 백신 조성물을 구성하는데 적절한 하나 이상의 면역증강제를 포함할 수 있다.
본 발명의 조성물에 포함될 수 있는 면역증강제는 주사한 동물의 면역 반응을 증대시키는 물질을 의미하는 것으로, 다수의 상이한 면역증강제가 기술 분야의 당업자에게 공지되어 있다. 상기 면역증강제는 프로인트 완전 및 불완전 면역 증강제, 비타민 E, 비이온성 차단 폴리머, 뮤라밀디펩티드, Quil A, 광유 및 무광물유 및 카보폴(Carbopol), 유중수형 유제 면역증강제 등을 포함하며, 이에 제한되는 것은 아니다.
또한, 본 발명의 다가 백신 조성물은 포유동물에 투여된 후 활성 성분의 신속, 지속 또는 지연된 방출을 제공할 수 있도록 당업계에 공지된 방법을 사용하여 제형화될 수 있다. 제형은 분말, 과립, 정제, 에멀젼, 시럽, 에어로졸, 연질 또는 경질 젤라틴 캅셀, 멸균 주사용액, 멸균 분말 등의 형태일 수 있다. 본 발명의 다가 백신 조성물은 근육, 피하, 경피, 정맥, 비강내, 복강내 또는 경구 경로로 투여될 수 있고 바람직하게는 근육내 또는 피하 경로로 투여될 수 있다. 백신의 투여량은 투여 경로, 동물의 연령, 성별, 체중 및 중증도 등의 여러 인자에 따라 적절히 선택될 수 있다.
또한, 본 발명의 다가 백신 조성물은 재조합 단백질 P97 및 PCV2 유래 재조합 단백질의 제조와 같이 본 발명에 특이적인 방법을 제외하고는 당해 기술 분야의 표준 방법에 의해 제조될 수 있다. 가령, 유기체는 완전 배지와 같은 배양 배지에서 증식시킬 수 있고, 유기체의 증식은 색 변화 단위(CCU)를 측정하는 것과 같은 표준 기술로 모니터하고 충분히 높은 역가가 성취된 경우 수거될 수 있다. 스톡(stock)은 제형화를 위해 백신에 포함되기 전에 통상적인 방법에 의해 추가로 농축되거나 동결건조시킬 수 있다.
또한 본 발명은 본 발명에 따른 다가 백신 조성물을 돼지에 접종하는 단계;를 포함하는 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방 방법을 제공한다.
상기 돼지는 마이코플라스마 및/또는 돼지 써코바이러스에 감염될 가능성이 있는 개체를 제한없이 포함할 수 있으며, 이와 같은 감염 예방 방법은 다른 당 분야에 공지된 치료 방법 또는 예방 방법과 함께 병행하여 이용할 수 있다. 본 발명에서 사용되는 용어 "접종"은 임의의 적절한 방법으로 개체에게 소정의 본 발명의 조성물을 제공하는 것을 의미한다.
본 발명에 따른 다가 백신 조성물은 1 내지 5주령에 1회 접종을 실시할 수 있고, 보다 바람직하게는 3주령에 1회 접종을 실시할 수 있다.
본 발명의 예방 방법은 돼지에 있어 상기 돼지 마이코플라스마균 및/또는 돼지 써코바이러스에 의해서 야기될 수 있는 감염성 질환의 발병을 예방하는 것을 목적으로 한다.
또한 본 발명은 (i) 돼지 마이코플라스마 하이오뉴모니애 (Mycoplasma hyopneumoniae, Mhp) 균주; (ii) 돼지 마이코플라스마 하이오라이니스(Mycoplasma hyorhinis, Mhr) 균주; (iii) 돼지 마이코플라스마 하이오뉴모니애 유래 재조합 P97 단백질; 및 (iv) 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질;을 포함하는, 돼지 마이코플라스마균 및 돼지 써코바이러스 감염에 의한 질환 예방용 약학적 조성물을 제공한다.
상기 돼지 마이코플라스마균 및 돼지 써코바이러스 감염에 의한 질환은 돼지 호흡기 복합증후군(Porcine Respiratory Disease Complex, PRDC), 돼지유행성폐렴(enzootic pneumonia, EP), 이유자돈 전신성 소모성 증후군 (postweaning multisystemic wasting syndrome, PMWS), 돼지 피부염 신부전 증후군(porcine dermatitis and nephropathy syndrome, PDNS), 모돈유산 폐사 증후군(sow abortion and mortality syndrome, SAMS), 돼지 생식기 및 호흡기 증후군(Porcine Reproductive and Respiratory Syndrome, PRRS), 가성 광견병 (pseudorabies), 글래서병 (Glasser's disease), 연쇄구균성 수막염(streptococcal meningitis), 살모넬라증(salmonellosis), 이유후 대장균증(postweaning colibacillosis), 식이성 간증 (dietetic hepatosis), 화농성 기관지폐렴(suppurative bronchopneumonia), 유스타키오관(Eustachian tube) 염증, 다발성 장막염(polyserositis), 마이코플라스마성 폐렴 및 흉막 폐렴으로 이루어진 군에서 선택된 어느 하나 이상일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 약학적 조성물은 경구 또는 비경구 투여가 바람직하다.
경구 투여의 경우, 구강 내 투여를 포함하며, 본 발명의 약학적 조성물은 이들로 한정되는 것은 아니지만 환제, 당의정, 캡슐, 액제, 겔, 시럽, 슬러리, 현탁제를 포함하여 경구적으로 허용되는 어떠한 형태로도 경구 투여될 수 있다.
경구용 정제의 경우, 흔히 사용되는 담체로는 락토즈 및 옥수수 전분이 포함된다. 마그네슘 스테아레이트와 같은 윤활제가 또한 전형적으로 첨가된다. 캡슐형으로 경구 투여하는 경우 유용한 희석제로는 락토즈 및 건조된 옥수수 전분이 포함된다. 수성 현탁액이 경구 투여될 때 활성 성분은 유화제 및 현탁화제와 배합된다. 필요한 경우, 감미제 및/또는 풍미제 및/또는 착색제가 첨가될 수 있다.
구강 내 투여를 위한 약학적 조성물은 고체상의 부형제와 함께 활성 성분을 혼합함으로써 제조할 수 있으며 정제 또는 당의정 형태로 제조하기 위해 과립형태로 제조할 수 있다. 적합한 부형제로는 락토스, 수크로스, 만니톨 및 소비톨과 같은 슈가 형태 또는 옥수수, 밀가루, 쌀, 감자 또는 다른 식물로부터 전분, 메틸 셀룰로스, 하이드로시프로필메틸-셀룰로스 또는 나트륨 카복시메틸세룰로스와 같은 셀룰로스, 아라빅 검, 타가칸쓰 검을 포함하는 검류와 같은 카보하이드레이트 또는 젤라틴, 콜라겐과 같은 단백질 필러를 사용할 수 있다. 필요한 경우에는, 교차결합된 폴리비닐피롤리돈, 아가 및 알긴산 또는 나트륨 알긴산과 같은 각각의 염 형태의 붕해제 또는 용해제를 첨가할 수 있다.
본 발명에 있어서, “비경구”는 피하, 피내, 정맥 내, 근육내, 관절내, 활액낭내, 흉골내, 경막내, 병소내 및 두개골내 주사 또는 주입 기술을 포함한다.
본 발명의 약학적 조성물은 멸균 주사용 수성 또는 유성 현탁액으로서, 멸균 주사용 제제의 형태일 수 있다. 이 현탁액은 적합한 분산제 또는 습윤제(예, 트윈 80) 및 현탁화제를 사용하여 본 분야에 공지된 기술에 따라 제형될 수 있다. 멸균 주사용 제제는 또한 무독성의 비경구적으로 허용되는 희석제 또는 용매 중의 멸균 주사용액 또는 현탁액(예, 1,3-부탄디올중의 용액)일 수 있다. 허용적으로 사용될 수 있는 비히클 및 용매로는 만니톨, 물, 링겔 용액 및 등장성 염화나트륨 용액이 있다. 또한, 멸균 불휘발성 오일이 통상적으로 용매 또는 현탁화 매질로서 사용된다. 이러한 목적을 위해, 합성 모노 또는 디글리세라이드를 포함하여 자극성이 적은 어떠한 불휘발성 오일도 사용할 수 있다. 올레산 및 이의 글리세라이드 유도체와 같은 지방산이 약제학적으로 허용되는 천연 오일(예, 올리브유 또는 피마자유), 특히 이들의 폴리옥시에틸화된 것과 마찬가지로 주사 제제에 유용하다. 더불어 비경구적 투여의 경우 본 발명의 약학적 조성물은 수용성 용액으로 제조할 수 있다. 바람직하게는, 한스 용액 (Hank's solution), 링거 용액 (Ringer's solution) 또는 물리적으로 완충된 염수와 같은 물리적으로 적절한 완충용액을 사용할 수 있다. 수용성 주입 (injection) 현탁액은 소디움 카복시메틸 셀루로스, 솔비톨 또는 덱스트란과 같이 현탁액의 점도를 증가시킬 수 있는 기질을 첨가할 수 있다. 덧붙여서, 활성 성분의 현탁액은 적합한 유질의 주입 현탁액 (oily injection suspensions)으로 제조될 수 있다. 적합한 친지성 용매 또는 담체는 참기름과 같은 지방산 또는 에틸 올레이트, 트리글리세라이드 또는 리포솜과 같은 합성 지방산 에스테르를 포함한다. 복수 양이온성 비지질 아미노 폴리머(polycationic amino polymers)도 운반체로서 사용될 수 있다. 임의로, 현탁액은 화합물의 용해도를 증가시키고 고농도의 용액을 제조하기 위해 적합한 안정화제 또는 약제를 사용할 수 있다.
본 발명의 약학적 조성물은 또한 직장 투여를 위한 좌제의 형태로 투여될 수 있다. 이들 조성물은 본 발명의 (i) 돼지 마이코플라스마 하이오뉴모니애 (Mycoplasma hyopneumoniae, Mhp) 균주; (ii) 돼지 마이코플라스마 하이오라이니스(Mycoplasma hyorhinis, Mhr) 균주; (iii) 돼지 마이코플라스마 하이오뉴모니애 유래 재조합 P97 단백질; 및 (iv) 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질을 혼합한 혼합물과, 실온에서 고형이지만 직장 온도에서는 액상인 적합한 비자극성 부형제를 혼합하여 제조할 수 있다. 이러한 물질로는 이들로 한정되는 것은 아니지만 코코아 버터, 밀랍 및 폴리에틸렌 글리콜이 포함된다.
본 발명의 약학적 조성물을 피부에 국소적으로 적용하는 경우, 상기 약학적 조성물은 담체에 현탁 또는 용해된 활성 성분을 함유한 적합한 연고로 제형되어야 한다. 본 발명의 (i) 돼지 마이코플라스마 하이오뉴모니애 (Mycoplasma hyopneumoniae, Mhp) 균주; (ii) 돼지 마이코플라스마 하이오라이니스(Mycoplasma hyorhinis, Mhr) 균주; (iii) 돼지 마이코플라스마 하이오뉴모니애 유래 재조합 P97 단백질; 및 (iv) 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질을 혼합한 혼합물을 국소 투여하기 위한 담체로는 이들로 한정되는 것은 아니지만 광유, 유동 파라핀, 백색 바셀린, 프로필렌 글리콜, 폴리옥시에틸렌, 폴리옥시프로필렌 화합물, 유화 왁스 및 물이 포함된다. 또한 본 발명의 약학적 조성물은 담체에 현탁 또는 용해된 활성 화합물을 함유한 적합한 로션 또는 크림으로 제형될 수 있다. 적합한 담체로는 이들로 한정되는 것은 아니지만 광유, 솔비탄 모노스테아레이트, 폴리솔베이트 60, 세틸 에스테르 왁스, 세테아릴 알코올, 2-옥틸도데카놀, 벤질 알코올 및 물이 포함된다. 본 발명의 약학적 조성물은 또한 직장 좌제에 의해 또한 적합한 관장제로 하부 장관으로 국소 적용할 수 있다. 국소 적용된 경피 패치가 또한 본 발명에 포함된다.
본 발명의 약학적 조성물은 비내 에어로졸 또는 흡입에 의해 투여할 수 있다. 이러한 조성물은 약제의 분야에 잘 알려진 기술에 따라 제조하며 벤질알코올 또는 다른 적합한 보존제, 생체이용률을 증가시키기 위한 흡수 촉진제, 플루오로카본 및/또는 기타 본 분야에 알려진 가용화제 또는 분산제를 사용하여 염수중의 용액으로서 제조할 수 있다.
