WO2022112849A1 - 비오틴 모이어티, 지방산 모이어티 또는 이의 조합이 결합된 생리활성 물질 접합체 - Google Patents

비오틴 모이어티, 지방산 모이어티 또는 이의 조합이 결합된 생리활성 물질 접합체 Download PDF

Info

Publication number
WO2022112849A1
WO2022112849A1 PCT/IB2021/022237 IB2021022237W WO2022112849A1 WO 2022112849 A1 WO2022112849 A1 WO 2022112849A1 IB 2021022237 W IB2021022237 W IB 2021022237W WO 2022112849 A1 WO2022112849 A1 WO 2022112849A1
Authority
WO
WIPO (PCT)
Prior art keywords
substituted
conjugate
moiety
seq
physiologically active
Prior art date
Application number
PCT/IB2021/022237
Other languages
English (en)
French (fr)
Inventor
신재희
임성묵
박은지
Original Assignee
(주) 디앤디파마텍
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by (주) 디앤디파마텍 filed Critical (주) 디앤디파마텍
Priority to CN202180092431.3A priority Critical patent/CN116916965A/zh
Priority to AU2021386899A priority patent/AU2021386899A1/en
Priority to IL303229A priority patent/IL303229A/en
Priority to JP2023532340A priority patent/JP2023553362A/ja
Priority to GB2309455.0A priority patent/GB2617717A/en
Priority to CA3200366A priority patent/CA3200366A1/en
Priority to MX2023006188A priority patent/MX2023006188A/es
Priority to EP21897261.0A priority patent/EP4252780A1/en
Publication of WO2022112849A1 publication Critical patent/WO2022112849A1/ko

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/55—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug, i.e. a dimer, oligomer or polymer of pharmacologically or therapeutically active compounds
    • A61K47/551—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug, i.e. a dimer, oligomer or polymer of pharmacologically or therapeutically active compounds one of the codrug's components being a vitamin, e.g. niacinamide, vitamin B3, cobalamin, vitamin B12, folate, vitamin A or retinoic acid
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/545—Heterocyclic compounds
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22—Hormones
    • A61K38/26—Glucagons
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/542—Carboxylic acids, e.g. a fatty acid or an amino acid
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/0012—Galenical forms characterised by the site of application
    • A61K9/0053—Mouth and digestive tract, i.e. intraoral and peroral administration
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575—Hormones
    • C07K14/605—Glucagons
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide

Definitions

  • Biotin moiety, fatty acid moiety, or a combination thereof is bound to a bioactive substance conjugate
  • the present invention relates to a bioactive material conjugate to which a novel biotin moiety, fatty acid moiety, or a combination thereof is bound, and specifically, biotin moiety and fatty acid having excellent oral absorption in the body and excellent pharmacokinetics It relates to a bioactive substance conjugate to which a moiety or a combination thereof is bound, and more particularly to a bioactive substance conjugate to which a biotin moiety and a fatty acid moiety are bound.
  • Bioavailability refers to the degree of drug used at the target site after drug administration, and the degree is different depending on the administration method, target environment, and the like.
  • the drug may be lost or degraded in the process of being delivered from the site of administration to the target, which varies depending on the mode of administration.
  • drug delivery of therapeutic agents including proteins, polypeptides, etc. is divided into parenteral administration and oral administration.
  • Parenteral administration methods include intravenous injection, intramuscular injection, subcutaneous injection, sublingual administration, etc. 2022/112849 1» (that means 1'/182021/022237.
  • parenteral administration Most therapeutic agents such as proteins and polypeptides are administered by parenteral methods in consideration of bioavailability, target environment, delivery process, etc., and it is known that parenteral administration methods directly exhibit rapid effects. However, parenteral administration may cause pain or discomfort to the patient, and side effects such as injection infection and air embolism may appear depending on the route. In contrast, in the case of oral administration, since it is administered directly by mouth, administration is simple and the effect can be continuously displayed. Accordingly, many pharmaceutical companies have attempted to administer therapeutic agents by oral administration, but there is a problem in that oral administration passes through the digestive tract, so resistance to acidic environment, enzymatic degradation, etc. is required. In particular, proteins and peptides are known to have a low bioavailability of about 0.1% when administered orally.
  • An object of the present invention is to have excellent oral absorption in the body and excellent pharmacokinetics 2022/112849 1» (The 1'/182021/022237 To provide a bioactive substance conjugate to which a biotin moiety, a fatty acid moiety, or a combination thereof exhibiting an effect is bound. More specifically, to provide a bioactive substance conjugate to which a biotin moiety and a fatty acid moiety are bound.
  • One aspect of the present invention provides a bioactive substance conjugate combined with a biotin moiety, a fatty acid moiety or a combination thereof, and a method for preparing the same.
  • Another aspect of the present invention provides a pharmaceutical composition comprising a bioactive substance conjugate bound to a biotin moiety, a fatty acid moiety, or a combination thereof.
  • Another aspect of the present invention provides a composition for oral administration comprising a bioactive substance conjugate combined with a biotin moiety, a fatty acid moiety, or a combination thereof.
  • a specific aspect of the present invention provides a bioactive material conjugate to which a biotin moiety and a fatty acid moiety are bound, and a method for preparing the same.
  • Another aspect of the present invention is diabetes, obesity, fatty liver disease, irritable bowel syndrome, neurodegenerative disease, bone disease, osteoporosis, human growth comprising a bioactive substance conjugate combined with a biotin moiety, a fatty acid moiety, or a combination thereof It provides a pharmaceutical composition for preventing or treating hormone deficiency, anticancer or non-alcoholic fatty liver disease.
  • the bioactive substance conjugate combined with a biotin moiety, a fatty acid moiety, or a combination thereof according to an embodiment of the present invention exhibits excellent effects by combining water-soluble biotin 2022/112849 1» (It has 1'/182021/022237. Specifically, it has an effect of improving oral absorption, improving pharmacokinetic effects, protecting against degradation of physiologically active substances from enzymes, promoting intestinal membrane permeation of physiologically active substances, or active transport and absorption through sodium-dependent multivitamin transporters.
  • bioactive material conjugate to which a biotin moiety and a fatty acid moiety are bonded exhibits superior effects in terms of each of the above effects compared to a conjugate to which a biotin moiety or a fatty acid moiety is bonded alone.
  • FIG. 1 is a purification chromatogram of conjugates 14 to 17 according to an embodiment of the present invention.
  • 2 is a purification chromatogram of conjugates 18 to 19 according to an embodiment of the present invention.
  • 3 is a chromatogram of the final material of Conjugates 20 and 24 according to an embodiment of the present invention.
  • 4 is a diagram showing changes in blood glucose after glucose administration of conjugates 20 and 24 according to an embodiment of the present invention.
  • 5 is a chromatogram of final materials of conjugates 51 to 52 according to an embodiment of the present invention.
  • 6 is a purification chromatogram of conjugates 53 to 54 according to an embodiment of the present invention. 7 shows the administration of glucose of conjugates 53 and 54 according to an embodiment of the present invention.
  • 8 is a purification chromatogram of conjugates 55 to 59 according to an embodiment of the present invention.
  • 9 is a chromatogram of the final material of the conjugate 56 according to an embodiment of the present invention.
  • 10 is a diagram showing changes in body weight after subcutaneous administration of conjugates 58 to 59 according to an embodiment of the present invention for 2 weeks.
  • 11 is a purification chromatogram of conjugates 60 to 64 according to an embodiment of the present invention.
  • 12 is a diagram showing feed intake after oral administration of conjugates 33, 36, 39, 42, 61, 62, 63 and 64 according to an embodiment of the present invention.
  • 13 is a purification chromatogram of conjugate 66 according to an embodiment of the present invention.
  • 14 is a diagram showing the blood glucose control ability of conjugates 65 and 66 according to an embodiment of the present invention after oral administration.
  • 15 is a purification chromatogram of conjugate 69 according to an embodiment of the present invention.
  • 16 is a diagram showing the amount of intracellular accumulation of conjugates 68 and 69 according to an embodiment of the present invention.
  • One aspect of the present invention is to provide a bioactive substance conjugate to which a biotin moiety and a fatty acid moiety are bound, and a method for preparing the same. 2022/112849 1 » (G 1'/182021/022237
  • step of doing or “step of” as used throughout the specification of the present invention does not mean “step for”.
  • step of doing or “step of” as used throughout the specification of the present invention does not mean “step for”.
  • the term “combination of these” included in the expression of the Markush form means one or more mixtures or combinations selected from the group consisting of the components described in the expression of the Markush form, It means to include one or more selected from the group consisting of components.
  • the description of “and/or means “and or show or table”.
  • One aspect of the present invention is to provide a bioactive substance conjugate combined with a biotin moiety, a fatty acid moiety, or a combination thereof, and a method for preparing the same.
  • a specific aspect of the present invention is to provide a bioactive substance conjugate to which a biotin moiety and a fatty acid moiety are bound, and a method for preparing the same It corresponds to class 3 (ical Classi f icat ion System).
  • Peptide and protein drugs have high hydrophilicity and large molecular weight, can be decomposed by gastric acid at low pH, and have low intestinal absorption due to attack by enzymes such as trypsin.
  • the oral bioavailability (BA) of peptide and protein drugs is about 0.1%, making it difficult to use as a pharmaceutical composition.
  • a technique of passing through the stomach using an enteric capsule is used, but there is a limit in that the absorption rate of peptides and proteins cannot be fundamentally improved.
  • the biotin moiety, fatty acid moiety, or a bioactive substance conjugate combined with a combination thereof according to an embodiment of the present invention increases intestinal membrane permeation, thereby promoting absorption in the intestine.
  • the bioactive substance conjugate combined with a biotin moiety, a fatty acid moiety, or a combination thereof according to an embodiment of the present invention may exhibit excellent pharmacokinetic effects.
  • bioactive material conjugate combined with a biotin moiety, a fatty acid moiety, or a combination thereof according to an embodiment of the present invention can prevent the decomposition of a bioactive material such as a peptide from an enzyme, and ultimately the physiological activity the substance penetrates the intestinal mucosa 2022/112849 1» (The 1'/182021/022237 Excessive absorption may promote absorption in the intestine.
  • bioactive substance conjugate combined with a biotin moiety, a fatty acid moiety, or a combination thereof according to an embodiment of the present invention is combined with biotin, a type of water-soluble vitamin, thereby active transport through a sodium-dependent multivitamin transporter. can be absorbed.
  • biotin moiety, fatty acid moiety, or a combination thereof may be bound to the active site or inactive site of the physiologically active material, and thus may not inhibit the activity of the physiologically active material .
  • unsubstituted or substituted means that it may be unsubstituted or substituted, and “substituted” has one or more substituents, and the substituents are those of a main group such as alkylene or heteroalkylene.
  • halo refers to fluorine, chlorine, bromine, iodine, and the like.
  • alkyl refers to a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of an aliphatic or alicyclic, saturated or unsaturated hydrocarbon compound, for example, methyl, ethyl, propyl, butyl, pentyl, Nucleic acid, 11-propyl, 11-butyl, 11-pentyl, isopropyl, isobutyl 161 ⁇ _butyl, isopentyl, and neopentyl.
  • heteroalkyl is an alkyl containing one or more heteroatoms, and the heteroatom is a heteroatom positioned at any one carbon atom of the alkyl, and 0, 012 or [: 3 ⁇ 4 is substituted. 2022/112849 1» (the 1'/182021/022237
  • alkylene means a divalent moiety obtained by removing a hydrogen atom from a carbon atom of an aliphatic or alicyclic, saturated or unsaturated hydrocarbon compound.
  • alkenylene refers to a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of an aliphatic or alicyclic, saturated or unsaturated hydrocarbon compound.
  • heteroalkylene refers to one or more heteroatoms
  • aryl refers to a monovalent moiety obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound having a ring atom.
  • 5-10 aryl refers to a monovalent moiety obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound as having 5 to 10 ring atoms of carbon.
  • aryl include groups derived from benzene, acenaphthene, fluorene, phenalene, acephenanthrene and aceanthrene.
  • heteroaryl is an aryl containing one or more hetero atoms, for example, pyridine, pyrimidine, benzothiophene, furyl, dioxalanyl, pyrrolyl, oxazolyl, pyridyl, pyridazinyl, Pyrimidinyl, isobenzofuran, indole, isoindole, indolizine, indoline, isoindoline, purine, benzodioxane, quinoline, isoquinoline, quinolizine, benzoxazine, benzodiazine, pyridopyridine, quinoc saline, quinazoline, cinnoline, phthalazine, naphthyridine, pteridine, perimidine, pyridoindole, oxanthrene, phenoxatiin, phenazine, phenoxazine, etc.
  • arylene means a divalent moiety obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound having a ring atom. 2022/112849 1» (1'/182021/022237
  • heteroarylene means an arylene containing one or more heteroatoms.
  • alkynyl is an alkyl group having one or more carbon-carbon triple bonds, and examples thereof include ethynyl and 2-propynyl.
  • the biotin moiety may be represented by the following general formula show.
  • X is a functional group capable of binding to a physiologically active material, is a spacer
  • the table may be represented by the following formula / ⁇ 1, 2022/112849 1 » (G 1'/182021/022237
  • I) is an integer of 0 or 1.
  • Table is a functional group capable of binding to a physiologically active substance.
  • the functional group is a functional group capable of reacting with a thiol group, a carboxyl group and/or an amine group, for example, maleimide, succinimide, hydroxysuccinimide, aldehyde, carboxyl, carboxyl ester; dill already Subdivision 11101'01) 11th period), tetrafluorophenyl ester, pentafluorophenyl?
  • the structure of the functional group table may be maintained or dropped or deformed when combined with a physiologically active substance.
  • the spacer may have a structure having cleavability in the body.
  • a direct bond or substituted or unsubstituted alkylene, -0 -, (0) ⁇ -, (0) 0 - or (0) -
  • 6 _methyllysine, diminopimelic acid, ornithine, 3-methylornithine, 3-methylornithine, citrulline, homocitrulline, arginine, aspartate, asparagine, glutamate may include glutamine, histidine, ornithine, proline, serine, or threonine.
  • 6 or I when II is 0, 6 or I may be directly bonded to X or (spacer). In the present invention, it is not limited thereto as a terminal group, but may be, for example, hydrogen or ⁇ . In the present invention, when ]3 is 0, the octavalent terminal may be used.
  • the above table and Na can form a bioactive substance binding site together.
  • m may be an integer of 1 to 10, and specifically may be an integer of 1 to 8, 1 to 5, or 1 to 4.
  • the table includes maleimide, succinimide, Ihydroxysuccinimide, succinimidyl succinate, succinimidyl glutarate, succinimidyl methyl ester, succinimidyl pentyl ester, Succinimidyl carbonate, nitrophenyl carbonate, aldehyde, amine, thiol, oxyamine, iodoacetamide, aminooxyl, hydrazide, hydroxy, propionate, pyridyl, alkyl halide, vinyl sulfone, carboxyl, It may be selected from the group consisting of hydrazide, halogen acetamide, 02-5 alkynyl, 06-20 aryldis
  • the table is maleimide, I hydroxysuccinimide, succinimidyl carbonate, nitrophenyl carbonate, thiol, aminooxyl, aldehyde de or amine.
  • the table above shows maleimide, I hydroxysuccinimide, aldehyde or amine.
  • (0) - includes.
  • (0) ⁇ - is a substituted linear or branched 01-50 heteroalkylene, and includes at least one (0)-.
  • the present invention In one aspect of 2022/112849 1» (the 1'/182021/022237, where 11 is an integer from 1 to 20).
  • (0)-(001 2 ⁇ 2 - ⁇ - includes as a repeating unit, wherein 11 is an integer of 2 to 4.
  • the present invention comprises an amino acid as a constituent part.
  • V comprises glutamic acid or lysine as a constituent part.
  • the fatty acid is included as a constituent part. In a specific aspect of the present invention, it includes 2-24 fatty acids, wherein the fatty acids are present in a combined form. In one aspect of the present invention, is a direct bond. In one aspect of the present invention, is any one of the following and each may be independently selected.
  • the present invention comprises at least one glycerol, at least one polyethylene glycol, or a combination thereof. is combined with one or more, wherein II is an integer from 1 to 20. In one aspect of the present invention, comprising 2022/112849 1 ⁇ (:1 ⁇ 2021/022237 _ (Example 2) 3 ⁇ - is further combined. In one aspect of the present invention, the biotin moiety is
  • the fatty acid moiety may be represented by the following general formula B.
  • X' -Y' -ff is a functional group capable of binding to the physiologically active material
  • r is a spacer
  • V is a fatty acid.
  • the fatty acid includes carboxylic acid having a long saturated or unsaturated aliphatic chain, but is not limited thereto.
  • caprylic acid which is a type of saturated fatty acid, lauric acid (Laurie acid) , palmitic acid, stearic acid, arachidic acid, cerotic acid, myristoleic acid, a type of unsaturated fatty acid, palmitoleic acid ( Palmitoleic acid), oleic acid, linoleic acid, alpha-linolenic acid, and the like.
  • in the general formula B is a functional group capable of binding to a physiologically active substance.
  • the structure may be maintained, or eliminated or modified when the functional group is combined with a physiologically active material.
  • in the general formula B may correspond to a fatty acid 2022/112849 1» (It may be 1'/182021/022237.
  • the fatty acid includes a fatty acid in all deformable forms such as modification, addition, deletion, etc., including simple fatty acids.
  • in one aspect of the present invention is the same as in the general formula show.
  • the spacer [corresponds to a direct bond, or substituted or unsubstituted 01-50 linear alkylene, substituted or unsubstituted 01-50 non-linear alkylene, substituted or unsubstituted in the structure of Unsubstituted 01-50 linear heteroalkylene, substituted or unsubstituted 01-50 non-linear heteroalkylene, substituted or unsubstituted 01-50 arylene, substituted or unsubstituted 01-50 heteroarylene, - 0 -, -0(0), -0(0) ⁇ -, -0(0)0 -, It may include one or more from the group consisting of - ⁇ - or - Yes-, wherein the mallow is hydrogen, a substituted or unsubstituted 01-50 alkyl, a substituted or unsubstituted -50 aryl, or an ethylene glycol repeating unit (_ ( ⁇ 20120 ⁇ -, II is an integer of 1 or more and
  • the [is _ ( ⁇ 2 to 20 ) - may include - as a repeating unit.
  • the [] includes -0(0)-(0012 ⁇ 2 ⁇ - ⁇ - as a repeating unit, wherein II is an integer from 1 to 20.
  • ⁇ is - 0) - (001 2 01 2 sh ⁇ 1 - includes as a repeating unit, wherein II is an integer of 2 to 4.
  • ⁇ includes an amino acid or a derivative thereof as a constituent part.
  • the [ is glutamic acid (_ ⁇ 301 (1)), glutamine (1 _ 1116), glycine (1 116), isoleucine (01611 (116), or lysine (11 116) ) as a component, wherein each amino acid may exist in a combined form.
  • the [] comprises glutamic acid or lysine as a constituent part.
  • ⁇ may be substituted or unsubstituted 01 0-28 linear or branched alkylene.
  • at least one substituted is a substituted or unsubstituted 012-24 saturated fatty acid, and when substituted, includes - ⁇ .
  • ⁇ is -(01 2 ⁇ -[:00 ⁇ 1, and V is 10 to
  • the fatty acid moiety is
  • the biotin moiety and/or the fatty acid moiety and the physiologically active substance may be formed by various bonds. It may be formed by combining a functional group of a biotin moiety or a fatty acid moiety with a functional group of a physiologically active material, but is not limited thereto, but may be formed by, for example, a thiol-ether bond or an amide bond. In one embodiment, the binding of the biotin moiety to the physiologically active material may be combined in the same manner as in Scheme 1 below.
  • ⁇ '; ⁇ ) ⁇ _ can be combined in the same way.
  • ⁇ represents a physiologically active material containing an amine group, I hydroxy according to an embodiment of the present invention 2022/112849 1»
  • the 1'/182021/022237 represents the reaction between a biotin moiety containing succinimide and an amine group (- 3 ⁇ 4) present in a physiologically active substance.
  • the physiologically active material may not be particularly limited.
  • a physiologically active substance may be administered to the body for a specific purpose, and refers to a substance that causes a physiological or biochemical reaction in the body.
  • the physiologically active substance may be a substance used in a pharmaceutical composition.
  • diabetes, obesity, fatty liver disease, irritable bowel syndrome, neurodegenerative disease, bone disease, osteoporosis, human growth hormone deficiency, anticancer or non-alcoholic fatty liver disease may be a substance used for prevention or treatment. This is exemplary, and since the indication may be different depending on the type of the physiologically active substance, it is not limited to the indication.
  • the physiologically active material is not limited thereto, but may be, for example, a polypeptide or a non-peptidic polymer.
  • polypeptides, proteins, polysaccharides (1)01 3£10 ( ⁇ £1 or their derivation) can be a chain
  • the physiologically active material is glucagon (Glugacon), GLP-1 (Glucagon_like pept ide-1), GLP-2 (G 1 ucagon-1 i ke pept ide-2), GIP (glucose_dependent insul inotropic polypept ide) , exendin-4 (exendin_4) , insulin, parathyroid hormone, interferon, erythropoietin, calcitonin, amylin, serotonin, ritoximab, trastuzumab, Needlesse, tissue plasminogen Activator, thymoglobin, vaccine,
  • the biotin moiety may be bound to a physiologically active substance.
  • the biotin moiety may not inhibit the biological activity of the physiologically active material by binding to the physiologically active material, and thus may have the same biological activity or improved biological activity as the physiologically active material.
  • the physiologically active material may contain an exposed _ group, so that a biotin moiety may be bound to the _ group.
  • the physiologically active material contains an exposed -NH3 + group or -NH2 group, so that a biotin moiety may be bonded to the exposed -Nil group or -NH2 group.
  • the biotin moiety may be bound by avoiding the site where the binding position with the physiologically active substance is controlled and thus exhibiting activity. 2022/112849 1 » (The 1'/182021/022237
  • the fatty acid moiety may be directly bound to a physiologically active substance.
  • some of the fatty acid moiety may be in common with the biotin moiety.
  • biotin moieties 635 and 836 commonly include a fatty acid moiety that is a part of the fatty acid moiety. However, this corresponds to an example and is not limited thereto.
  • the fatty acid moiety may be bound to a physiologically active material, and bound to a site different from that to which the biotin moiety is bound.
  • the fatty acid moiety may also be bound to the active site or the inactive site of the physiologically active material in the same manner as the biotin moiety, and may exhibit the same properties as the above properties.
  • both the biotin moiety and the fatty acid moiety may be bound to the bioactive material, and the bioactive material conjugate to which both the biotin moiety and the fatty acid moiety are bound is a biotin moiety or a fatty acid moiety Compared to the conjugate in which T is bound alone, oral absorption rate, pharmacokinetics, inhibition of enzymatic degradation, intestinal membrane permeation, etc. may be excellent.
  • the physiologically active substance may be glucagon, calcitonin, ⁇ 1, ⁇ 2, 01?, exendin-4, parathyroid hormone, insulin, amylin, human growth hormone or a derivative thereof. have.