특정 개체에 대한 특정 유효량은 사용된 (i) 돼지 마이코플라스마 하이오뉴모니애 (Mycoplasma hyopneumoniae, Mhp) 균주; (ii) 돼지 마이코플라스마 하이오라이니스(Mycoplasma hyorhinis, Mhr) 균주; (iii) 돼지 마이코플라스마 하이오뉴모니애 유래 재조합 P97 단백질; 및 (iv) 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질을 혼합한 혼합물의 활성, 연령, 체중, 일반적인 건강, 성별, 규정식, 투여시간, 투여경로, 배출율, 약물 배합 및 예방 또는 치료될 특정 질환의 중증을 포함한 여러 요인에 따라 변할 수 있다.
상술한 본 발명의 내용은 상호 모순되지 않는 한, 서로 동일하게 적용되며, 당해 기술분야의 통상의 기술자가 적절한 변경을 가해 실시하는 것 또한 본 발명의 범주에 포함된다.
이하 본 발명을 실시예를 통해 상세하게 설명하나 본 발명의 범위가 하기 실시예로만 한정되는 것은 아니다.
실시예 1. 다가 백신 조성물의 항원 제작
1-1. 마이코플라스마 하이오뉴모니애 불활화 항원의 제작
마이코플라스마 하이오뉴모니애(M. hyopneumoniae, 이하 Mhp)와 마이코플라스마 하이오라이니스 (Mycoplasma hyorhinis, 이하 Mhr) 균주를 돼지의 마이코플라스마성 폐병변을 나타내는 폐에서 분리하였고, PCR을 이용하여 각 균주를 동정하였다.
분리한 Mhp와 Mhr 균주는 Friis' 배지를 사용하여 5% CO2, 37℃의 조건에서 3일간 배양하였다. 단백질 패턴 분석과 다형성 DNA의 무작위 증폭 (Random amplification of polymorphic DNA, RAPD) 분석을 통하여 분리된 균주가 Mhp 또는 Mhr임을 확인하였다. 3일간 배양된 균액은 대략 0.1 ~ 5.0 × 109 CCU/mL의 세균 수를 보유하였다. 배양된 균액은 pH를 약 7.8로 맞춘 후 BEI(Binary ethyleneimine)와 같은 불활화 시약을 이용하여 최종 4 mM의 농도로 20 ~ 24시간동안 균의 불활화를 진행하였다. BEI는 배양액에 BEA(L-bromoethylaminehydrobromide (Sigma-Aldrich, St. Louis, MO, USA))를 첨가하여 제조하였다. 그 후 중화 시약인 티오황산나트륨(sodium thiosulfate (Sigma-Aldrich, St. Louis, MO, USA))을 최종 16 mM의 농도로 혼합하여 20~24시간동안 중화시키고 불활화된 배양액 일부를 새 배지에 첨가하여 37℃에서 최소 일주일간 배양하며 불활화되었는지 확인하였다. 불활화된 배양액은 원심분리법으로 농축하여 백신 항원으로 사용하였다.
1-2. 재조합 Mhp P97 단백질 항원의 제작
재조합 P97 단백질은 마이코플라스마 하이오뉴모니애의 P97 유전자에 eltb 유전자를 융합한 후 pET-30a(+) (Novagen, USA) 발현 시스템을 이용하여 제작하였다. 요약하면, E. coli BL21 codon-plus RIL competent cell (Novagen)에 열충격을 이용하여 재조합 플라스미드로 형질전환시킨 후 50 μg/mL 카나마이신 (Kanamicin)이 첨가된 1L의 LB(Luria-Bertani) 배지에서 배양하였다. 그 후, 1 mM의 IPTG(isopropyl-β-D-1-thiogalactopyranoside)를 혼합하여 20시간 동안 단백질 발현을 유도한 후 파쇄하고 원심분리하여 상층액에서 재조합 단백질이 포함된 용균액을 얻었다.
수득한 단백질 항원은 하기 2가지 방법으로 정제하였다. 첫 번째로, 재조합 단백질이 포함된 용균액을 Ni-NTA 컬럼에 친화력을 이용하여 결합시킨 후 정제버퍼(50mM NaH2PO4, 300mM NaCl)로 5CV(컬럼 레진 용량(Column resin volume)의 5배)만큼 세척하여 결합하지 않은 단백질을 제거하였다. 이후 40mM의 이미다졸(Imidazole)이 포함된 정제버퍼로 5CV만큼 비특이적 결합한 단백질을 제거하였고, 400mM의 이미다졸이 포함된 정제버퍼로 재조합 P97 단백질 항원을 용출하여 회수하였다. 회수한 단백질은 용량에 따라 여과하여 농축하였다. 정제된 단백질 항원은 BCA(Bicinchoninic acid) 방법으로 정량하였고, SDS-PAGE(sodium dodecyl sulphate-polyacrylamide gel electrophoresis) 방법으로 순도를 확인하였다.
두 번째로, 재조합 단백질이 포함된 용균액의 pH를 6.0로 적정하고 약 2시간동안 교반하여 반응시켰다. 이후 원심분리하여 단백질 항원을 침전시켰고, pH 7.2의 PBS(phosphate buffer saline)를 첨가하여 단백질을 회수하였다. 정제된 단백질은 BCA 방법으로 정량하였고, SDS-PAGE 방법으로 순도를 확인하였다.
상기와 같이 정제된 재조합 P97 단백질의 아미노산 서열은 서열번호 1에 나타내었다.
1-3. 재조합 PCV2d 캡시드 단백질 항원의 제작
1-3-1. 세포 및 균주 준비
PCV-free PK-15 세포는 10% FBS(fetal bovine serum (GenDEPOT))와 1% 항생제-항진균 용액(antibiotic-antimycotic solution (Gibco))이 첨가된 DMEM(Dulbecco's modified Eagle medium (GenDEPOT, Katy, TX, USA)) 배지에서 37℃, 5% CO2 조건에서 배양하였다. 단백질 발현에 사용한 곤충세포(ExpiSf9, Gibco)는 28℃, rpm 100 조건으로 ExpiSf CD medium (Gibco)을 사용하여 진탕배양하였다.
PCV2d 유전형의 ORF2 염기서열은 2017년 충청남도 논산시에 위치한 양돈농가에서 분리된 PCV2d의 바이러스 DNA를 주형으로 증폭되었으며, PCV2d에 대한 바이러스 중화시험은 PCV2에 감염 판정된 돼지의 림프절과 폐 조직으로부터 PCV2d를 분리 및 계대배양하여 사용하였다.
1-3-2. 재조합 배큘로바이러스의 제작
재조합 배큘로바이러스를 제조업체가 권장하는 사용자 지침에 따라 배큘로바이러스 발현 시스템(Baculovirus Expression System (Gibco))을 사용하여 제작하였다. 요약하면, PCV2d의 ORF2 유전자를 정방향 프라이머 (5'-CGCGGATCCGCCGCCACCATGACGTATCCAAGGAGG-3'(서열번호 3))와 역방향 프라이머 (5'-GGCAAGCTTTCATTTAGGGTTAAGTGG-3'(서열번호 4))를 TOPsimple DyeMIX-Forte (Enzynomics Inc., Daejeon, Korea)와 같이 사용하여 증폭하였다. 증폭한 PCV2 캡시드(PCV2 CP) 유전자를 제한효소인 BamHI과 HindIII(Enzynomics Inc.)로 절단하고, HiYield Gel/PCR DNA Extraction Kit (RBC Bioscience, Taipei, Taiwan)를 사용하여 정제한 후 pFastBac1 (pFB) (Gibco) 베큘로바이러스 벡터에 클로닝하였다. 재조합 pFB-2dCP를 competent Escherichia coli DH10BacTM(Gibco)에 삽입하여 형질전환하고, 염기서열을 분석하였다. 재조합 bacmid DNA는 ExpiFectamine reagent (Gibco)를 이용하여 ExpiSf9 세포에 트랜스펙션을 실시하였다. 이를 28℃, 100 rpm 조건에서 5일간 진탕배양하여 PCV2d ORF2를 발현하는 재조합 베큘로바이러스(Bac-2dCP)를 확보하였다. RibospinTM vRD(GeneAll)를 이용하여 바이러스 DNA를 추출한 후 실시간 중합효소연쇄반응(Real-time quantitative polymerase chain reaction, qPCR)으로 상기 재조합 베큘로바이러스의 역가를 측정한 결과, 1.48×1011 copies/mL을 나타냈다.
1-3-3. 발현된 재조합 단백질의 정제
ExpiSf9 세포에 재조합 베큘로바이러스를 감염다중도(Multiplicity of infection, MOI) 5의 농도로 감염시킨 후 배양하였다. 배양 5일에 1,000 x g의 속도로 5분간 원심분리하여 세포를 수확하였다. 발현된 재조합 단백질은 음이온 교환 크로마토그래피 컬럼을 사용하여 정제하였다. 요약하면 수확한 세포를 50 mM NaH2PO4.2H2O(sodium dihydrogen phosphate dihydrate), 300 mM NaCl(sodium chloride), 1% IGEPAL CA-630(Sigma-Aldrich, St. Louis, MO, USA)이 포함된 용해버퍼에 재현탁시켰다. 이를 30분동안 얼음에서 반응시킨 뒤 10,000 x g로 10분동안 원심분리하였다. 재조합 단백질이 포함된 상층액을 Q Sepharose Fast Flow (GE Healthcare, Madison, WI, USA) 이온교환 플랫폼에서 정제한 후 0.22 μm 크기의 필터를 통해 여과하였다. 상기와 같이 정제된 PCV2 유래 재조합 단백질의 아미노산 서열은 서열번호 2에 나타내었다.
더불어 상기 PCV2 유래 재조합 단백질을 한국 기초과학 연구원 춘천센터에서 투과전자현미경(TEM; JEM-2100F; JEOL, Tokyo, Japan)을 이용하여 관찰한 결과 도 1과 같이, 약 17 nm 직경의 PCV2 바이러스 유사입자(Virus-like particle, VLP)가 형성된 것을 확인하였다.
1-3-4. 재조합 단백질 발현 분석
정제된 재조합 단백질을 12% 겔에 주입하여 SDS-PAGE를 시행하였으며 반건조 이송 기기(semidry transfer apparatus (Bio-Rad, Hercules, CA, USA))를 이용하여 하이본드 폴리비닐피롤리돈 멤브레인(Hybond polyvinylpyrrolidone membrane (Amersham Biosciences, Freiburg, Germany))으로 트랜스퍼하였다. 돼지 항-PCV2 항체(porcine anti-PCV2 antibody (1:500 희석))와 HRP-결합된 염소 항-돼지 IgG 항체(HRP(horseradish peroxidase)-conjugated goat anti-porcine IgG antibody ((1:5,000 희석) (Bethyl Laboratories, Montgomery, TX, USA))를 이용하여 웨스턴 블롯을 수행한 결과 약 28kDa의 단백질 밴드를 확인하였다.
1-4. 본 발명에 따른 다가 백신 조성물의 제조
2 x 108 CCU/dose 이상 농도의 상기 실시예 1-1을 통해 제조한 Mhp 및 Mhr 불활화 균주 항원과 상기 실시예 1-2를 통해 제조한 25 μg/dose 이상 농도의 재조합 P97 단백질 항원, 상기 실시예 1-3을 통해 제조한 20μg/dose 농도의 재조합 PCV2d 캡시드 단백질 항원을 2X PBS에 혼합한 후(1mL/dose), 20분 이상 교반하여 혼합하였다. 그런 후, 동일 용량의 보조제(adjuvant (IMS1313, Seppic))를 추가하고 20분 이상 교반하여 다가 백신 조성물을 제조하였다.