  • the physiologically active material is in the following SEQ ID NO: 1 2022/112849 1»
  • the 1'/182021/022237 may be a polypeptide having any one of 7 amino acid sequences or derivatives thereof.
  • the physiologically active substances of the following SEQ ID NOs: 1 to 7 are each a glucagon derivative (SEQ ID NO: 1), ⁇ 1 (SEQ ID NO: 2), ⁇ 2 (SEQ ID NO: 3), (SEQ ID NO: 4), exendin-4 (SEQ ID NO: 5), parathyroid hormone (SEQ ID NO: 6), glucagon (SEQ ID NO: 7).
  • the physiologically active material may be a protein having the amino acid sequences of SEQ ID NOs: 15 and 16 or proteins having the amino acid sequences of SEQ ID NOs: 17 and 16.
  • the physiologically active material may be a protein having the amino acid sequence of SEQ ID NOs: 15 and 16 or a protein having the amino acid sequence of SEQ ID NOs: 17 and 16, wherein the protein is the 6th and 11th of SEQ ID NO: 15 or 17 It is bonded by a disulfide bond between the cysteine, the 7th cysteine of SEQ ID NO: 15 or 17 and the 7th cysteine of SEQ ID NO: 16, and the 20th cysteine of SEQ ID NO: 15 or 17 and the 19th cysteine of SEQ ID NO: 16.
  • any one or more amino acids of a polypeptide selected from the group consisting of amino acid sequences shown in SEQ ID NOs: 1 to 7 may be substituted or inserted with a cysteine amino acid.
  • a biotin moiety is bound to the _ group of the cysteine amino acid.
  • any one or more amino acids of a polypeptide selected from the group consisting of the amino acid sequence may be substituted or inserted with a lysine amino acid.
  • the biotin moiety is bound to the 3 ⁇ 4 group of the lysine amino acid.
  • the polypeptide into which the cysteine amino acid is inserted may be a polypeptide having an amino acid sequence of any one of SEQ ID NOs: 8 to 14 below.
  • the physiologically active substances of SEQ ID NOs: 8 to 14 are the physiologically active substances of SEQ ID NOs: 1 to 7 2022/112849 1» (The 1'/182021/022237 refers to a physiologically active substance in which a cysteine amino acid is substituted or inserted from the vagina (for example, the physiologically active substance of SEQ ID NO: 8 is the amino acid of the physiologically active substance of SEQ ID NO: 1) at least one of them is substituted with cysteine)
  • a portion of the polypeptide may be substituted in order to control the binding position with the biotin moiety.
  • a lysine amino acid may be substituted or inserted into the polypeptide in order to control the binding position with the biotin moiety.
  • any one or more of the amino acids of the amino acid sequence shown in SEQ ID NO: 5 may be substituted or inserted with a lysine amino acid.
  • any one or more of the amino acids of the amino acid sequence shown in SEQ ID NO: 5 2-aminoisobutyric acid (2-show 11111110 0
  • polypeptide 301 (1, is substituted with Si, and a lysine amino acid may be inserted.
  • a biotin moiety is bonded to the 3 ⁇ 4 group of the lysine amino acid.
  • a part of the polypeptide is substituted, or a lysine amino acid is substituted or inserted
  • the polypeptide may be a polypeptide having an amino acid sequence of any one of SEQ ID NOs: 18 to 21.
  • the physiologically active substances of SEQ ID NOs: 18 to 21 are substituted with some amino acids from the physiologically active substances of SEQ ID NO: 5 , means an exendin-4 derivative as inserted.
  • the physiologically active substance may be a polypeptide having the amino acid sequence of SEQ ID NO: 22 or a derivative thereof.
  • the physiologically active substance of SEQ ID NO: 22 refers to amylin. 2022/112849 1» (The 1'/182021/022237
  • a part of the amino acid sequence represented by SEQ ID NO: 22 may be substituted or inserted in order to control the binding position with the biotin moiety.
  • any one or more of the amino acids of the amino acid sequence shown in SEQ ID NO: 22 may be substituted with proline, aspartic acid, or arginine amino acids.
  • any one or more of the amino acids of the amino acid sequence shown in SEQ ID NO: 22 may be substituted or inserted with a lysine amino acid.
  • the polypeptide in which a part of the amino acid represented by SEQ ID NO: 22 is substituted or inserted may be a polypeptide having any one of the amino acid sequences of SEQ ID NOs: 23 to 31 below.
  • the physiologically active substances of SEQ ID NOs: 23 to 31 below refer to amylin derivatives in which some amino acids are substituted and inserted from the physiologically active substances of SEQ ID NO: 22.
  • the physiologically active substance may be a polypeptide having the amino acid sequence of SEQ ID NO: 32 or a derivative thereof.
  • the physiologically active substances of SEQ ID NO: 32 below refer to exendin-4 derivatives, respectively.
  • a part of the amino acid sequence of SEQ ID NO: 32 may be deleted, substituted, or inserted in order to control the binding position with the biotin moiety.
  • any one or more of the amino acids of the amino acid sequence shown in SEQ ID NO: 32 may be substituted with methionine, lysine, isoleucine, tryptophan, glycine, or amino acids.
  • any one or more of the amino acids of the amino acid sequence represented by SEQ ID NO: 32 may be deleted.
  • the polypeptide in which a part of the amino acid represented by SEQ ID NO: 32 is deleted, substituted or inserted may be a polypeptide having any one of the amino acid sequences of SEQ ID NOs: 33 to 37 below.
  • any one or more of the amino acids in the amino acid sequence shown in SEQ ID NO: 12 may be substituted with 2-aminoisobutyric acid (Si ).
  • At least one of the amino acids of the amino acid sequence represented by SEQ ID NO: 12 is substituted with 2-aminoisobutyric acid (si, at least one 3 ⁇ 43-£1 110- ⁇ 1 (11)
  • the polypeptide that can be substituted may be a polypeptide having the amino acid sequence of SEQ ID NOs: 38 to 39 below.
  • the physiologically active material of SEQ ID NO: 38 or 39 is an amino acid substituted from the physiologically active material of SEQ ID NO: 12, and refers to an exendin-4 derivative.
  • the physiologically active material of the amino acid sequence of SEQ ID NO: 39 is at least one of the amino acids E) is a bioactive substance substituted with 2022/112849 1 » (G 1'/182021/022237
  • any one or more of the amino acids in the amino acid sequence shown in SEQ ID NO: 8 may be substituted with lysine (1 or arginine (yose)).
  • the polypeptide in which any one or more of the amino acids of the amino acid sequence shown in SEQ ID NO: 8 is substituted with lysine or arginine may be a polypeptide having the amino acid sequence of SEQ ID NOs: 40 to 41 below.
  • the physiologically active material of SEQ ID NO: 40 or 41 below refers to a glucagon derivative in which some amino acids are substituted from the physiologically active material of SEQ ID NO: 8.
  • the physiologically active substance may be a polypeptide having the amino acid sequence of SEQ ID NO: 42 or a derivative thereof.
  • the physiologically active material of SEQ ID NO: 42 refers to a human growth hormone derivative.
  • the bioactive substance conjugate having a biotin moiety is a peptide and a non-peptidic polymer, a fatty acid, cholesterol, an antibody, an antibody fragment, an albumin and a fragment thereof, a nucleotide, a fibronectin (f ibronect in) , transferrin, FcRn binding material, saccharide, elastin, heparin, and any one or more selected from the group consisting of derivatives thereof may covalently bond or form inclusion bodies (microspheres).
  • the non-peptidic polymer is polyethylene glycol (PEG), polypropylene glycol, copolymer of ethylene glycol and propylene glycol, polyoxyethylated polyol, polyvinyl alcohol (PVA), polysaccharide, textran, polyvinylethyl ether, PLA (polylactic acid, polylactic acid) , PLGA (polylactic-glycolic acid, polylactic-glycol ic acid) , lipid polymer, chitin, hyaluronic acid, and may be selected from the group consisting of combinations thereof.
  • PEG polyethylene glycol
  • PVA polyvinyl alcohol
  • PLA polylactic acid, polylactic acid
  • PLGA polylactic-glycolic acid, polylactic-glycol ic acid
  • lipid polymer chitin, hyaluronic acid
  • Another aspect of the present invention is a method comprising the steps of obtaining a biotin moiety; reacting the biotin moiety with a physiologically active substance; and separating the bioactive material bound to the biotin moiety after the completion of the reaction.
  • another aspect of the present invention comprises the steps of obtaining a biotin moiety; reacting the biotin moiety with a physiologically active substance; After completion of the reaction of the biotin moiety and the physiologically active material, the step of reacting with the fatty acid moiety; and completion of the reaction 2022/112849 1» (The 1'/182021/022237 Preparation of a bioactive substance conjugate bound to a biotin moiety and a fatty acid moiety, comprising the step of isolating the bioactive substance bound to the biotin moiety and the fatty acid moiety to provide a way
  • the biotin moiety may be represented by the general formula show.
  • the fatty acid moiety may be one represented by the general formula 8.
  • the reaction molar ratio of the biotin moiety to the physiologically active material may be 0.5 or more. Specifically, the molar ratio of the reaction of the biotin moiety to the physiologically active material may be 0.5 to 30.
  • the appropriate reaction molar ratio may be selected in consideration of the molecular structure, molecular weight, solubility, ] of the reaction solution, reaction temperature, reaction time, and the like of the biotin moiety.
  • the reaction molar ratio of the fatty acid moiety to the physiologically active material may be 0.5 or more.
  • the molar ratio of the reaction of the fatty acid moiety to the physiologically active material may be 0.5 to 20.
  • the appropriate reaction molar ratio may be selected in consideration of the molecular structure, molecular weight, solubility, ] of the reaction solution, reaction temperature, reaction time, etc. of the fatty acid moiety.
  • the reaction molar ratio of the biotin moiety to the physiologically active material may be 20 or more.
  • the molar ratio of the reaction of the biotin moiety to the physiologically active substance may be 20 to 25 days. have.
  • the reaction molar ratio of the fatty acid moiety to the physiologically active material in the step of obtaining the mixture may be 6 or more.
  • the molar ratio of the reaction of the fatty acid moiety to the physiologically active material may be 6 to 12.
  • the reaction may be performed using a buffer solution or an organic solvent.
  • the buffer or organic solvent is not particularly limited, and a buffer solution commonly used in the art may be appropriately selected according to the structure of the biotin moiety and the fatty acid moiety.
  • the temperature and time of the reaction step may be appropriately adjusted according to the characteristics of the biotin moiety, fatty acid moiety and physiologically active material used. Although not limited thereto, for example, it may be carried out at 4 °C for 3 hours or more, and may be carried out for a shorter time at room temperature. This may relate to the degree of reactivity of the biotin moiety, fatty acid moiety or a combination thereof used.
  • the reaction can be stopped by lowering the pH of the reaction solution.
  • a step of removing unreacted substances may be performed after the reaction step. The method of removing the unreacted material may be performed by a method commonly used in the art.
  • a purification step may be included after the separation step.
  • the separation and purification step may be performed using size exclusion chromatography, reverse phase high performance liquid chromatography, ion exchange chromatography, etc., but is not limited thereto.
  • Another aspect of the present invention is to provide a pharmaceutical composition comprising a bioactive substance conjugate combined with the above-described biotin moiety, fatty acid moiety, or a combination thereof.
  • Another specific aspect of the present invention is to provide a pharmaceutical composition comprising the above-described biotin moiety and a bioactive substance conjugate bound to a fatty acid moiety.
  • the use of the pharmaceutical composition may be determined according to the type of the physiologically active substance.
  • the pharmaceutical composition may be a composition for oral administration.
  • diabetes, obesity, fatty liver disease, irritable bowel syndrome, neurodegenerative disease, bone disease, osteoporosis, human It is possible to provide a pharmaceutical composition for the prevention or treatment of growth hormone deficiency, anticancer or non-alcoholic fatty liver disease.
  • the conjugate when the physiologically active substance is ⁇ 1, ⁇ 2, insulin, amylin or a derivative thereof, the conjugate may be used for preventing or treating diabetes. Specifically, the contact containing the physiologically active material of SEQ ID NO: 12 2022/112849 1» (The 1'/182021/022237 coalescence can be used for the prevention or treatment of diabetes. However, this is illustrative and not limited thereto.
  • the physiologically active substance is parathyroid hormone or a derivative thereof
  • the conjugate when the physiologically active substance is parathyroid hormone or a derivative thereof, the conjugate can be used for the prevention or treatment of bone diseases.
  • the conjugate comprising the physiologically active substance of SEQ ID NO: 6 can be used for the prevention or treatment of bone diseases.
  • the conjugate when the physiologically active substance is 11 sheets or a derivative thereof, the conjugate may be used for preventing or treating human growth hormone deficiency.
  • the conjugate comprising the physiologically active substance of SEQ ID NO: 42 can be used for preventing or treating human growth hormone deficiency.
  • Another aspect of the present invention is to provide a composition for oral administration comprising a bioactive substance conjugate combined with the above-described biotin moiety, fatty acid moiety, or a combination thereof.
  • Another specific aspect of the present invention is to provide a composition for oral administration comprising the above-described biotin moiety and a bioactive substance conjugate bound to a fatty acid moiety.
  • the bioactive substance conjugate combined with a biotin moiety, a fatty acid moiety, or a combination thereof according to an embodiment of the present invention is combined with biotin, a type of water-soluble vitamin As a result, it can be absorbed by active transport through a sodium-dependent multivitamin transporter, so that it can penetrate the intestinal membrane and promote absorption in the intestine. More specifically, as both the biotin moiety and the fatty acid moiety are bound, an excellent effect is exhibited.
  • the pharmaceutical composition containing the bioactive material bound to the biotin moiety as an active ingredient may be formulated and administered in various oral or parenteral dosage forms, but is not limited thereto.
  • the pharmaceutical composition containing the biotin moiety, the fatty acid moiety, or a bioactive substance conjugate combined with a combination thereof as an active ingredient is formulated into various oral or parenteral dosage forms and administered may be, but is not limited thereto.
  • formulation it can be prepared using diluents or excipients such as commonly used fillers, dissolution aids, extenders, binders, wetting agents, disintegrants, surfactants, and absorption enhancers.
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, etc., and these solid preparations include at least one excipient in the compound, for example, starch, calcium carbonate, sucrose Alternatively, it can be prepared by mixing lactose, gelatin, and the like. In addition to simple excipients, lubricants such as magnesium stearate and talc are also used.
  • Liquid formulations for oral use include suspensions, internal solutions, emulsions, syrups, etc. In addition to water and liquid paraffin, which are commonly used simple diluents, various excipients, examples For example, a wetting agent, a sweetener, a fragrance, a preservative, etc. may be included.
  • Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, freeze-dried preparations, and suppositories.
  • Non-aqueous solvents and suspensions may include propylene glycol (Propylene glycol), polyethylene glycol (PEG), vegetable oils such as olive oil, and injectable esters such as ethyl oleate.
  • PEG polyethylene glycol
  • injectable esters such as ethyl oleate.
  • calcium or vitamin D3 may be added to enhance efficacy as a therapeutic agent for proliferative diseases or autoimmune diseases.
  • the dosage of the pharmaceutical composition according to an embodiment of the present invention may vary depending on the patient's weight, age, sex, health status, diet, administration time, administration method, excretion rate and severity of disease.
  • HBTU 3-[bis(dimethylamino)methyliumyl]- 3H-benzotriazole- 1-oxide hexaple 2022/112849 1 ⁇ (:1 ⁇ 2021/022237 Luorophosphate (: 3-[Bis(dimethylamino)methyliumy1]-3H-benzotriazol-l ⁇ oxide hexafluorophosphate)
  • HATU 1- [bis (dimethyla - Triacolo [4,5-b] pyridinium-3 oxide hexafluorophosphate
  • HOBt 1-Hydroxybenzotriazole (1-Hydroxybenzotriazo1e)
  • LCMS Liquid Chromatography Mass Spectrometry General SPPS Methods
  • solid phase synthesis of peptides can be accomplished with groups that can be cleaved under acidic conditions, for example, 2-Fmoc-oxy-4-methoxybenzyl, or 2,4,6- This can be improved by the use of a di-peptide protected at the di-peptide amide bond with trimethoxybenzyl.
  • Fmoc-protected amino acid derivatives were the recommended standards: for example Fmoc-Ala-OH, Fmoc-Arg( Pbf)_0H, Fmoc-Asn(Trt)-0H, Fmoc-Asp(OtBu)-OH, Fmoc-Cys(Trt)_0H, Fmoc-Gln(Trt)-0H, Fmoc-Glu(0tBu)-0H, Fmoc- Gly-OH, Fmoc_His(Trt)_0H, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Met-OH, Fmoc-Phe-OH, Fmoc-Pro-OH, Fmoc - Ser(tBu)-OH, Fmoc-Thr(
  • N_terminal amino acid is alpha Boc protected at the amino group.
  • Fmoc-8-amino-3,6-dioxaoctanoic acid Fmoc-tranexamic acid, Fmoc-isoni, supplied from Anaspec, Bachem, Iris Biotech, or Novabiochem.
  • Pecotic acid, Fmoc-Glu-OtBu, and Fmoc-Lys(Fmoc)-0H were used.
  • Peptide synthesis using SPPS name Peptides can be synthesized using HBTU/DIEA, HATU/DIEA, or DIC/HOBt as a coupling reagent, using general Fmoc chemistry in link amide MBHA resin.
  • the reactants and coupling reagents used in the synthesis include combinations of the following.
  • An exemplary protocol of the peptide synthesis process using SPPS includes the following. 1) DMF is added to the vessel containing the link amide MBHA resin and expanded for 2 hours (sub: 0.68 mmol/g, 1.0 mmol, 1.47 g or 5 mmol, 7.35 g, sub: 0.68 mmol/g) . 2) Add 20% piper idine/DMF and mix for 30 minutes. 3) After removing the solvent of 1)-2), it is washed (30 seconds X 5 times) using DMF. 4) Add the reactant (one of the reactants #1 to #5) and mix for 30 seconds, then add the coupling reagent (one of the coupling reagents #1 to #5) corresponding to the reactant to 1 Proceed with nitrogen bubbling for an hour.
  • biotin moieties 66 to 837 were obtained through the protocol, purification and analysis of peptide synthesis 1) to 5) using the above.
  • Table 4 below, X, I and Myo are included in the definition of the general formula show herein.
  • the fatty acid moiety may be prepared by a method known in the art or a commercially obtained material may be used.
  • a fatty acid moiety according to Table 5 below was used.
  • Polypeptide may be prepared by a method known in the art or a commercially obtained material may be used.
  • the sequence of the polypeptide bound to the biotin moiety, the fatty acid moiety, or a combination thereof in the present invention is as shown in Table 6 below.
  • the reaction product was separated and purified by reverse-phase high performance liquid chromatography.
  • the column is SUPERSIL 0DS-1 column (10x250 mm, 5 um, LB Science, South Korea) was used, and the mobile phase conditions were 30-50% solvent B (acetonitrile with 0.1% TFA added) and solvent A (distilled water with 0.1% TFA added). The change was made linearly while maintaining the flow rate of 4.7 mL/min. Peaks detected between 10 and 20 minutes were collected by monitoring with a UV absorber at 280 nm. The collected peaks were concentrated and purified using an ultracentri fugal filter having an appropriate molecular weight cutoff after volatilizing the organic solvent and TFA under vacuum.
  • the purity of the purified material was confirmed through HPLC analysis. Analysis was performed using a Gemini C18 column (4.6 X 250 mm, 5 um; Phenomenex, CA, USA) at a constant temperature near room temperature. The analysis was performed by gradient elut ion method at a flow rate of 1 mL/min using this phase consisting of a trifluoroacetic acid TS solution: acetonitrile mixture (the mixing ratio was changed). UV absorbance was observed at 280 nm.
  • the analysis was performed using a mobile phase consisting of a trifluoroacetic acid TS solution: acetonitrile mixture (the mixing ratio was set to 20:80 after 20 minutes from 70:30) at a flow rate of 1 mL/min (gradient elut ion). ) method was performed. UV absorbance was observed at 280 nm. As a result of the measurement, the purification chromatograms of the conjugates 14 to 17 are as shown in FIG. 1 .
  • reaction solvent As a « solution to which 0.3% triethylamine seedling £111£1) was added, the molar ratio of the polypeptide of SEQ ID NO: 12 described in Table 6 and the biotin moieties of Tables 3 to 4 A mixture of 1:2 was prepared and reacted at room temperature for 30 minutes or more.
  • the reaction is 1% trifluoroacetic acid in a volume equal to the volume of the mixture
  • the concentration was purified using an ultracentrifugal filter having an appropriate molecular weight cutoff.
  • the purity of the purified material was confirmed through HPLC analysis. Analysis was performed using a Gemini C18 column (4.6 x 250 mm, 5 um; Phenomenex, CA, USA) at a constant temperature near room temperature. The analysis was performed by gradient elution method at a flow rate of 1 mL/min using a mobile phase consisting of a trifluoroacetic acid solution: acetonitrile mixture (mixing ratio of 70: 30 to 20: 80 after 20 minutes). UV top light was observed at 280 nm. As a result of the measurement, the purification chromatograms of the conjugates 18 to 19 are as shown in FIG. 2 .
  • - Conjugates 53 to 54 were prepared by the following method.
  • the reaction solvent was added with 0.3% triethylamine
  • a mixture of the polypeptides of SEQ ID NOs: 39 to 40 shown in Table 6 and the biotin moieties shown in Tables 3 to 4 in a molar ratio of 1: 2 was prepared and reacted at room temperature for at least 10 minutes.
  • a mixture of the fatty acid moieties listed in Table 5 was prepared in a molar ratio of 1:3 to the polypeptide-biotin moiety mixture, and the mixture was reacted at room temperature for at least 90 minutes.
  • the reaction was stopped by adding 1% trifluoroacetic acid ( ⁇ 1 1101'0£ sub: 30 1( 1) solution in a volume equal to the volume of the mixture.
  • the collected peak was concentrated and purified using an ultracentri fugal filter having an appropriate molecular weight cutoff after evaporating the organic solvent and TFA under vacuum.
  • the purity of the purified material was confirmed through HPLC analysis. Analysis was performed using a Gemini C18 column (4.6 x 250 mm, 5 um; Phenomenex, CA, USA) at a constant temperature near room temperature. The analysis was performed by gradient elut ion method at a flow rate of 1 mL/min using a mobile phase consisting of a trifluoroacetic acid solution: acetonitrile mixture (the mixing ratio was 70: 30 to 20: 80 after 20 minutes). . UV absorbance was observed at 280 nm.
  • the chromatogram of the final material of the conjugates 51 to 52 is as shown in FIG. 5
  • the purification chromatogram of the conjugates 53 to 54 is as shown in FIG. 6 .