실시예 2. 실험 동물 준비
2-1. 마우스 준비
체중 15g의 BALB/c 암컷 마우스 5마리에 본 발명에 따른 다가 백신 조성물(Mhp+Mhr+재조합 P97 단백질+재조합 PCV2 캡시드 단백질 조합)을 접종하였다. 본 발명에 따른 다가 백신(돼지용량의 1/10두분인 200 μL/dose)을 마우스 양쪽 뒷다리의 허벅지 근육 내로 접종하였다. 혈액 샘플은 접종 후 0, 2, 4, 6주에 수집하여 혈청학적 분석을 위해 -70 ℃에 보관하였다가 실험에 사용하였다.
2-2. 기니피그 준비
체중 300~350g의 기니피그 4마리에 본 발명에 따른 다가 백신 조성물(Mhp+Mhr+재조합 P97 단백질+재조합 PCV2 캡시드 단백질 조합)을 접종하였다. 더불어 기니피그 4마리에 대조군인 PCV2 단독 백신을 접종하였다. 각각의 실험군 기니피그 뒷다리의 허벅지 근육 내로 각 백신(돼지용량의 1/2두분인 1 mL/dose)을 접종하였다. 혈액 샘플은 접종 후 0, 2, 4, 6주에 수집하여 혈청학적 분석을 위해 -70 ℃에 보관하였다가 실험에 사용하였다.
2-3. 돼지 준비
체중 5~8 Kg의 돼지 5마리에 본 발명에 따른 다가 백신 조성물 (Mhp+Mhr+재조합 P97 단백질+재조합 PCV2 캡시드 단백질 조합)을 접종하였다. 각 돼지의 목 부위 근육 내로 본 발명에 따른 백신(2 mL/dose)을 접종하였다. 혈액 샘플은 접종 후 0, 4, 9, 14, 17주에 수집하여 혈청학적 분석을 위해 -70 ℃에 보관하였다가 실험에 사용하였다. 또한 사이토카인(cytokine) 분석을 위해 접종 후 0, 4, 9, 14주에 경정맥에서 채혈하여 말초 혈액 단핵세포(Peripheral blood mononuclear cell, PBMC)를 분리한 뒤 항원으로 자극하여 형성된 IFN-γ를 분석하였다.
실시예 3. 본 발명에 따른 다가 백신 조성물의 효과 검정 방법
3-1. 효소 결합 면역 흡착분석법(Enzyme-liked immunosorbent assay, ELISA)
본 발명에 따른 다가 백신 조성물의 접종에 따른 혈청학적 분석을 위해 간접효소면역측정법(indirect ELISA)을 수행하였다. 보다 구체적으로 Mhp(마우스에서 확인(재조합 P46 단백질)), 재조합 P97 단백질(돼지 및 마우스에서 확인), PCV2(기니피그 및 돼지에서 확인)에 대한 특이적인 IgG 항체역가를 조사하였다. 요약하면, 재조합 P97 단백질 (100ng/well), 재조합 P46 단백질(125ng/well) 또는 재조합 PCV2 캡시드 단백질(100 ng/well)을 각각의 농도로 0.05 M 카보네이트 버퍼(carbonate buffer (pH 9.6))에 희석하여 96-웰 마이크로플레이트(Nunc Maxisorp, Roskilde, Denmark)에 100 μL/well씩 분주한 후 4 ℃에서 16시간동안 코팅하였다. 각 웰은 PBS(phosphate-buffered saline)-T (0.05% Tween 20)으로 3회 세척하고 1% BSA가 첨가된 PBS를 첨가한 후 37℃에서 2 시간 동안 반응시켰다. 그 다음 PBS-T로 3회 세척하고 1:100로 희석한 혈청을 100 μL씩 분주하고 37℃에서 2 시간 동안 반응시켰다. 그 후 PBS-T로 3회 세척하고 플레이트에 HRP-결합된 염소 항-마우스(HRP-conjugated goat anti-mouse (또는 항-기니피그(anti-guinea pig) 또는 항-돼지(anti-pig)) IgG 항체(1:10,000 희석; Bethyl Laboratories)를 분주하고 37 ℃에서 1 시간동안 반응시켰다. 이를 PBS-T로 3회 세척한 후 각 웰에 TMB(3,3',5,5'-tetramethylbenzidine) 기질(TMB One Component HRP Microwell Substrate (Surmodics, Inc., Eden Prairie, MN, USA))을 분주하여 5분 동안 암반응시키고, 2N H2SO4로 반응을 중지시켰다. Epoch 마이크로플레이트 리더기(Epoch microplate reader (BioTek, Winooski, VT, USA))를 사용하여 450nm의 파장에서 각 플레이트의 흡광도(optical density, OD)를 측정하였다.
또한 본 발명에 따른 다가 백신의 접종에 따른 혈청학적 분석을 위해 샌드위치 ELISA(sandwich ELISA)를 수행하여 Mhr P37 단백질(마우스 및 돼지에서 확인)에 특이적인 IgG 항체역가를 조사하였다. 항-P37 IgG(Anti-P37 IgG(capture antibody))를 500 ng/mL의 농도로 카보네이트 버퍼에 희석하고 96 웰 마이크로플레이트의 각 웰에 100 μL/well씩 분주한 후 4 ℃에서 16시간동안 코팅시켰다. 코팅 용액을 제거하고 PBS-T로 3회 세척하고 각 웰에 블로킹 용액(Blocking solution)으로써 10% FBS를 포함하는 PBS-T을 200 μL씩 분주한 후 37 ℃에서 4 시간동안 반응시켰다. 블로킹 용액을 제거하고 0.05% PBST로 3회 세척하였다. 그 후, 재조합 P37 단백질을 500 ng/mL로 블로킹 용액에 희석한 후, 각 웰에 이를 100 μL씩 분주하고 37 ℃에서 1시간동안 재조합 P37 단백질과 항-P37 IgG를 반응시켰다. 그 동안 10% FBS 용액(100 ng E. coli 용해물(lysate)과 함께)에 마우스 또는 돼지 혈청을 1/100로 희석하고, 37℃에서 1시간동안 반응시켜 검사혈청을 준비하였다. 재조합 P37 단백질 용액을 제거하고 0.05% PBS-T로 3회 세척하였다. 검사혈청을 90 μL씩 상기 재조합 P37 단백질과 반응시킨 플레이트의 각 웰에 분주한 뒤 37 ℃에서 1시간동안 반응시켰다. 검사혈청을 제거하고 0.05% PBS-T로 3회 세척하였다. 항-마우스(또는 항-돼지) IgG HRP 결합물(conjugate)을 10% FBS 용액에 1/20,000로 희석하고 이를 100 μL씩 각각의 웰에 넣었다. 37 ℃에서 1 시간동안 반응시킨 후 용액을 제거하고 0.05 % PBS-T로 4회 세척하였다. 그 후 TMB 용액 100 μL씩 각각의 웰에 넣고 상온에서 5분간 암반응시켰다. 정지 용액(Stop solution)을 100 μL씩 각 웰에 분주한 후 즉시 450 nm에서 흡광도를 측정하였다.
더불어 본 발명에 따른 다가 백신의 접종에 따른 혈청학적 분석을 위해 IDEXX사의 MH kit를 사용하여 Mhp(돼지에서 확인)에 특이적인 IgG 항체역가를 조사하였다.
3-2. 바이러스 중화 실험(Virus Neutralization test, VN test)
PCV2 중화항체는 면역형광법(immunofluorescence assay, IFA)을 이용하여 측정하였다. 백신 접종 후 기니피그 또는 돼지의 0, 2, 4, 6주 혈청을 56 ℃에서 30 분 동안 가열하여 비동화시킨 후 DMEM에 2진 연속희석하고 이와 동일한 부피의 PCV2b 또는 PCV2d 바이러스(200 x 50% 조직배양감염량(tissue culture infective dose), TCID50)를 밀도 70-80 %가 되는 PK-15 세포에 접종한 후 5% CO2, 37℃에서 배양하였다. 72시간 후에 감염된 세포를 90% 아세톤으로 고정시키고, FITC(fluorescein isothiocyanate)-표지된 항-기니피그(또는 항-돼지) IgG (Bethyl Laboratories)를 첨가하여 반응하였다. 중화항체 역가는 형광현미경 하에 90% 이상의 바이러스 중화를 나타내는 최고 혈청의 희석배수로 결정하였다.
3-3. 인터페론 감마(interferon-gamma, IFN-γ) 측정
돼지에서의 본 발명에 따른 다가 백신 조성물에 대한 세포매개성 면역반응을 평가하기 위해 IFN-γ 분비량을 조사하였다. 본 발명에 따른 다가 백신 조성물을 접종한 후 0, 4, 9, 14주에 혈액에서 분리한 PBMC에 Mhp 불활화 또는 PCV2 항원으로 감작하여 72시간동안 반응시켰다. 이의 상층액을 분리하여 돼지 IFN-γ ELISA 키트 (Invitrogen, Lofer, Austria)로 제조사의 지침에 따라 IFN-γ 분비량을 측정하였다.
3-4. 통계적 분석
GraphPad Prism 7 software (Graph-Pad Software, Inc., La Jolla, CA, USA)를 사용하여 데이터를 분석하였고, Dunnett의 다중 비교 분석과 함께 일원 분산 분석(ANOVA)을 사용해 각 그룹을 비교하여 대조군과의 유의한 차이를 나타냈다. P 값이 0.05 미만인 경우 통계적으로 유의한 것으로 간주하였다.
실시예 4. 마우스에 접종 후 항체가 확인
4-1. Mhp에 대한 항체 형성 확인
돼지 마이코플라스마 백신 검정시험 동물인 마우스에 본 발명에 따른 다가 백신 조성물을 접종하고 0, 2, 4주차때 채혈하여 Mhp에 대한 항체가를 확인하였다. 이를 위하여, Mhp의 게놈이 암호화하는 것으로 알려진 면역우세 단백질(immunodominant protein)인 재조합 P46 단백질에 특이적인 IgG 항체 역가를 측정하였다. 그 결과 도 2와 같이, 본 발명에 따른 다가 백신이 Mhp, Mhr, 재조합 P97 단백질 및 재조합 PCV2 캡시드 단백질을 모두 포함하였음에도 Mhp에 대하여 정상적으로 항체가 형성되었고, 접종 주차에 따라 항체 역가가 증가됨을 확인하였다. 따라서 본 발명의 다가 백신을 접종시 다양한 항원에 의한 간섭 현상이 야기되지 않음을 확인하였다.
4-2. Mhp 재조합 P97 단백질에 대한 항체가 확인
돼지 마이코플라스마 백신 검정시험 동물인 마우스에 본 발명에 따른 다가 백신 조성물을 접종하고 0, 2, 4주차때 채혈하여 재조합 P97 단백질에 대한 항체가를 확인하였다. 그 결과 도 3에 나타낸 바와 같이, 앞선 결과와 마찬가지로 재조합 P97 단백질에 대한 항체가 정상적으로 형성되었으며, 2주차에 항체 생성이 급격히 증가하였고 4주차에도 높은 항체가를 보임을 확인하였다.
4-3. Mhr에 대한 항체 형성 확인
돼지 마이코플라스마 백신 검정시험 동물인 마우스에 본 발명에 따른 다가 백신 조성물을 접종하고 0, 2, 4주차때 채혈한 후 Mhr에 대한 항체가를 확인하였다. 이를 위하여, Mhr의 게놈이 암호화한다고 알려진 재조합 P37 단백질에 특이적인 IgG 항체 역가를 측정하였다. 그 결과 도 4와 같이, Mhr에 대하여 정상적으로 항체가 형성되었으며, 접종 주차에 따라 증가됨을 확인하였다.
상기와 같은 결과를 통해 본 발명의 Mhp+Mhr+재조합 P97 단백질+재조합 PCV2 캡시드 단백질 조합의 다가 백신 조성물은 돼지 마이코플라스마 백신 검정시험 동물인 마우스에서 상호 간섭 현상을 나타내지 않고, 각각의 항원에 대한 항체를 효과적으로 형성할 수 있음을 확인하였다.
실시예 5. 기니피그에 접종 후 항체가 확인