  • other peaks other than the polypeptide bound to the biotin moiety and the fatty acid moiety were not observed, and when the area of the peak generated from each chromatogram was expressed as a percentage, conjugate 51 It was confirmed that the purity of to 54 is 95% or more. 2022/112849 1 » (G 1'/182021/022237
  • conjugates 58-59: 40-70% were linearly changed. Peaks detected during 10 to 15 minutes (conjugate 55: 13 minutes, conjugate 57: 10 minutes, conjugate 58: 13 minutes, conjugate 59: 15 minutes) were collected by monitoring with a UV absorber at 280 nm. The collected peak was concentrated and purified using an ultracentr i fugal filter having an appropriate molecular weight cutoff after volatilizing the organic solvent and TFA under vacuum. The purity of the purified material was confirmed through HPLC analysis. Analysis was performed using a Gemini C18 column (4.6 x 250 mm, 5 um; Phenomenex, CA, USA) at constant temperature (35 ° C). The assay was performed in trifluoroacetate.
  • reaction products of the conjugates 60 to 64 were separated and purified by reverse-phase high performance liquid chromatography.
  • the column was a Gemini C18 column (10 x 250 mm, 5 um; Phonomenex, CA, USA) was used, and the mobile phase conditions were Example 18 while maintaining a flow rate of 4.7 ml/min in solvent A (distilled water with 0.1% TFA added) and solvent B (acetonitrile with 0.1% TFA added). to 20: 30-60%, Examples 21 to 22: 25-50%.
  • the UV absorber is monitored at 280 nm and detected between 5 minutes and 18 minutes (Example 18: 20 minutes, Example 19: 15 minutes, Example 20: 13 minutes, Example 21: 17 minutes, Example 15 minutes)
  • the peak was collected.
  • the collected peak was concentrated and purified using an ultracentrifugal filter having an appropriate molecular weight cutoff after volatilizing the organic solvent and TFA under vacuum.
  • the purity of the purified material was confirmed through HPLC analysis.
  • Gemini C18 column (4.6 x 250 mm, 5 um; Phenomenex, CA, USA) was used for analysis.
  • the analysis was performed by gradient elution method at a flow rate of 1 mL/min using a mobile phase consisting of trifluoroacetic acid TS: acetonitrile mixture (mixing ratio of 75:25 to 50:50 after 20 minutes). carried out UV absorbance was observed at 280 nm.
  • the purification chromatograms of the conjugates 60 to 64 are as shown in FIG. 11 .
  • the fatty acid moieties listed in Table 5 were mixed in a molar ratio of 1:2 to prepare a mixture and reacted at room temperature for at least 120 minutes.
  • the reaction is 1% trifluoroacetic acid in a volume equal to the volume of the mixture
  • reaction product of the conjugate 66 was separated and purified by reverse-phase high-performance liquid chromatography (high performance l iquid chromatography).
  • high performance liquid chromatography high performance l iquid chromatography
  • a Gemini C18 column (10 X 250 mm, 5 um; Phonomenex, CA, USA) was used, and the mobile phase conditions were solvent A (distilled water with 0.1% TFA added) and solvent B (0.1% TFA added).
  • acetonitrile was changed linearly to 35-45% while maintaining a flow rate of 4.7 ml/min. Peaks detected between 13 and 14 minutes were collected by monitoring with a UV absorber at 280 nm.
  • the collected peaks were concentrated and purified using an ultracentri fugal filter having an appropriate molecular weight cutoff after volatilizing the organic solvent and TFA under vacuum.
  • the purity of the purified material was confirmed through HPLC analysis. Analysis was performed using a Gemini C18 column (4.6 x 250 mm, 5 um; Phenomenex, CA, USA) at constant temperature (35 ° C). The analysis was performed by gradient elut ion method at a flow rate of 1 mL/min using a mobile phase consisting of trifluoroacetic acid TS: acetonitrile mixture (mixing ratio of 70: 30 to 40: 60 after 20 minutes). was performed by UV absorbance was observed at 280 nm.
  • the purification chromatogram of the conjugate 66 is as shown in FIG. 13 .
  • poly-coupled with a biotin moiety and a fatty acid moiety 2022/112849 1» No peaks other than the 1'/182021/022237 peptide were observed, and when the area of the peak generated from each chromatogram is expressed as a percentage, the purity of the conjugate 66 is 95% or more Confirmed.
  • each Example was treated with 0.001 - 1000 nM and Exendin-4 and then cultured in a C0 2 incubator at a temperature of 37 ° C for 30 minutes. Thereafter, the amount of cAMP (Luciferase acitivity) produced was measured using a HitHunter (R) cAMP assay kit to calculate an ECso value for the receptor of GLP-1. The measurement results are shown in Table 17.
  • sample 100 (10 ug/mouse, based on SEQ ID NO: 1) was orally administered to 9-week-old male mice (C57BL/6) at -60 minutes, and then 200 uL of glucose ( 2 g/kg) was injected intraperitoneally, and blood glucose changes in blood collected from the tail vein were observed at -60, 0, 20, 40, 60, 90, and 120 minutes.
  • the subcutaneous administration of the polypeptide having the amino acid sequence of SEQ ID NO: 5 was used as Control 1
  • the oral administration was used as Control 2.
  • Conjugates 65 and 66 After oral administration of the conjugates 65 and 66 to mice, the blood glucose control efficacy was measured through a glucose tolerance test. In order to measure intraperitoneal glucose tolerance in an animal model, the sample was orally administered to an 8-week-old male mouse ⁇ 57 ⁇ /6) at -20 minutes, and then glucose (2 ⁇ /13 ⁇ 4) was intraperitoneally injected and -20, 0 At 20, 40, 60, 90, and 120 minutes, blood glucose changes in blood collected from the tail vein were observed. Controls are the 6th and 11th cysteines of SEQ ID NO: 15, SEQ ID NO: 15
  • Caco-2 cell membrane permeability measurement Conjugates 17, 51, 72 and 73
  • the conjugate 51 was dissolved in Hanks Balanced Salt Solut ion (HBSS), and Caco-2 cell membrane permeability was measured.
  • HBSS Hanks Balanced Salt Solut ion
  • the TEER value and the Luci fer yel low value are measured, and only the cell monolayer membrane whose TEER value is 300 Q x cirf or higher and the Luci fer yel low transmittance value is within 3% is used for the test did.
  • the prepared drug and the permeability marker (Permeabi 1 ity marker) are applied to the apical side by 200 y L each.
  • the basolateral side was treated with 1 mL of drug-free transport media, and incubated for 2 hours at 37 ° C in a CO2 incubator.
  • the permeability coefficient (p app vaiue ) of the water sampled by 1 mL each from the basolateral side was measured by the enzyme-linked immunosorbent assay (ELISA).
  • the transmittance coefficient (Papp) value was calculated as follows, and the analysis results are as shown in Table 21 same. (At this time, each conjugate was prepared in the same manner as in Preparation Example)
  • Conjugates 68 and 69 The conjugates 68 and 69 were dissolved in Hanks Balanced Salt Solut ion (HBSS), and the amount of Caco-2 intracellular accumulation was measured.
  • HBSS Hanks Balanced Salt Solut ion
  • Caco-2 cells were aliquoted into 7 x 10 4 per well in a 96-well plate and cultured in a C02 incubator at a temperature of 37 ° C. After 24 hours, after removing the culture solution from each well, after washing with HBSS, 100 ul of the prepared drug was added and incubated at 37 °C, CO 2 incubator.
  • each well was washed with PBS and then treated with 10% formalin for 100 ul each, and then reacted at room temperature turned on After 10 minutes, each well was washed with PBS, treated with 0.1% TRITON X-100 by 100, and then reacted at room temperature. After 10 minutes, each well was washed with PBS and blocked with 1% BSA for 1 hour. Iku, it was treated with HRP Anti-Growth Hormone antibody (1:1000). After 1 hour, each well was washed with PBST, and Ultra TMB substrate solution was added thereto. After 10 minutes, each well was treated with 2N HCL stop solution and absorbance was measured at 450 nM to calculate the intracellular accumulation of each material. The results were based on 100% hGH, and the measurement results are as shown in Table 22 and FIG. 16 . (At this time, the conjugate prepared in the same manner as in Preparation Example was used)
  • each conjugate was prepared in the same manner as in Preparation Example
  • the weight loss is as shown in Table 23 below
  • the feed intake is as shown in FIG. 12 .
  • the single polypeptide-administered group had weight loss and reduced feed intake, but compared to the single polypeptide-administered group, the conjugate-administered group showed excellent effects on weight loss and feed intake reduction.
  • the present invention can be usefully used in the pharmaceutical field as the oral absorption rate is improved.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Epidemiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Nutrition Science (AREA)
  • Physiology (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Endocrinology (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 비오틴 모이어티, 지방산 모이어티 또는 이의 조합이 생리활성 물질과 결합된 생리활성 물질 접합체, 보다 상세하게는 비오틴 모이어티 및 지방산 모이어티가 결합된 생리활성 물질 접합체에 관한 것으로, 본 발명에 따른 비오틴 모이어티 및 지방산 모이어티가 결합됨에 따라 생리활성 물질은 체내 경구 흡수율이 우수하고, 약물동태학적으로 우수한 효과를 가진다.

Description

2022/112849 1»（그1’/182021/022237
【명세서】
【발명의 명칭】 비오틴 모이어티， 지방산 모이어티 또는 이의 조합이 결합된 생리활성 물질 접합체
【기술분야】 본 발명은 신규한 비오틴 모이어티， 지방산 모이어티 또는 이의 조합이 결합 된 생리활성 물질 접합체에 관한 것으로， 상세하게는 체내 경구 흡수율이 우수하 고， 약물동태학적으로 우수한 비오틴 모이어티， 지방산 모이어티 또는 이의 조합이 결합된 생리활성 물질 접합체， 보다 더 상세하게는 비오틴 모이어티 및 지방산 모 이어티가 결합된 생리활성 물질 접합체에 관한 것이다.
【배경기술】 약물이 효과적으로 작용하기 위해서는 높은 생체이용률이 확보되어야 한다. 생체이용율은 약물 투여후 목적 부위에서 이용되는 약물의 정도를 의미하는 것으 로， 투여 방식， 표적 환경 등에 의해 그 정도가 상이하다. 약물은 투여된 위치에서 표적까지 전달되는 과정에서 소실되거나， 분해될 수 있고 이는 투여 방식에 따라 달리 나타난다. 일반적으로， 단백질， 폴리펩티드 등을 포함하는 치료제의 약물 전달은 비경 구 투여방식과 경구 투여방식으로 나누어 진다. 비경구 투여방식은 정맥주사， 근육 주사， 피하주사， 설하투여 등이 있으며， 경구 투여방식은 입으로 약물을 섭취하는 2022/112849 1»（그1’/182021/022237 것을 의미한다. 대부분의 단백질， 폴리펩티드 등의 치료제는 생체이용률， 표적 환 경， 전달 과정 등을 고려하여 비경구 방식에 의해 투여되고 있으며， 비경구 투여방 식이 직접적으로 신속한 효과를 나타내는 것으로 알려져 있다. 다만， 비경구 투여 방식은 환자의 통증이나 불편함을 야기할 수 있고， 경로에 따라 주사감염， 공기색 전 등의 부작용이 나타날 수 있다. 이에 비해 경구 투여방식의 경우， 입으로 직접 투여하는 방식이므로， 투약이 간편하며， 효과가 지속적으로 나타날 수 있다는 장점 이 있다 . 이에 많은 제약사들은 경구 투여방식에 의해 치료제를 투여하려는 시도를 이어오고 있으나， 경구 투여는 소화기관을 거치므로 산성 환경， 효소 분해 등의 저 항이 요구된다는 문제가 있다. 특히， 단백질， 펩티드의 경우 경구투여되는 경우 0.1% 내외의 낮은 생체이용률을 갖는다고 알려져 있다. 경구 투여시의 이러한 문제를 해결하기 위하여， 계면활성제， 흡수 촉진제 등 을 함께 사용하여 별도의 제제로 제조하거나 약물 입자의 미세화， 투여 횟수 조절 등의 방식으로 약물의 전달을 높이려는 시도가 이루어지고 있다. 이와 관련하여， 대형 제약사에서는 경구용 인슐린， 경구용 (¾ -1 유사체 등이 개발되고 있으며， 그 외에도 경구용 인터페론 알파 등의 경구 투여를 위한 다양한 연구개발이 진행중에 있다. 다만， 펩티드， 단백질 약물은 경구 투여가 어려운 물질로， 이를 해결하기 위 하여 다양한 시도가 이루어지고 있으나 현재까지 명확하게 해결된 «1 - 없다.
【발명의 상세한 설명】
【기술적 과제】 본 발명의 목적은 체내 경구 흡수율이 우수하고， 약물동태학적으로 우수한 2022/112849 1»（그1’/182021/022237 효과를 나타내는 비오틴 모이어티， 지방산 모이어티 또는 이의 조합이 결합된 생리 활성 물질 접합체를 제공하는 것이다. 보다 상세하게는， 비오틴 모이어티 및 지방 산 모이어티가 결합된 생리활성 물질 접합체를 제공하는 것이다.
【기술적 해결방법】 본 발명의 일 측면은 비오틴 모이어티， 지방산 모이어티 또는 이의 조합과 결합된 생리활성 물질 접합체 및 이의 제조방법을 제공한다. 본 발명의 또 다른 측면은 비오틴 모이어티， 지방산 모이어티 또는 이의 조 합과 결합된 생리활성 물질 접합체를 포함하는 약학적 조성물을 제공한다. 본 발명의 다른 측면은 비오틴 모이어티， 지방산 모이어티 또는 이의 조합과 결합된 생리활성 물질 접합체를 포함하는 경구 투여용 조성물을 제공한다. 구체적인 본 발명의 일 측면은 비오틴 모이어티 및 지방산 모이어티가 결합 된 생리활성 물질 접합체 및 이의 제조방법을 제공한다. 본 발명의 또 다른 측면은 비오틴 모이어티， 지방산 모이어티 또는 이의 조 합과 결합된 생리활성 물질 접합체를 포함하는 당뇨병， 비만， 지방간 질환， 과민성 장 증후군， 신경퇴행성 질환， 골 질환， 골다공증， 인간 성장 호르몬 결핍증， 항암 또는 비알코올성 지방간질환의 예방 또는 치료용 약학적 조성물을 제공한다 .
【발명의 효과】 본 발명의 일 실시형태에 따른 비오틴 모이어티， 지방산 모이어티 또는 이의 조합과 결합된 생리활성 물질 접합체는 수용성 비오틴이 결합되어 우수한 효과를 2022/112849 1»（그1’/182021/022237 가진다. 구체적으로， 경구 흡수율 향상， 약물 동태학적 효과 향상， 효소로부터의 생리활성 물질의 분해 방어， 생리활성 물질의 장관 막 투과 촉진， 또는 나트륨 의 존성 멀티비타민 수송체를 통한 능동 수송 흡수효과를 가진다. 또한， 본 발명의 일 실시형태에 따른 비오틴 모이어티 및 지방산 모이어티가 결합된 생리활성 물질 접합체는 비오틴 모이어티 또는 지방산 모이어티가 단독 결 합된 접합체에 비해 상기 각 효과 측면에서 더욱 우수한 효과를 나타낸다.
【도면의 간단한 설명】 도 1은 본 발명의 일 실시형태에 따른 접합체 14 내지 17의 정제 크로마토그 램이다. 도 2는 본 발명의 일 실시형태에 따른 접합체 18 내지 19의 정제 크로마토그 램이다. 도 3은 본 발명의 일 실시형태에 따른 접합체 20 및 24의 최종 물질에 대한 크로마토그램이다. 도 4는 본 발명의 일 실시형태에 따른 접합체 20 및 24의 글루코오스 투여 후 혈당 변화를 나타낸 도이다. 도 5는 본 발명의 일 실시형태에 따른 접합체 51 내지 52의 최종 물질에 대 한 크로마토그램이다. 도 6는 본 발명의 일 실시형태에 따른 접합체 53 내지 54의 정제 크로마토그 램이다. 도 7은 본 발명의 일 실시형태에 따른 접합체 53 및 54의 글루코오스를 투여 2022/112849 1»（그1’/182021/022237 한 후 혈당 변화를 나타낸 도이다. 도 8은 본 발명의 일 실시형태에 따른 접합체 55 내지 59의 정제 크로마토그 램이다. 도 9는 본 발명의 일 실시형태에 따른 접합체 56의 최종 물질에 대한 크로마 토그램이다. 도 10은 본 발명의 일 실시형태에 따른 접합체 58 내지 59의 2주간 피하 투 여후 체중 변화를 나타낸 도이다. 도 11은 본 발명의 일 실시형태에 따른 접합체 60 내지 64의 정제 크로마토 그램이다. 도 12는 본 발명의 일 실시형태에 따른 접합체 33， 36， 39， 42， 61 , 62, 63 및 64의 경구 투여후 사료 섭취량을 나타낸 도이다. 도 13은 본 발명의 일 실시형태에 따른 접합체 66의 정제 크로마토그램이다. 도 14는 본 발명의 일 실시형태에 따른 접합체 65 및 66의 경구 투여후 혈당 조절능을 나타낸 도이다. 도 15은 본 발명의 일 실시형태에 따른 접합체 69의 정제 크로마토그램이다. 도 16은 본 발명의 일 실시형태에 따른 접합체 68 및 69의 세포내 축적량을 나타낸 도이다.
【발명의 실시를 위한 최선의 형태】 본 발명의 일 측면은 비오틴 모이어티 및 지방산 모이어티가 결합된 생리활 성 물질 접합체 및 이의 제조방법을 제공하는 것이다. 2022/112849 1»（그1’/182021/022237
【발명의 실시를 위한 형태】 이하， 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자가 용이하게 본 발명을 실시할 수 있도록 본 발명의 구현예 및 실시 예를 상세히 설명한다. 그러나 본 발명은 여러 가지 상이한 형태로 구현될 수 있으며 여기에서 설명 하는 구현예 및 실시 예에 한정되지 않는다. 본 발명의 명세서 전체에서， 어떤 부분 이 어떤 구성 요소를 “포함” 한다고 할 때， 이는 특별히 반대되는 기재가 없는 한 다른 구성 요소를 제외하는 것이 아니라 다른 구성요소를 더 포함할 수 있는 것을 의미한다 . 본 발명의 명세서 전체에서 사용되는 정도의 용어 “약” ， “실질적으로” 등은 언급된 의미에 고유한 제조 및 물질 허용오차가 제시될 때 그 수치에서 또는 그 수치에 근접한 의미로 사용되고， 본 발명의 이해를 돕기 위해 정확하거나 절대 적인 수치가 언급된 개시 내용을 비양심적인 침해자가 부당하게 이용하는 것을 방 지하기 위해 사용된다. 본 발명의 명세서 전체에서 사용되는 정도의 용어 “하는 단계 ” 또는 “의 단계 ” 는 “를 위한 단계 ” 를 의미하지 않는다. 본 발명의 명세서 전체에서， 마쿠시 형식의 표현에 포함된 “이들의 조합” 의 용어는 마쿠시 형식의 표현에 기재된 구성 요소들로 이루어진 군에서 선택되는 하나 이상의 혼합 또는 조합을 의미하는 것으로서， 상기 구성 요소들로 이루어진 군에서 선택되는 하나 이상을 포함하는 것을 의미한다. 본 발명의 명세서 전체에 서， “및/또는 의 기재는， “및 또는 쇼 또는 표 "를 의미한다. 본 발명의 일 측면은 비오틴 모이어티， 지방산 모이어티 또는 이의 조합과 결합된 생리활성 물질 접합체 및 이의 제조방법을 제공하는 것이다. 구체적인 본 발명의 일 측면은 비오틴 모이어티 및 지방산 모이어티가 결합된 생리활성 물질 접 합체 및 이의 제조방법을 제공하는 것이다 일반적으로 펩티드 및 단백질 약물은 고수용성으로 위장관 흡수 부위에 제약 이 있는 BCS(Biopharmaceut ical Classi f icat ion System) 클래스 3에 해당한다. 펩 티드 및 단백질 약물은 높은 친수성과 큰 분자량을 가지며， 낮은 pH의 위산에 의해 분해될 수 있고， 트립신과 같은 효소의 공격을 받아 장내 흡수율이 낮은 특성을 가 진다. 일반적으로 펩티드 및 단백질 약물의 경구 흡수율 (oral bioavai labi l ity, BA)이 0.1 % 내외로 약제학적 조성물로 사용되기 어려운 점이 있다. 이러한 문제점 을 개선하기 위하여 장용 캡슐을 이용하여 위를 통과하는 기술이 사용되고 있으나， 펩티드 및 단백질의 흡수율을 근본적으로 개선하지 못하는 한계가 있다. 이에 반하여 본 발명의 일 실시형태에 따른 비오틴 모이어티， 지방산 모이어 티 또는 이의 조합과 결합된 생리활성 물질 접합체는 장관막 투과를 증가시켜 장내 에서 흡수가 촉진될 수 있다. 또한， 본 발명의 일 실시형태에 따른 비오틴 모이어티， 지방산 모이어티 또 는 이의 조합과 결합된 생리활성 물질 접합체는 약물동태학적으로 우수한 효과를 나타낼 수 있다. 또한， 본 발명의 일 실시형태에 따른 비오틴 모이어티， 지방산 모이어티 또 는 이의 조합과 결합된 생리활성 물질 접합체는 효소로부터 펩티드 등의 생리활성 물질이 분해되는 것을 방어할 수 있고， 궁극적으로 생리활성 물질이 장관 막을 투 2022/112849 1»（그1’/182021/022237 과하여 장내에서 흡수가 촉진될 수 있다. 또한， 본 발명의 일 실시형태에 따른 비오틴 모이어티， 지방산 모이어티 또 는 이의 조합과 결합된 생리활성 물질 접합체는 수용성 비타민의 한 종류인 비오틴 과 결합됨으로써 나트륨 의존성 멀티비타민 수송체를 통해 능동 수송으로 흡수될 수 있다. 또한， 본 발명의 일 실시형태에 따른 비오틴 모이어티， 지방산 모이어티 또 는 이의 조합은 생리활성 물질의 활성 부위 또는 비활성 부위에 결합될 수 있고， 이에 따라 생리활성 물질의 활성을 저해시키지 않을 수 있다. 본 발명에서 ”비치환되거나 치환된"은 비치환될 수 있거나 또는 치환될 수 있는 것을 의미하며， ”치환된 ”은 1 이상의 치환기를 가지고， 치환기는 알킬렌， 헤 테로알킬렌 등의 주 그룹의 임의원자와 공유결합되거나 융합된 화학적 부분을 의미 한다. 본 발명에서 ”할로"는 플루오린， 클로린， 브로민， 요오드 등을 의미한다. 본 발명에서 "알킬 ”은 지방족 또는 지환족， 포화 또는 불포화 탄화수소 화합 물의 탄소 원자로부터 수소 원자를 제거하여 얻어진 1가 부분을 의미하는 것으로 서， 예를 들면， 메틸， 에틸， 프로필， 부틸， 펜틸， 핵실， 11-프로필， 11-부틸， 11-펜 틸， 이소프로필， 이소부틸
Figure imgf000010_0001
161寸_부틸， 이소펜틸， 네오펜틸 등이 있다. 본 발명에서 “헤테로알킬” 은 1 이상의 헤테로 원자를 포함하는 알킬로서， 헤테로 원자는 알킬의 임의의 탄소 원자 하나의 위치에 헤테로 원자가 위치하여， 0, 012 또는 ［：¾를 대체한 것을 의미한다. 2022/112849 1»（그1’/182021/022237 본 발명에서 ”알킬렌 "은 지방족 또는 지환족， 포화 또는 불포화 탄화수소 화 합물의 탄소 원자로부터 수소 원자를 제거하여 얻어진 2가 부분을 의미한다. 본 발명에서， “알케닐렌” 은 지방족 또는 지환족， 포화 또는 불포화 탄화 수소 화합물의 탄소 원자로부터 수소 원자를 제거하여 얻어진 1가 부분을 의미한 다. 본 발명에서 “헤테로알킬렌” 은 1 이상의 헤테로 원자를 포함하는 알킬렌을 의미한다. 본 발명에서 ”아릴"은 고리 원자를 갖는 방향족 화합물의 방향족 고리 원자 로부터 수소 원자를 제거하여 얻어진 1가 부분을 의미한다. 예를 들어 5-10아릴”은 탄소가 5 내지 10 개의 고리 원자를 갖는 것으로서， 방향족 화합물의 방향족 고리 원자로부터 수소 원자를 제거함으로써 수득되는 1 가 부분을 의미한다. 아릴의 예 로서， 벤젠， 아세나프텐， 플루오렌， 페날렌， 아세페난트렌 및 아세안트렌으로부터 유도된 기가 있다. 본 발명에서 ”헤테로아릴"은 1 이상의 헤테로 원자를 포함하는 아릴로서， 예 를 들면， 피리딘， 피리미딘， 벤조티오펜， 푸릴， 디옥살라닐， 피롤릴， 옥사졸릴， 피 리딜， 피리다지닐， 피리미디닐， 이소벤조푸란， 인돌， 이소인돌， 인돌리진， 인돌린， 이소인돌린， 푸린， 벤조디옥산， 퀴놀린， 이소퀴놀린， 퀴놀리진， 벤족사진， 벤조디 아진， 피리도피리딘， 퀴녹살린， 퀴나졸린， 신놀린， 프탈라진， 나프티리딘， 프테리 딘， 페리미딘， 피리도인돌， 옥산트렌， 페녹사티인， 페나진， 페녹사진， 등이 있다. 본 발명에서 “아릴렌” 은 고리 원자를 갖는 방향족 화합물의 방향족 고리 원자로부터 수소 원자를 제거하여 얻어진 2가 부분을 의미한다. 2022/112849 1»（그1’/182021/022237 본 발명에서 “헤테로아릴렌” 은 1 이상의 헤테로 원자를 포함하는 아릴렌을 의미한다. 본 발명에서 ”알케닐"은 1 이상의 탄소-탄소 이중 결합을 갖는 알킬로서， 예 를 들면， 바이닐（-대=抑 2）， 1 -프로페닐（-대=抑抑 3）， 이소프로페닐， 부테닐， 펜테닐， 핵세닐 등이 있다 . 본 발명에서 ”알키닐"은 1 이상의 탄소-탄소 삼중 결합을 갖는 알킬기로서， 예를 들면 에티닐 및 2 -프로피닐 등이 있다. 본 발명에서 일반식의 일부가 구체적인 화합물로 정의된 경우， 이는 해당 화 합물이 다른 구성과 결합된 형태를 포함한다. 본 발명의 일 실시형태에 따르면， 비오틴 모이어티는 하기 일반식 쇼로 표시 될 수 있다.