5-1. 재조합 PCV2 캡시드 단백질 항원에 대한 항체가 확인
기니피그에 본 발명에 따른 다가 백신 조성물 또는 PCV2 단독 백신을 접종하고 0, 2, 4, 6주차때 채혈한 후 재조합 PCV2 캡시드 단백질 항원에 대한 항체가를 확인하였다. 그 결과 도 5에 나타낸 바와 같이, 본 발명에 따른 다가 백신 조성물은 접종 2주째에 PCV2 단독 백신 접종군과 비교하여 유의적으로 높은 수준의 IgG 항체가를 나타냈다. 접종 4주째 모든 실험군이 가장 높은 피크(peak) 값을 보였으며, 전체적인 기간 동안 본 발명에 따른 다가 백신을 접종한 실험군이 더 높은 항체가를 보였다. 따라서 PCV2 단독 백신보다 본 발명에 따른 다가 백신 조성물을 접종하는 경우, 더 효과적으로 재조합 PCV2 캡시드 단백질 항원에 대한 항체가가 생성되는 것을 확인하였다.
5-2. PCV2b 또는 PCV2d에 대한 중화항체가 확인
기니피그에 본 발명에 따른 다가 백신 조성물 또는 PCV2 단독 백신을 접종하고 0, 2, 4, 6주차때 채혈한 후 PCV2b 또는 PCV2d 유전형에 대한 중화항체가를 확인하여 도 6 및 도 7에 나타내었다. 그 결과 PCV2 단독 백신 접종군 대비, 본 발명에 따른 다가 백신 조성물은 접종 후 전구간에서 PCV2b 또는 PCV2d 유전형에 대하여 동등 또는 약간 더 높은 중화항체가를 유도하는 것을 확인하였다. 특히, PCV2d에 대한 항체가가 PCV2b보다 높게 나타남을 확인하였다.
실시예 6. 돼지에 접종 후 항체가 확인
6-1. Mhp에 대한 항체가 확인
돼지에 본 발명에 따른 다가 백신 조성물을 접종하고 0, 4, 9, 14, 17주차때 채혈하여 Mhp에 대한 항체가를 확인하였다. 그 결과 도 8에 나타낸 바와 같이, 본 발명에 따른 다가 백신 조성물은 접종 9주 후부터 항체가가 증가하기 시작하여 17주까지 매우 높은 항체가를 유도함을 확인하였다.
6-2. Mhp 재조합 P97에 대한 항체가 확인
돼지에 본 발명에 따른 다가 백신 조성물을 접종하고 0, 4, 9, 14, 17주차때 채혈하여 재조합 P97 단백질에 대한 항체가를 확인하였다. 그 결과 도 9와 같이, 접종 4주만에 매우 높은 수준의 OD값을 나타내어 항체가 형성됨을 확인하였다. 특히 PCV2 항원을 추가함에 따른 P97 항원에 대한 항체가를 방해하는 현상은 나타나지 않음을 확인하였다.
6-3. Mhr에 대한 항체 확인
돼지에 본 발명에 따른 다가 백신 조성물을 접종하고 0, 4, 9, 14, 17주차때 채혈한 후 재조합 P37 단백질에 대한 항체가를 확인하여, Mhr에 대한 항체 형성을 확인하였다. 그 결과 도 10에 나타낸 바와 같이, 본 발명에 따른 다가 백신 조성물을 접종하였을 때 Mhr 유래 재조합 P37 단백질에 대한 항체를 우수하게 형성함을 확인하였다.
6-4. Mhp 감작에 따른 인터페론 감마(Interferon-gamma(IFN-gamma, IFN-γ)) 분비 확인
돼지에 본 발명에 따른 다가 백신 조성물을 접종하고 0, 4, 9, 14주차때 채혈한 후 Mhp 감작에 따른 IFN-γ 분비를 확인하였다. 그 결과 도 11과 같이, 접종 후 9주차부터 IFN-γ 분비량이 증가하면서 14주차까지 꾸준히 증가하는 경향을 확인하였다.
6-5. PCV2 감작에 따른 IFN-γ 분비 확인
돼지에 본 발명에 따른 다가 백신 조성물을 접종하고 0, 4, 9, 14주차때 채혈한 후 PCV2 감작에 따른 IFN-γ 분비를 확인하였다. 그 결과 도 12에 나타낸 바와 같이, 접종 후 9주차부터 IFN-γ 분비량이 증가하면서 14주차까지 꾸준히 증가하는 경향을 보였다. 특히 백신 접종 14주 후 높은 수준의 IFN-γ가 관찰되었다.
실시예 7. 본 발명에 따른 다가 백신 조성물의 안전성 평가
7-1. 돼지에서의 다가 백신 조성물 접종
본 발명에 따른 다가 백신 조성물에 대한 안전성 및 방어능을 평가하기 위하여, SPF(Specific pathogen free) 미니돼지(Miniature pig)를 대상으로 하기와 같은 조건의 실험군을 설정하였다.
Figure PCTKR2022003112-appb-img-000001
자돈이 3주령 되었을 때 채혈한 후 백신을 접종하였다(백신 접종 후 0주차). 더불어 5주령(백신 접종 후 2주차), 7주령(백신 접종 후 4주차), 9주령(백신 접종 후 6주 차), 11주령(백신 접종 후 8주차)에 채혈하였다. 또한 상기 7주령에 있어서, 채혈 후 공격접종을 실시하였으며, 11주령에 있어서, 안락사를 진행하여 림프절 및 폐 등의 병변을 확인하였다. 상기 공격접종으로는 보유하고 있는 PCV2d 분리주(HID9071, (역가: 105.5 TCID50/mL))를 비강으로 2 mL 접종하였다.
상기 접종용량과 접종 경로는 국가출하검정 시험 기준을 참고하여 설정하였으며, 보다 구체적으로 본 발명에 따른 다가 백신 조성물을 자돈 우측 목 근육으로 1회(2 mL/dose) 접종하였다. 상기 공격접종은 PCV2d 분리주 2 mL을 양쪽 비강을 통해 1 mL씩 주입하였다. 채혈은 0, 2 WPV(Weeks postvaccination)에 경정맥을 통해 5 mL씩 채혈하여 혈청을 분리하고 4, 6, 7, 8 WPV에는 경정맥을 통해 8 mL씩 채혈하여 PBMC와 혈청을 분리하였다.
7-2. 체중 측정
체중은 시험 기간 동안 매주 각 실험군의 체중을 측정하였다. 측정된 체중을 이용하여 하기 수학식 1을 통해 각 개체당 일당증체량(Average daily weight gain, ADWG)을 분석하였다.
[수학식 1]
일당증체량(Average daily weight gain, ADWG)= (측정 주 체중- 이전 주 체중)/7days
체중측정 결과 도 13 및 하기 표 2에 나타낸 바와 같이, 백신 접종 전(0 WPV) 모든 군은 평균 2.82 ~ 3.33 Kg 사이의 체중을 나타냈으며, 4 WPV에 본 발명에 따른 다가 백신 조성물 접종군(이하, 다가 백신 접종군으로 기재)은 평균 5.14 Kg으로 공격접종대조군(5.87 Kg)과 음성대조군(6.10 Kg)보다 약간 낮은 체중을 나타냈다. 그러나 공격접종 후 4주(8 WPV)의 체중은 공격접종대조군이 평균 9.05 Kg으로 가장 낮았으며, 다가 백신 접종군은 평균 9.29 Kg으로 음성대조군과 비교하여 유사한 수준의 체중을 나타냈다.
Figure PCTKR2022003112-appb-img-000002
ADWG 측정 결과 도 14 및 하기 표 3에 나타낸 바와 같이, 백신 접종부터 공격접종 전까지(0-4 WPV) 다가 백신 접종군은 평균 ADWG가 82.86 g으로 공격접종대조군(90.48 g)과 음성대조군(108.93 g)과 비교하여 큰 차이를 나타내지 않았다. 그러나 공격접종 이후부터 시험 종료시까지(5-8 WPV)에는 공격접종대조군이 평균 113.69 g으로 가장 낮았으며, 다가 백신 접종군은 평균 ADWG가 148.21 g으로 음성대조군(119.64 g)과 비교하여 더 높은 수준의 증체량을 나타냈다. 따라서 본 발명에 따른 다가 백신 조성물의 접종에 의해 식욕결핍(저하) 등의 부작용이 없음을 확인하였다.
Figure PCTKR2022003112-appb-img-000003
7-3. 임상 증상 또는 부작용 발생 여부 확인
본 발명에 따른 다가 백신 조성물을 접종하고 0, 4, 24, 48시간 후 직장 체온을 측정하였다. 더불어 7일 간 접종부위 부작용 및 임상 부작용을 관찰하였다.
상기 임상 부작용으로는 식욕 절폐, 활력 감소, 기침, 호흡곤란, 질식, 쇼크, 구토, 설사에 대해 확인하였다.
체온 측정 결과 하기 표 4와 같이, 본 발명에 따른 다가 백신 조성물을 접종하고 4시간 후 체온이 다소 상승하였으나, 24시간, 48시간이 지난 후에는 접종 전 수준으로 하강하였음을 확인하였다.
Figure PCTKR2022003112-appb-img-000004
더불어 임상 증상 확인 결과, 본 발명에 따른 다가 백신 접종군은 백신 접종에 따른 어떠한 임상 증상도 보이지 않았다. 그러므로 본 발명에 따른 다가 백신 조성물은 체온 및 임상 증상에 어떠한 영향도 미치지 않음을 확인하였다.
실시예 8. 본 발명의 다가 백신 조성물의 방어능 평가
8-1. 면역학적 평가
8-1-1. PCV2 항체가 확인
간접형광항체 분석법(Indirect fluorescent antibody test, 이하 IFA)을 이용하여 각 실험군의 혈청 내 PCV2b-특이적 IgG(PCV2b-specific IgG) 및 PCV2d-특이적(PCV2d-specific IgG) 항체가를 확인하였다. 이때 각 실험군에 있어서, 백신 접종 시 또는 백신 접종 2, 4, 6, 8주 후 혈청을 채취하여 실험을 수행하였다.
먼저 2 × 104 cells/100 μL/well의 PCV1-제외 돼지 신장 세포(PCV1-free Porcine kidney)인 PK-15 세포와 보유하고 있는 PCV2b(HID9029) 또는 PCV2d(HID9071) 바이러스를 600 TCID50/mL로 희석하여 96-웰 플레이트에 각각 100 μL/well씩 분주하였다.
이를 37 ℃, 5% CO2 조건의 배양기에서 24시간 배양한 후 300 mM 글루코사민(glucosamine)을 200 μL/well씩 첨가하여 30분간 반응시킨 후 상층액을 제거하였다. PBS를 이용해 3회 세척한 후 1% 항생제-항진균 용액(antibiotic-antimycotic solution (Gibco))이 첨가된 DMEM을 200 μL/well씩 분주하여 4일간 배양하였다. 상층액을 제거하고 PBS를 이용해 1회 세척하였다. 80% 아세톤을 100 μL/well씩 분주한 후 4 ℃에서 1시간동안 고정하였다.
고정액을 버리고 PBS를 이용해 1회 세척한 후 플레이트를 -20 ℃에 보관하여 항체가 검사에 사용하였다.
돼지 혈청시료를 DMEM으로 2진 희석해서 준비하고 이를 고정한 플레이트에 100 μL/well씩 분주한 후 37 ℃에서 1시간 동안 반응시켰다. 그후 PBS를 이용해 3회 세척하였다. 상기 플레이트에 돼지 IgG 경쇄 및 중쇄 항체(Pig IgG-heavy and light chain antibody, Goat polyclonal, FITC conjugate[Bethyl])를 PBS에 1:200으로 희석하여 100 μL/well씩 분주하고 37 ℃에서 30분간 반응시켰다. 그 후 PBS를 이용해 1회 세척하고 형광현미경으로 관찰하여 바이러스가 증식한 최고 희석 배수의 역수를 항체가로 판정하였다. 이를 통해 확인한 PCV2b-특이적 IgG 항체가 확인 결과는 하기 표 5 및 도 15에 나타내었다. 도 15에 있어서, *는 음성대조군과 비교한 결과이고(P<0.05), #는 공격접종대조군과 비교한 결과이며(P<0.05), ##는 공격접종대조군과 비교한 결과이다(P<0.01).
그 결과, 백신 접종 전(0 WPV), 모든 실험군은 낮은 수준의 항체가를 나타냈다. 본 발명에 따른 다가 백신 접종군은 2 WPV부터 다른 실험군대비 유의성있게(P<0.01) PCV2b에 특이적인 IgG 항체가를 유도함을 확인하였다. 특히 공격 접종 이후에도 계속해서 항체가가 상승하여 시험 종료시까지 상당히 높은 수준의 IgG 항체가를 나타냈다.