［일반식 시
Figure imgf000012_0001
상기 일반식 쇼에서，
X는 생리활성 물질과 결합할 수 있는 작용기이고， 는 스페이서이며，
2는 바인딩 유닛이고， 표는 하기 화학식 /ᅡ1로 표시될 수 있으며， 2022/112849 1»（그1’/182021/022237
[화학식 쇼-1]
Figure imgf000013_0001
는 화학식 쇼-1의 ^ '■广、 와 연결되고，는 말단기 이며， m은 1 내지 10의 정수이고，
II은 0 또는 1 내지 10의 정수이며， 11=0인 경우 는 6 또는 에 직접 결합하 고，
I）는 0 또는 1의 정수이다 . 본 발명의 일 실시 형 태에 따르면， 상기 일반식 쇼에서， 표는 생리활성 물질과 결합할 수 있는 작용기 이다 . 이 에 제한되지 않으나， 상기 작용기는 티올기， 카복실 기 및/또는 아민기와 반응할 수 있는 작용기， 예를 들면 말레이미드， 석신이미드， 하이드록시석신이미드， 알데하이드， 카르복실， 카르복실 에스테르， 숙식 이미 딜
Figure imgf000013_0002
아대 11101'01）11태기）， 테트라플루오로페닐 에스테르， 펜타플루오로페닐作? ， 펜타 플루오로페닐 에스테르， -0 -벤조트리아졸， 벤조트리아졸， 설포테트라플루오로페 닐（ ， 설포디클로로페닐 卵）， 니트로페놀， 니트로페닐 카보네이트（ 0 등을 2022/112849 1»（그1’/182021/022237 포함할 수 있다. 본 발명의 일 실시형태에서， 상기 작용기 표는 생리활성 물질과 결합할 때 구 조가 유지되거나 탈락 또는 변형될 수 있다. 상기 는 스페이서로 체내에서 절단성을 가지는 구조일 수 있다. 이에 제한 되는 것은 아니나， 예를 들면 는 직접결합에 해당하거나， 치환 또는 비치환된 알 킬렌， -0 -, (0)·-， (0)0 -또는 (0) -，
Figure imgf000014_0001
포함할 수 있다. 보 다 구체적으로 는 직접결합에 해당하거나， 의 구조 내에 치환 또는 비치환된 01-50 선형 알킬렌， 치환 또는 비치환된 01-50 비선형 알킬렌， 치환 또는 비치환된 01-50 선 형 헤테로알킬렌， 치환 또는 비치환된 01-50 비선형 헤테로알킬렌， 치환 또는 비치환 된 01-50 아릴렌， 치환 또는 비치환된 01-50 헤테로아릴렌， -0 -, -0(0), - 0川묘 -， -0(0)0 -,
Figure imgf000014_0002
구성된 그룹으로부터 하나 이상을 포함할 수 있 고， 여기에서 묘은 수소， 치환 또는 비치환된 01-50 알킬， 치환 또는 비치환된 01-50아 릴， 또는 에틸렌글리콜 반복단위 (-(抑 20120^ -， II은 1 이상 20이하의 정수)일 수 있 다. 상기 1는 8와 결합될 수 있는 바인딩 유닛으로， 이에 제한되지 않으나， 예를 들면， 아미노산， 폴리펩티드， 알킬렌， 아민， 또는 폴리아미도아민 구조를 포함할 수 있다. 또한， 이에 제한되지 않으나， 예를 들면， 상기 아미노산은 라이신， 5 -하이드 록시라이신， 4 -옥살라이신， 4 -티아라이신， 4 -셀레나라이신， 4 -티아호모라이신， 5, 5 -디메틸라이신， 5, 5 -디플루오로라이신， 트랜스- 4 -디하이드로라이신(仕 3-4- (16]¾년1'01731116)， 2, 6 -디아미노- 4 -핵시노산， 시스- 4 -디하이드로라이신 2022/112849 1»（그1’/182021/022237
（1산¾년1017^116）， 6 _메틸라이신， 다이미노피멜산， 오르니틴， 3 -메틸오르니틴， 3- 메틸오르니틴， 시트룰린， 호모시트룰린， 아르기닌， 아스파테이트， 아스파라긴， 글 루타메이트， 글루타민， 히스티딘， 오르니틴， 프롤린， 세린， 또는 트레오닌을 포함 할 수 있다. 본 발명에서， 상기 II이 0인 경우 6 또는 I는， X 또는 （스페이서）와 직접 결 합할 수 있다. 본 발명에서， 상기 는 말단기로 이에 제한되지 않으나， 예를 들면 수소， 또 는 ■일 수 있다. 본 발명에서， 상기 ]3가 0인 경우 상기 8가 말단일 수 있다. 본 발명에서， 상기 표나가 함께 생리활성 물질 결합 부위를 형성할 수 있다. 본 발명의 일 실시형태에 따르면， 상기 일반식 쇼에서 m은 1 내지 10의 정수 일 수 있으며， 구체적으로 1 내지 8, 1 내지 5, 1 내지 4의 정수일 수 있다. 본 발명의 일 양태에서， 상기 표는 말레이미드， 석신이미드， I하이드록시석 신이미드， 석신이미딜 석시네이트， 석신이미딜 글루타레이트， 석신이미딜 메틸에스 터， 석신이미딜 펜틸에스터， 석신이미딜 카보네이트， 니트로페닐카보네이트， 알 데하이드， 아민， 티올， 옥시아민， 아이오도아세트아마이드， 아미녹실， 하이드라지 드， 하이드록시， 프로피오네이트， 피리딜， 알킬할라이드， 비닐술폰， 카복실， 하이 드라지드， 할로겐 아세트아마이드， 02-5 알키닐， 06-20 아릴디설파이드， 05-20 헤테로아 릴디설파이드， 이소시아네이트， 티오에스테르， 이미노에스테르， 및 이의 유도체로 이루어진 그룹으로부터 선택될 수 있다. 2022/112849 1»（그1’/182021/022237 구체적인 본 발명이 일 양태에서， 상기 표는 말레이미드， I하이드록시석신이 미드， 석신이미딜 카보네이트， 니트로페닐카보네이트， 티올， 아미녹실， 알데하이 드 또는 아민이다. 구체적인 본 발명이 일 양태에서， 상기 표는 말레이미드， I하이드록시석신이 미드， 알데하이드 또는 아민이다. 본 발명의 일 양태에서， 상기 는 부재하거나 치환되거나 비치환된 선형 또 는 분지형 01-50 알킬렌， 치환되거나 비치환된 선형 또는 분지형 01-50 헤테로알킬렌， 치환되거나 비치환된 06-50 아릴렌， 또는 치환되거나 비치환된 06-50 헤테로아릴렌이 며， 치환된 경우 =0， (0) 2， _예， -⑶예， - ， =■ 및 出로 구성된 그룹으로부 터 선택된 하나 이상을 포함한다. 본 발명의 일 양태에서， 상기 는 (0) -를 포함한다. 본 발명의 일 양태에 서， 는 (0)· -를 포함한다. 본 발명의 일 양태에서， 상기 는 치환된 선형 또는 분지형 01-50 헤테로알킬 렌이고， 최소 하나 이상의 (0) -를 포함한다. 본 발명의 일 양태에서， 상기 는 -ᄄ(0)) (抑 2 -ᄄ(0) )!；-(012 - (0抑 2抑 2)厂( 0)九-이고， 여기에서 (1， I·， 는 독립적으로 선택되며， (1， 는 0 또 는 1이고， I·은 1 내지 20의 정수이며， 는 0 내지 20의 정수이다. 본 발명의 일 양태에서， 상기 는 _(抑 2) (0)·· -이고， 여기에서 I·은 1 내 지 20의 정수이다. 본 발명의 일 양태에서， 상기 는 (0)-(0012抑 2 -· -를 반복단위로 포함하 2022/112849 1»（그1’/182021/022237 고， 여기에서 11은 1 내지 20의 정수이다. 본 발명의 일 양태에서， 상기 는 （0）-（0012抑 2 -· -를 반복단위로 포함하 고， 여기에서 11은 2 내지 4의 정수이다. 본 발명의 일 양태에서， 상기 는 아미노산을 구성 일부로 포함한다. 구체적인 본 발명의 일 양태에서， 상기 는 글루탐산（요1 £1111八： 301（1） , 글루 타민（요1 _1116） , 글리신（요1 （ 116） , 이소류신（ 01611（ 116） , 또는 리신（11 116）을 구성 일부로 포함하고， 여기에서 각 아미노산은 결합된 형태로 존재할 수 있다. 구체적인 본 발명의 일 양태에서， 상기 V는 글루탐산 또는 리신을 구성 일부 로 포함한다. 본 발명의 일 양태에서， 상기 는 지방산을 구성 일부로 포함한다. 구체적인 본 발명의 일 양태에서， 상기 는 2-24의 지방산을 포함하고， 여기 에서 지방산은 결합된 형태로 존재한다. 본 발명의 일 양태에서， 상기 는 직접결합이다. 본 발명의 일 양태에서， 상기 는 하기 중 어느 하나이고 각각 독립적으로 선택될 수 있다.