공격접종대조군은 6 WPV부터 항체가를 유도하였지만, 본 발명에 따른 다가 백신 접종군과 비교하여 유의성있게(P<0.05) 낮은 수준을 나타냈고, 음성대조군은 시험 전 구간에서 낮은 수준의 항체가를 나타냈다.
Figure PCTKR2022003112-appb-img-000005
더불어 PCV2d 특이적 IgG 항체가 확인 결과는 도 16 및 하기 표 6에 나타내었다. 이때 도 16에 있어서, ***는 음성대조군과 비교한 결과이고(P<0.001), ###는 공격접종대조군과 비교한 결과이다(P<0.001).
그 결과, 백신 접종 전(0 WPV), 모든 실험군은 낮은 수준의 항체가를 나타냈다. 본 발명에 따른 다가 백신 접종군은 2 WPV부터 다른 실험군대비 유의성있게(P<0.001) PCV2d에 특이적인 IgG 항체가를 유도함을 확인하였다. 특히 공격 접종 이후에도 계속해서 증가하여 시험 종료시까지 상당히 높은 수준의 IgG 항체가를 나타냈다.
공격접종대조군은 6 WPV부터 항체가를 유도하였지만 본 발명에 따른 다가 백신 접종군과 비교하여 유의성있게(P<0.001) 낮은 수준을 나타냈고, 음성대조군은 시험 전 구간에서 낮은 수준의 항체가를 나타냈다.
Figure PCTKR2022003112-appb-img-000006
8-1-2. PCV2 중화항체가 확인
각 실험군의 혈청 내 중화항체가 확인은 다음과 같이 수행하였다. 먼저 각 실험군의 혈청을 56 ℃에서 30분간 비동화하였다. 96-웰 플레이트의 첫 웰에 상기 혈청 50 μL과 DMEM 150 μL을 분주하여 희석한 후 나머지 웰에 DMEM을 100 μL/well씩 분주하여 2진 희석하였다. 보유하고 있는 PCV2b(HID9029) 또는 PCV2d(HID9071) 바이러스를 400 TCID50/mL로 희석한 후 2진 희석된 혈청이 담긴 웰에 동량(100 μL/well)을 분주하고 37 ℃에서 1시간 동안 반응시켰다. PCV1-제외 돼지 신장 세포(PCV1-free Porcine kidney)인 PK-15 세포를 각 웰에 2 × 104 cells/100 μL/well로 분주하였다. 이를 37 ℃, 5% CO2 조건의 배양기에서 24시간 배양한 후 300 mM 글루코사민을 200 μL/well씩 30분간 처리하였다. 그 후 상층액을 제거하고 PBS를 이용해 3회 세척하였다. 그 후 1% 항생제-항진균 용액이 첨가된 DMEM을 200 μL/well씩 첨가하고 2일간 배양하였다. 배양 후 면역형광 분석법(Immunofluorescence assay)을 다음과 같이 수행하였다.
배양액을 버리고 PBS를 이용해 1회 세척하고, 플레이트를 37 ℃ 배양기에 넣어 30분 동안 건조하였다. 건조시킨 플레이트에 80 % 아세톤을 100 μL/well씩 분주한 다음 4 ℃에서 1시간동안 고정하였다. 그 후 고정액을 버리고 PBS를 이용해 1회 세척하였다. PBS에 1:500으로 희석한 돼지 항-PV2 항혈청(anti-PCV2 antiserum)을 100 μL/well씩 분주하고 37 ℃에서 1시간동안 반응시켰다. 그 후 PBS를 이용해 3회 세척하였다. 상기 플레이트에 돼지 IgG 경쇄 및 중쇄 항체(Pig IgG-heavy and light chain antibody, Goat polyclonal, FITC conjugate[Bethyl])를 PBS에 1:200으로 희석하여 100 μL/well씩 분주하고 37 ℃에서 30분간 반응시켰다. 그 후 PBS를 이용해 1회 세척하고 형광현미경으로 관찰하였다. 이때 바이러스 증식을 억제한(1 well 내에서 90 % 억제) 최고 혈청 희석 배수의 역수를 중화항체가로 판정하였다. 이를 통해 확인한 PCV2b 중화항체가 측정 결과는 도 17 및 하기 표 7에 나타내었다. 도 17에 있어서, ***는 음성대조군과 비교한 결과이고(P<0.001), ##는 공격접종대조군과 비교한 결과이며(P<0.01), ###는 공격접종대조군과 비교한 결과이다(P<0.001).
그 결과, 백신 접종 전(0 WPV), 모든 실험군은 낮은 수준의 중화항체가를 나타냈다. 본 발명에 따른 다가 백신 접종군은 2 WPV 부터 PCV2b에 대하여 평균 9.6 이상의 중화항체가를 보여, PCV2b에 대한 중화항체가 생성되기 시작함을 알 수 있었다. 더불어 6 WPV에는 평균 921.6 이상의 높은 중화항체가를 나타냈다. 특히 공격접종 이후인 4 WPV부터는 중화항체가가 계속해서 증가하여 8 WPV에는 평균 1,433.6 이상의 높은 수준의 중화항체가를 나타냈다.
공격접종대조군은 공격접종 이후 중화항체가가 생성되긴 했지만 8 WPV에 평균 106.67 이상으로, 다가 백신 접종군 대비 낮은 수준의 중화항체가를 나타냈으며, 음성대조군은 시험 전 구간에서 매우 낮은 수준의 중화항체가를 나타냈다.
Figure PCTKR2022003112-appb-img-000007
더불어 PCV2d 중화항체가 측정 결과는 도 18 및 하기 표 8에 나타내었다. 이때 도 18에 있어서, ***는 음성대조군과 비교한 결과이고(P<0.001), #는 공격대조군과 비교한 결과이며(P<0.05), ###는 공격접종대조군과 비교한 결과이다(P<0.001).
그 결과, 백신 접종 전(0 WPV), 모든 실험군은 낮은 수준의 중화항체가를 나타냈다. 다가 백신 접종군은 2 WPV 부터 PCV2b에 대하여 평균 9.6 이상의 중화항체가를 보여, PCV2b에 대한 중화항체가 생성되기 시작함을 알 수 있었다. 더불어 6 WPV에는 평균 1,024 이상으로 증가한 높은 중화항체가를 나타냈다. 특히 공격접종 이후인 4 WPV부터 중화항체가는 계속해서 증가했고, 8 WPV에는 평균 2,252 이상의 매우 높은 수준의 중화항체가를 나타냈다.
공격접종대조군은 공격접종 이후 중화항체가가 생성되긴 했지만 시험 종료시에 평균 170.67 이상으로, 다가 백신 접종군 대비 낮은 수준의 중화항체가를 나타냈으며, 음성대조군은 시험 전 구간에서 매우 낮은 수준의 중화항체가를 나타냈다.
Figure PCTKR2022003112-appb-img-000008
8-1-3. IFN-γ 분비량 확인
IFN-γ 분비량 확인을 위하여 PBMC를 분리하였고, 이에 항원을 감작하였다. 피콜(Ficoll)을 튜브(conical tube)에 4 mL씩 분주하여 준비하였다. 각 실험군의 혈액 4 mL 과 PBS 4 mL을 새로운 튜브(conical tube)에 혼합하여 준비하였다. 혈액과 PBS 혼합액을 피콜이 들어있는 튜브에 천천히 옮긴 후 840 x g의 속도로 상온에서 30분간 원심분리하였다. 피콜과 혈청 사이에 떠있는 PBMC를 피펫(pipet)을 이용해 분리한 후 PBS 4 mL이 들어있는 새로운 튜브(conical tube)에 옮겼다. 이를 210 x g의 속도로 상온에서 10분간 원심분리하였다. 상층액을 제거한 후 PBMC에 PBS 3 mL을 넣어 재부유시킨 후, 210 x g의 속도로 상온에서 10분간 원심분리하였다. 상층액을 제거하고 상기와 똑같이 PBS에 재부유시키고, 원심분리하여 상층액을 제거하였다. 이에 RPMI(10 % FBS, 1 % Anti-anti) 1 mL을 첨가하여 세포를 부유하였다. PBMC 10 μL를 1 % 트리판 블루 용액(trypan blue solution)과 1:1로 혼합하여 세포 계수기로 계수한 후 96-웰 플레이트에 1 × 106 cells/well으로 분주하였다. PBMC 분주 30분 후 재조합 PCV2d 단백질 정제 항원(in RPMI)을 10 μg/mL의 농도로 100 μL/well씩 분주하여 감작하고 72시간 배양한 후 15,800 x g의 속도로 10분간 원심분리하여 상층액을 분리하였다. 분리한 상층액은 회수하여 -70 ℃에 보관하였다. 상기 상층액에 대하여 IFN-γ 돼지 ELISA 키트(IFN-γ Porcine ELISA kit(Invitrogen, #KSC4021)를 이용해 제조사의 지침에 따라 IFN-γ 분비량을 측정하였다. IFN-γ 분비량 측정 결과는 도 19 및 하기 표 9에 나타내었다.
그 결과 4WPV에서 본 발명에 따른 다가 백신 접종군은 30.62 pg/mL로 PCV2d 항원에 특이적인 IFN-γ가 분비되었으며, 전 실험 구간에서 유의적인 차이는 없었다. 반면, 공격접종대조군과 음성대조군은 IFN-γ가 측정되지 않았다.
Figure PCTKR2022003112-appb-img-000009
8-2. 공격접종 바이러스 DNA 정량
각 실험군의 혈청, 비강 검체(swab), 직장 검체(swab), 폐, 림프절에 대한 공격접종 바이러스 DNA를 정량 평가하였다. 먼저 각 군별 모든 개체의 혈액에서 혈청을 분리하고, 면봉을 이용하여 비강 및 직장 검체를 채취하였다. 각 검체를 2 mL E-튜브(E-tube)에 넣고 PBS 1 mL과 충분히 볼텍싱(vortexing)하여 검체와 PBS를 혼합하였다. 이때 폐와 림프절 조직은 2 mL 둥근바닥 E-튜브(round-bottom E-tube)에 PBS를 혼합하여 비드(beads)와 함께 TissueLyser II를 이용하여 파쇄하였다.
이를 10,000 x g에서 5분간 원심분리하여 상층액을 분리하였다. 그 후 Gene-spin™ Viral DNA/RNA Extraction Kit를 사용하여 viral DNA를 분리하였다. PCV2 정량 분석을 위하여 PCV2에 대한 프라이머(정방향 프라이머 (5'-AACCACATACTGGAAACCAC-3'(서열번호 5))와 역방향 프라이머 (5'-TTGAGGAGTACCATTCCAAC-3'(서열번호 6)))를 사용해 RT-qPCR를 수행하였다.
PCV2 검출을 위한 시약 조성은 표 10과 같으며, 표 11의 조건에 따라 RT-qPCR를 수행하였다.
Figure PCTKR2022003112-appb-img-000010
Figure PCTKR2022003112-appb-img-000011
RT-qPCR 수행 시 항상 음성대조군과 PCV2d에 대한 표준 샘플(103 ~ 109 DNA copy)을 함께 수행하였다. RT-qPCR 후 표준 샘플을 통해 구한 표준정량곡선에 대입하여 샘플의 DNA 카피(copy) 수를 측정하였다. 이때, 음성대조군에서는 어떠한 증폭 산물도 관찰되지 않아야 한다. 시험 샘플의 결과를 정리하여 PCV2d 양성과 음성 유무를 기록하였다.
8-2-1. 혈청, 비강 및 직장 검체의 측정 결과
혈청에서 PCV2 DNA 카피 수 정량 결과(바이러스혈증(viremia))는 도 20 및 하기 표 12에 나타내었다. 도 20에 있어서, *는 음성대조군과 비교한 결과이다(P<0.05).
그 결과, 백신 접종 이후부터 공격접종 전(4 WPV)까지 모든 실험군의 혈청에서 PCV2 DNA가 검출되지 않았다. 또한 공격접종 이후에도 본 발명에 따른 다가 백신 접종군은 음성대조군과 동일하게 바이러스혈증이 관찰되지 않았다. 그러나 공격접종대조군은 공격접종 2주 후(6 WPV)에 5.63(Log10) copies/mL의 바이러스혈증을 나타내었다. 7 WPV부터 8 WPV에서는 모든 실험군에서 바이러스혈증이 관찰되지 않았다.
Figure PCTKR2022003112-appb-img-000012
비강과 직장에서 PCV2를 정량한 결과는 도 21 및 도 22, 하기 표 13 및 표 14에 나타내었다. 도 21에 있어서, ***는 음성대조군과 비교한 결과이다(P<0.001). 또한 도 22에 있어서, *는 음성대조군과 비교한 결과이고(P<0.05), ***는 음성대조군과 비교한 결과이다(P<0.001). 또한 표 13은 비강에서 PCV2 DNA 카피수를 정량한 결과이고, 표 14는 직장에서 PCV2 DNA 카피수를 정량한 결과이다.
그 결과, 백신 접종 이후부터 공격접종 전(4 WPV)까지 모든 실험군의 혈청에서 PCV2 DNA가 검출되지 않았다. 6 WPV부터 공격접종대조군에서만 PCV2 DNA가 검출되었고, 비강과 직장에서 각각 6.88(Log10)과 8.36(Log10) copies/mL로 상당히 높은 수준의 DNA가 검출되어 다른 군과 비교하였을 때 유의적인 차이를 보였으며 8 WPV까지는 DNA가 조금씩 감소하는 경향을 나타냈다.
Figure PCTKR2022003112-appb-img-000013
Figure PCTKR2022003112-appb-img-000014
8-2-2. 폐 및 림프절 검체의 측정 결과
시험 종료시인 8 WPV에 모든 실험군을 안락사시킨 후 채취한 폐와 서혜부 림프절 조직에서 PCV2 DNA 카피 수를 조사한 결과는 도 23 및 도 24와 하기 표 15 및 표 16에 나타내었다. 도 23에 있어서, ##는 공격접종대조군과 비교한 결과이다(P<0.01). 더불어 표 15는 폐에서 PCV2 DNA 카피수를 정량한 결과이고, 표 16은 림프절에서 PCV2 DNA 카피수를 정량한 결과이다.
그 결과, 폐에서 공격접종대조군은 8.56(Log10) copies/mL로 상당히 높은 수준의 DNA 카피 수를 나타냈으나 본 발명에 따른 다가 백신 접종군은 5.59(Log10) copies/mL로, 공격접종대조군보다 DNA 카피 수가 1/103 만큼 감소하여 유의적으로 낮은 DNA 카피 수를 나타냈다.
림프절에서 공격접종대조군은 5.17(Log10) copies/mL의 DNA 카피 수를 나타냈으나 다가 백신 접종군은 PCV2 DNA 카피 수가 확인되지 않았다. 한편, 음성대조군에서는 폐와 림프절에서 PCV2 DNA가 검출되지 않았다.
Figure PCTKR2022003112-appb-img-000015
Figure PCTKR2022003112-appb-img-000016
8-3. 병리학적 평가
8-3-1. 육안 평가
부검 및 육안 병변 평가는 ㈜옵티팜에 의뢰하여 진행하였으며, 그 결과는 하기 표 17 및 표 18에 나타내었다. 육안 병변 평가 결과는 표 17에 나타내었고, 서해부 림프절 조직학적 평가 결과는 표 18에 나타내었다.
육안소견 관찰 결과, 네 실험군 중에서 공격접종대조군에서 변화가 확인되었다. 서혜부천층림프절(superficial inguinal lymph nodes)은 실험군간에 현저한 크기 차이를 보이지는 않았으나, 림프절 크기의 측정에서 다른 실험군보다 공격접종대조군의 1번과 2번 개체의 림프절이 양쪽 모두 다소 증가한 것으로 나타났다. 폐에서는 전복측엽을 중심으로 자적색조의 경화소(pulmonary consolidation)가 형성되어 있었으며, 폐 경화소는 공격접종대조군의 1번과 2번 개체에서만 확인되었다. 추가적으로 공격접종대조군의 2번 개체는 심장 표면에 유백색조의 섬유소(fibrin)로 추정되는 염증성 삼출물에 의한 심낭 유착(pericardial adhesion)이 관찰되었다. 기타 장기에서 유의적인 육안적 변화는 관찰되지 않았다.
Figure PCTKR2022003112-appb-img-000017
Figure PCTKR2022003112-appb-img-000018
8-3-2. 조직병리학적 및 면역조직화학적 평가
각 실험군의 내부 장기의 육안소견 관찰 후, 주요 내부 장기를 적출하여 일부를 10% 중성완충포르말린(Neutral buffered formalin, NBF) 용액에 고정하였다.
고정이 완료된 조직은 각 장기의 단면을 관찰할 수 있도록 삭정하고, 일반적인 조직처리 방법에 준하여 파라핀 포매하고 약 3~4 μm 두께로 박절하여 조직 슬라이드를 제작하였다. 슬라이드는 H&E(hematoxylin & eosin) 염색한 후, 광학현미경(Olympus BX53, Japan)을 이용하여 검경하였다.
폐, 림프절 및 편도 추가 조직 절편은 각 장기 내 돼지써코바이러스 2형(Porcine circovirus type 2, PCV2)의 존재여부를 확인하기 위하여 PCV2에 대한 특이 항체를 이용하여 면역조직화학염색(Immunohistochemistry, IHC)을 수행하였다. 상기 IHC 분석은 ㈜옵티팜에 의뢰하여 분석하였다. 상기 결과는 하기 표 19 및 표 20에 나타내었다. 표 19는 림프절, 폐 및 신장의 조직병리학적 및 면역조직화학적 평가 결과이고, 표 20은 장기의 조직병리학적 및 면역조직화학적 평가 결과이다.
병리조직학적 검사를 진행한 결과, 일부 림프절에서 림프구 고갈 및 조직구 대치(lymphoid depletion and histiocytic replacement)가 관찰되었다. 상기 소견은 림프여포 내 림프구의 변성 및 괴사 등으로 림프구의 수적 감소가 나타나고 해당 공간에는 염증성 반응의 일환으로 조직구(histiocyte)등의 세포가 침윤되는 특징을 보인다. 상기 소견은 이유 후 자돈의 돼지써코바이러스연관질병(PCVAD)으로 판단할 수 있는 병리조직학적 소견 중 하나이며, 침윤된 조직구 등 병변을 구성하고 있는 세포에서 바이러스 항원이 검출되면 PCVAD로 확진할 수 있다. 폐에서는 주로 혈관 및 세기관주위 염증세포침윤 (perivascular and peribronchiolar cuffing), 기관지 연관 림프조직 증생(BALT hyperplasia), 화농성 기관지 간질성 폐렴(suppurative bronchointerstitial pneumonia), 세기관지 내강의 분절화를 동반한 세기관주위 결합조직 증생(peribronchiolar fibroplasia with bronchiolar segmentation) 및 폐부종(pulmonary edema)이 확인되었다. 이 중에서 혈관 및 세기관주위 염증세포침윤은 PCV2를 비롯한 일반적인 호흡기 감염증 초기에 나타나는 변화이며 폐부종 또한 초기 염증성 반응의 일환으로 해석될 수 있다. 특징적으로 세기관주위 결합조직증생은 세기관지 주위로 섬유아세포(fibroblast) 등 결합조직을 구성하는 세포가 증생되는 소견으로 이러한 결합조직의 증가가 심해질수록 세기관지 내강을 압박하여 기도 내강이 분절화 되거나 폐쇄되기도 한다. 이러한 소견은 PCVAD에서 보다 빈번하게 관찰되므로 PCV2 감염을 의심할 수 있는 변화 중 하나로 알려져 있다. 상기 열거한 기도주위의 염증성 변화와 부종 등의 병변이 심화되면 폐렴으로 진행되며, 본 실시예에서는 전복측엽의 경화소에서 화농성 기관지 간질성폐렴이 확인되었다. 해당 소견은 호흡기 바이러스와 더불어 2차 호흡기 세균의 중복 감염에 의한 결과로 판단되었다. 추가적으로 기관지연관 림프조직 증생은 감염 후 기도상피층의 만성적인 항원 자극에 의하여 형성되는 소견이다. 폐렴이나 다른 염증성 변화를 동반하지 않고 단독으로 관찰되는 경우 대개 호흡기 마이코플라스마 감염에 의한 변화로 판단되고 있다. 더불어 신장에서는 피질부위를 중심으로 간질 내 염증세포침윤(interstitial inflammatory cell infiltration)이 관찰되었다. 간질에 침윤된 염증세포는 대부분 단핵염증세포(mononuclear inflammatory cells)로 비화농성염증을 형성하며 PCV2를 비롯한 바이러스 감염에 의한 변화로 알려져 있다. 군별 병리조직학적 병변의 출현 양상을 비교하여 본 결과 림프절 소견은 공격접종대조군에서만 관찰되었다. 림프구 고갈 및 조직구 대치는 공격접종대조군의 1번 개체에서만 미약한 수준으로 관찰되었으며, PCV2 감염으로 판단되는 림프절 병변은 모든 실험 개체에서 현저하지 않았다. 폐 병변의 경우 본 발명에 따른 다가 백신 접종군의 모든 개체에서 경도 이하의 혈관 및 세기관주위 염증세포침윤이 관찰되었다. 또한 본 발명에 따른 다가 백신 접종군의 2번과 3번 개체에서는 경도 이하의 BALT 증생이 확인되었다. 공격접종대조군의 경우 모든 개체에서 중등도 이상의 혈관 및 세기관지주위 염증세포침윤이 확인되었다. 공격접종대조군의 1번 개체는 전복측엽을 중심으로 중등도의 화농성 기관지간질성폐렴이 형성되었고, 일부 폐포에서 미약한 수준의 폐부종이 동반되어 전 개체 중에서 가장 심한 소견을 보였다. 2번 개체는 심한 기도 주변의 염증세포 침윤과 더불어 경도의 세기관주위 결합조직 증생이 동반되어 일부 세기관지 내강이 변형되고 분절화되어 있었다. 폐포에서도 중등도의 폐부종 소견이 확인되었다. 3번 개체는 중등도의 혈관 및 세기관주위 염증세포침윤과 미약한 BALT 증생만 관찰되어 공격접종대조군의 세 개체 중에서 가장 약한 변화를 보였다. 음성대조군에서는 두 개체 모두 경도 이하의 혈관 및 세기관주위 염증세포침윤만 관찰되었다. 신장에서는 공격접종대조군에서만 중등도 이하의 간질 내 염증세포침윤이 국소 내지 다병소성으로 관찰되었다. 병변은 공격접종대조군의 1번 개체에서 중등도 수준으로 가장 현저하였다.
더불어 서혜부천층림프절, 폐 및 신장에 대한 PCV2의 IHC 결과 본 발명에 따른 다가 백신 접종군에서는 모든 장기에서 PCV2 항원이 검출되지 않았다. 공격접종대조군은 1번과 2번의 림프절에서 소수 세포에 한정된 양성 반응을 확인하였으며, 1번 폐의 병변에 침윤된 일부 세포에서 경도 수준의 양성 반응을 확인하였다. 신장 조직에서는 공격접종대조군의 모든 개체에서 양성 반응을 확인하였으며, 대부분 간질 내 염증병변을 구성하는 일부 세포가 양성 반응을 보였다. 양성 반응은 1번 신장에서 경도 수준으로, 나머지 개체는 국소에 한정된 미약한 수준으로 관찰되었다. 음성대조군에서는 모든 장기에서 PCV2 항원이 검출되지 않았다.
Figure PCTKR2022003112-appb-img-000019
* 검출된 개체 수/총 개체 수
Figure PCTKR2022003112-appb-img-000020
1) 조직병리학적 소견: (1+) 최소; (2+) 약한; (3+) 보통; (4+) 심함. 2) 면역조직화학적 소견: (-) 없음; (+) 낮음; (++) 중간; (++++) 높음.
종합적으로 본 발명에 따른 Mhp+Mhr+재조합 P97 단백질+재조합 PCV2 캡시드 단백질 조합의 다가 백신 조성물은 마우스와 기니피그에 접종시 면역반응에서 상호 보완 효과를 나타냈으며, 특히 목적 동물인 돼지에 접종하였을 시 혈청학적인 수준에서 높은 수준의 항체가 및 중화항체가를 유도하였고, PBMC에서 Mhp 또는 PCV2 감작에 대해 높은 수준의 IFN-γ를 생성하였으며, 목적 동물인 돼지에 접종하고 공격접종시, 부작용없이 우수한 방어능을 보였으므로, 이를 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위하여 유용하게 활용할 수 있다.

Claims (15)

  1. (i) 돼지 마이코플라스마 하이오뉴모니애(Mycoplasma hyopneumoniae, Mhp) 균주;
    (ii) 돼지 마이코플라스마 하이오라이니스(Mycoplasma hyorhinis, Mhr) 균주;
    (iii) 돼지 마이코플라스마 하이오뉴모니애 유래 재조합 P97 단백질; 및
    (iv) 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질;을 포함하는, 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물.
  2. 제 1항에 있어서,
    상기 재조합 P97 단백질은 서열번호 1로 표시되는 아미노산 서열로 이루어진 것을 특징으로 하는, 다가 백신 조성물.
  3. 제 1항에 있어서,
    상기 돼지 써코바이러스 2형 유래 재조합 단백질은 서열번호 2로 표시되는 아미노산 서열로 이루어진 것을 특징으로 하는, 다가 백신 조성물.
  4. 제 1항에 있어서,
    상기 돼지 마이코플라스마 하이오뉴모니애는 1×108 내지 1×109 CCU(Colour-changing units)/mL의 농도로 포함되는 것을 특징으로 하는, 다가 백신 조성물.
  5. 제 1항에 있어서,
    상기 돼지 마이코플라스마 하이오라이니스는 1×108 내지 1×109 CCU(Colour-changing units)/mL의 농도로 포함되는 것을 특징으로 하는, 다가 백신 조성물.
  6. 제 1항에 있어서,
    상기 돼지 마이코플라스마 하이오뉴모니애 유래 재조합 P97 단백질은 10내지 100 μg/dose의 농도로 포함되는 것을 특징으로 하는, 다가 백신 조성물.
  7. 제 1항에 있어서,
    상기 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질은 0.1 내지 1000 μg/dose의 농도로 포함되는 것을 특징으로 하는, 다가 백신 조성물.
  8. 제 1항에 있어서,
    상기 돼지 마이코플라스마 하이오뉴모니애 균주는 불활화된 것을 특징으로 하는, 다가 백신 조성물.
  9. 제 1항에 있어서,
    상기 돼지 마이코플라스마 하이오라이니스 균주는 불활화된 것을 특징으로 하는, 다가 백신 조성물.
  10. 제 1항에 있어서,
    상기 다가 백신 조성물은 부형제를 더 포함하는 것을 특징으로 하는, 다가 백신 조성물.
  11. 제 10항에 있어서,
    상기 부형제는 IMS1313인 것을 특징으로 하는, 다가 백신 조성물.
  12. 제 1항에 따른 다가 백신 조성물을 돼지에 접종하는 단계;를 포함하는 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방 방법.
  13. 제 12항에 있어서,
    상기 다가 백신 조성물은 근육, 피하, 경피, 정맥, 비강내, 복강내 및 경구로 이루어진 군에서 선택된 하나 이상의 방법으로 접종하는 것을 특징으로 하는, 예방 방법.
  14. (i) 돼지 마이코플라스마 하이오뉴모니애(Mycoplasma hyopneumoniae, Mhp) 균주;
    (ii) 돼지 마이코플라스마 하이오라이니스(Mycoplasma hyorhinis, Mhr) 균주;
    (iii) 돼지 마이코플라스마 하이오뉴모니애 유래 재조합 P97 단백질; 및
    (iv) 돼지 써코바이러스 2형(Porcine circovirus type 2, PCV2) 유래 재조합 단백질;을 포함하는, 돼지 마이코플라스마균 및 돼지 써코바이러스 감염에 의한 질환 예방용 약학적 조성물.
  15. 제 14항에 있어서,
    상기 돼지 마이코플라스마균 및 돼지 써코바이러스 감염에 의한 질환은 돼지 호흡기 복합증후군(Porcine Respiratory Disease Complex, PRDC), 돼지유행성폐렴(enzootic pneumonia, EP), 이유자돈 전신성 소모성 증후군 (postweaning multisystemic wasting syndrome, PMWS), 돼지 피부염 신부전 증후군(porcine dermatitis and nephropathy syndrome, PDNS), 모돈유산 폐사 증후군(sow abortion and mortality syndrome, SAMS), 돼지 생식기 및 호흡기 증후군(Porcine Reproductive and Respiratory Syndrome, PRRS), 가성 광견병 (pseudorabies), 글래서병 (Glasser's disease), 연쇄구균성 수막염(streptococcal meningitis), 살모넬라증(salmonellosis), 이유후 대장균증(postweaning colibacillosis), 식이성 간증 (dietetic hepatosis), 화농성 기관지폐렴(suppurative bronchopneumonia), 유스타키오관(Eustachian tube) 염증, 다발성 장막염(polyserositis), 마이코플라스마성 폐렴 및 흉막 폐렴으로 이루어진 군에서 선택된 어느 하나 이상인 것을 특징으로 하는, 약학적 조성물.
PCT/KR2022/003112 2021-03-04 2022-03-04 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물 WO2022186661A1 (ko)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR20210028980 2021-03-04
KR10-2021-0028980 2021-03-04
KR10-2021-0073554 2021-06-07
KR1020210073554A KR102646305B1 (ko) 2021-03-04 2021-06-07 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물

Publications (1)

Publication Number Publication Date
WO2022186661A1 true WO2022186661A1 (ko) 2022-09-09

Family

ID=83154296

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/003112 WO2022186661A1 (ko) 2021-03-04 2022-03-04 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물

Country Status (1)

Country Link
WO (1) WO2022186661A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180049221A (ko) * 2012-04-04 2018-05-10 조에티스 서비시즈 엘엘씨 Pcv/마이코플라즈마 하이요뉴모니아 조합 백신
KR20190017725A (ko) * 2016-03-07 2019-02-20 버지니아 테크 인터렉추얼 프라퍼티스, 인크. 키메라 돼지 써코바이러스 유형 2 (pcv2) 백신
KR20200076551A (ko) * 2018-12-19 2020-06-29 주식회사 이노백 마이코플라즈마 폐렴 및 흉막폐렴 예방용 백신 조성물

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180049221A (ko) * 2012-04-04 2018-05-10 조에티스 서비시즈 엘엘씨 Pcv/마이코플라즈마 하이요뉴모니아 조합 백신
KR20190017725A (ko) * 2016-03-07 2019-02-20 버지니아 테크 인터렉추얼 프라퍼티스, 인크. 키메라 돼지 써코바이러스 유형 2 (pcv2) 백신
KR20200076551A (ko) * 2018-12-19 2020-06-29 주식회사 이노백 마이코플라즈마 폐렴 및 흉막폐렴 예방용 백신 조성물

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
DATABASE GenBank NCBI; . : "capsid protein [Porcine circovirus 2]", XP055964049 *
KIM K.: "Genetic characterization of porcine circovirus type 2 (PCV2) and development of novel recombinant PCV2d vaccine. ", THESIS GRADUATE SCHOOL OF KANGWON NATIONAL UNIVERSITY, KOREA, GRADUATE SCHOOL OF KANGWON NATIONAL UNIVERSITY, KORWEA, 1 August 2020 (2020-08-01), Korwea, pages 1 - 120, XP009539360 *
KIM KIJU; HAHN TAE-WOOK: "Evaluation of novel recombinant porcine circovirus type 2d (PCV2d) vaccine in pigs naturally infected with PCV2d", VACCINE, ELSEVIER, AMSTERDAM, NL, vol. 39, no. 3, 18 December 2020 (2020-12-18), AMSTERDAM, NL , pages 529 - 535, XP086433048, ISSN: 0264-410X, DOI: 10.1016/j.vaccine.2020.12.013 *

Similar Documents

Publication Publication Date Title
WO2011043584A2 (ko) 형질전환 식물 유래의 고병원성 조류독감 바이러스 단백질 백신 및 그 제조방법
WO2010147268A1 (ko) 자궁경부암 백신
WO2020060117A1 (ko) 돼지 열병 백신용 조성물 및 이의 제조 방법
WO2010019016A2 (ko) 산삼 또는 인삼을 포함한 인삼류의 형성층 유래 식물줄기세포주를 유효성분으로 함유하는 간질환의 예방 또는 치료용 조성물
WO2022186661A1 (ko) 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물
WO2017073851A1 (ko) 돼지유행성설사병바이러스 약독화주 및 불활화백신 조성물과 이를 이용한 경구 투여용 백신 조성물
WO2020091529A1 (ko) 재조합 호흡기 세포융합 바이러스 f 단백질 및 이를 포함하는 백신 조성물
WO2012036391A2 (ko) 돼지 써코바이러스２(ｐｃｖ２) 유전자의 표면발현용 벡터 및 이로 형질전환된 살모넬라 백신 균주
WO2018030878A1 (ko) 재조합 단백질을 포함하는 돼지 마이코플라즈마 감염 예방용 백신 조성물
WO2012043949A1 (ko) 화학식 1 내지 8로 표시되는 화합물 또는 고삼 추출물을 유효성분으로 포함하는 면역 증강용 조성물
WO2020005028A1 (ko) 중증 열성 혈소판 감소 증후군(sfts) 바이러스 감염 질환 예방 또는 치료용 백신 조성물
WO2014142515A1 (ko) 재조합 효모 전세포를 이용한 돼지 써코바이러스(pcv2) 서브유닛 백신과 그의 제조 방법
WO2019182417A1 (ko) 황열 바이러스 유래 ns1 단백질, 이에 특이적으로 결합하는 단일클론항체 및 이의 용도
WO2023027402A1 (ko) 아프리카 돼지열병 바이러스 유래 항원 단백질을 포함하는 아프리카 돼지열병의 예방용 백신
WO2019194393A1 (ko) 페리틴 자가조립체에 항원 펩타이드 및 면역 증강제가 결합된 나노 입자 및 이의 용도
WO2023090556A1 (ko) 신규 재조합 돼지 써코바이러스 2형 단백질 및 이의 용도
WO2022039438A1 (ko) 식물 발현 재조합 지카바이러스 외피단백질을 포함하는 백신 조성물 및 이의 제조방법
WO2023101381A1 (ko) 구제역 바이러스 유사 입자를 생산하기 위한 백신 플랫폼
KR102646305B1 (ko) 돼지 마이코플라스마균 및 돼지 써코바이러스 감염 예방을 위한 다가 백신 조성물
WO2015111904A1 (ko) 커큐미노이드계 화합물, 및 감초 추출물 또는 이의 분획물을 포함하는 인플루엔자 바이러스 감염의 예방 또는 치료용 조성물
WO2023121036A1 (ko) 불활화된 폐렴구균 변이 균주를 포함하는 백신 조성물
WO2021241873A1 (ko) 제2형 중증급성호흡기증후군 코로나바이러스 감염 질환의 예방 또는 치료용 조성물
WO2021125891A1 (ko) A형 간염 바이러스의 제조방법 및 상기의 방법에 따라 제조된 a형 간염 바이러스
WO2022050521A1 (ko) Ace2 결합력이 감소된 코로나바이러스 유래 수용체 결합 도메인 변이체 및 이를 포함하는 백신 조성물
WO2014046410A1 (ko) 노다바이러스의 바이러스 유사입자의 생산방법, 이를 발현하는 효모 세포주 및 이를 포함하는 백신 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22763642

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 22763642

Country of ref document: EP

Kind code of ref document: A1