3） 표와 함께 또는 표와 별도로， 아미노산 또는 이의 유도체를 형성하거나;
13） 치환되거나 비치환된 선형 또는 분지형 01-50 헤테로알킬렌이며， 여기에서 치환된 경우， =0， （0） 2， _예， -⑶예， - ， =■ 및 出로 구성 된 그룹으로부터 선택된 하나 이상을 포함한다. 본 발명의 일 양태에서， 상기 V 8와 _硏1 -를 통해 연결되는 것이다. 본 발명의 일 양태에서， 상기 는 친수성 아미노산 또는 이의 유도체이다. 구체적인 본 발명의 일 양태에서， 상기 는 리신 (lysine) , 아르기 닌 (arginine) , 히스티딘 (hist idine)， 글루타민 (glutamine)， 아스파라 긴 (asparagine)， 트레오닌 (threonine)， 시스테인 (cysteine)， 세린 (serine) 및 이의 유도체로 구성된 그룹으로부터 선택될 수 있다. 본 발명의 일 양태에서， 상기 는 하나 이상의 글리세롤， 하나 이상의 폴리 에틸렌 글리콜 또는 이의 결합을 포함한다.
Figure imgf000018_0001
Figure imgf000018_0003
가 하나 이상 결합되고， 여기에서 II는 1 내지 20의 정수이 다.
Figure imgf000018_0002
본 발명의 일 양태에서， 상기 는 을 포함하고， 2022/112849 1^(:1^ 2021/022237
Figure imgf000019_0001
에 _（예2）3·-가 더 결합된다. 본 발명의 일 양태에서, 상기 비오틴 모이어티는
Figure imgf000019_0002
Figure imgf000020_0001
Figure imgf000021_0001
Figure imgf000022_0001
Figure imgf000023_0001
Figure imgf000024_0001
Figure imgf000025_0001
Figure imgf000026_0001
Figure imgf000027_0001
Figure imgf000028_0001
Figure imgf000029_0001
Figure imgf000030_0001
Figure imgf000031_0001
2022/112849 1^(:1^ 2021/022237
Figure imgf000032_0001
선택되는 것 이다. 본 발명의 일 실시형태에 따르면， 지방산 모이어티는 하기 일반식 B로 표시 될 수 있다.
[일반식 B]
X' -Y' -ff 상기 식에서，은 상기 생리활성 물질과 결합할 수 있는 작용기이고， r는 스페이서이며，
V는 지방산이다. 본 명세서에서 지방산은 포화 또는 불포화된 긴 지방족 사슬을 가지고 있는 카복실산을 포함하며， 이에 제한되는 것은 아니나 예를 들면， 포화 지방산의 일종 인 카프릴산 (Capryl ic acid) , 라우르산 (Laurie acid) , 팔미트산 (Palmit ic acid) , 스테아르산 (Stearic acid) , 아라키드산 (Arachidic acid) , 세로트산 (Cerot ic acid) , 불포화 지방산의 일종인 미리스톨레산 (Myristoleic acid) , 팔미톨레산 (Palmitoleic acid) , 올레산 (Oleic acid) , 리놀레산 (Linoleic acid) , 알파-리놀렌산 (alpha- Linolenic acid) 등을 포함한다. 본 발명의 일 실시형태에 따르면， 상기 일반식 B에서， 은 생리활성 물질과 결합할 수 있는 작용기이다. 여기에서 은 상기 일반식 A에서 표와 동일하다. 따라 서， 본 발명의 일 실시형태에서， 상기 작용기 은 생리활성 물질과 결합할 때 구 조가 유지되거나 탈락 또는 변형될 수 있다. 본 발명의 일 실시형태에 따르면， 상기 일반식 B에서， 는 지방산에 해당할 2022/112849 1»（그1’/182021/022237 수 있다. 여기에서 지방산은 단순 지방산을 포함하여， 변형， 부가， 삭제 등의 모든 변형 가능한 형태의 지방산을 포함한다. 본 발명의 일 양태에서， 상기 는 상기 일반식 쇼에서 와 동일하다. 따라 서， 본 발명의 일 실시형태에서， 상기 스페이서 ［는 직접결합에 해당하거나， 의 구조 내에 치환 또는 비치환된 01-50 선형 알킬렌， 치환 또는 비치환된 01-50 비선형 알킬렌， 치환 또는 비치환된 01-50 선형 헤테로알킬렌， 치환 또는 비치환된 01-50 비 선형 헤테로알킬렌， 치환 또는 비치환된 01-50 아릴렌， 치환 또는 비치환된 01-50 헤 테로아릴렌， -0 -, -0(0), -0(0)·-， -0(0)0 -,
Figure imgf000034_0001
-·- 또는 - 예 -로 구성된 그룹 으로부터 하나 이상을 포함할 수 있고， 여기에서 묘은 수소， 치환 또는 비치환된 01- 50 알킬， 치환 또는 비치환된 -50아릴， 또는 에틸렌글리콜 반복단위 (_(抑 20120^ -， II은 1 이상 20이하의 정수)일 수 있다. 본 발명의 일 양태에서， 상기 는 치환되거나 비치환된 선형 또는 분지형 01- 60 알킬렌， 치환되거나 비치환된 선형 또는 분지형 01-60 알케닐렌， 치환되거나 비치 환된 선형 또는 분지형 01-60 헤테로알킬렌， 또는 치환되거나 비치환된 선형 또는 분 지형 01-60 헤테로알케닐렌이며， 치환된 경우 =0， -◦(0) 2， _예， -⑶예， - ， =■， ¾， 및 할로로 구성된 그룹으로부터 선택된 하나 이상으로 치환될 수 있다. 본 발명의 일 양태에서， 상기 는 하나 이상이 치환된 012-24 알킬렌 또는 하 나 이상이 치환된 比6-48헤테로알킬렌이고， 치환된 경우 =0 또는 -期에를 포함할 수 있다. 구체적인 본 발명의 일 양태에서， 상기 하나 이상이 치환된 는 치환되거나 2022/112849 1»（그1’/182021/022237 비치환된 012-24 포화 지방산이고， 치환된 경우 -期에를 포함한다 . 본 발명의 일 양태에서， 지방산 모이어티는 다음 일반식 의 화학식을 갖는 것일 수 있다.
［일반식 ¾］
Figure imgf000035_0001
상기 식에서， 1은 말레이미드， I하이드록시석신이미드， 알데하이드， 아민， 테트라플루 오로페닐 에스테르 또는 니트로페놀이고， ’은 스페이서이며， 凡은 06-28 치환 또는 비치환된 선형 또는 분지형 알킬렌， 치환 또는 비치환된 선형 또는 분지형 헤테로 알킬렌이다. 본 발명의 일 실시형태에 따르면， 상기 일반식 에서， 1은 상기 일반식 묘에서 표와 동일한 의미를 가질 수 있다. 따라서， 본 발명의 일 실시형태에서， 상기 작용기 1은 생리활성 물질과 결합할 때 구조가 유지되거나 탈락 또는 변형될 수 있다. 또한， 상기 일반식 에서， 상기 ［는 상기 일반식 8에서 와 동일한 의 미를 가질 수 있다. 본 발명의 일 양태에서， ^은 치환되거나 비치환된 06-50의 선형 또는 분지형 헤테로 알킬렌이고， 치환된 경우， =0， (0) 2， _예， -⑶예， - ， =■ 및 - 2로 2022/112849 1»（그1’/182021/022237 구성된 그룹으로부터 선택된 하나 이상을 포함한다. 본 발명의 일 양태에서， 상기 ［은 _（抑 2대20） -을 반복단위로 포함할 수 있 다. 본 발명의 일 양태에서， 상기 ［는 -0（0）-（0012抑 2^-· -를 반복단위로 포함 하고， 여기에서 II은 1 내지 20의 정수이다. 구체적인 본 발명의 일 양태에서， 상기 ^는 - 0）-（0012012쉐}1 -를 반복단 위로 포함하고， 여기에서 II은 2 내지 4의 정수이다. 본 발명의 일 양태에서， 상기 ^는 아미노산 또는 이의 유도체를 구성 일부 로 포함한다. 구체적인 본 발명의 일 양태에서， 상기 ［는 글루탐산（ _比 301（1） , 글루 타민（요1 _1116） , 글리신（요1 （ 116） , 이 소류신（ 01611（ 116） , 또는 리신（11 116）을 구성 일부로 포함하고， 여기에서 각 아미노산은 결합된 형태로 존재할 수 있다. 구체적인 본 발명의 일 양태에서， 상기 ［는 글루탐산 또는 리신을 구성 일 부로 포함한다. 본 발명의 일 양태에서， 상기 凡은 치환 또는 비치환된 010-28 선형 또는 분지 형 알킬렌일 수 있다. 구체적인 본 발명의 일 양태에서， 상기 하나 이상이 치환된 는 치환되거나 비치환된 012-24 포화 지방산이고， 치환된 경우 -期에를 포함한다 . 구체적인 본 발명의 일 양태에서， 상기 凡은 -（012八-［：00}1이고， V는 10 내지
20의 정수이다. 2022/112849 1»（그1’/182021/022237 구체적인 본 발명의 일 양태에서， 상기 凡은 - 0)-(抑 2八-¥예이고， V는 10 내지 20의 정수이다. 구체적인 본 발명의 일 양태에서， 상기 지방산 모이어티는
Figure imgf000037_0001
Figure imgf000038_0001
Figure imgf000039_0001
Figure imgf000040_0001
2022/112849 1^(:1^ 2021/022237
2022/112849 1»（그1’/182021/022237 본 발명의 일 실시형태에 따르면， 비오틴 모이어티， 및/또는 지방산 모이어 티와 생리활성 물질은 다양한 결합으로 형성될 수 있다. 비오틴 모이어티 또는 지 방산 모이어티의 작용기와 생리활성 물질의 작용기가 결합하여 형성될 수 있고， 이 에 제한되지 않으나， 예를 들면， 티올-에테르 결합 또는 아미드 결합으로 형성될 수 있다. 일 구체예에서， 비오틴 모이어티와 생리활성 물질의 결합은 하기 반응식 1과 같은 방식에 의해 결합될 수 있다. 하기 반응식 1에서
Figure imgf000042_0001
함하는 생리활성 물질을 나타내고， 본 발명의 일 실시형태에 따른 말레이미드를 포 함하는 비오틴 모이어티와 생리활성 물질에 존재하는 시스테인 잔기의 티올기（- ） 와의 반응을 나타낸다.
Figure imgf000042_0002
[반응식 1] 일 구체예에서， 비오틴 모이어티와 생리활성 물질의 결합은 하기 반응식 2와
{’;、）一_ 같은 방식에 의해 결합될 수 있다. 하기 반응식 2에서， 、 는 아민기를 포함하는 생리활성 물질을 나타내고， 본 발명의 일 실시형태에 따른 I하이드록시 2022/112849 1»（그1’/182021/022237 석신이미드를 포함하는 비오틴 모이어티와 생리활성 물질에 존재하는 아민기 (- ¾) 와의 반응을 나타낸다.
Figure imgf000043_0001
[반응식 2] 본 발명의 일 실시형태에 따르면， 상기 생리활성 물질은 특별히 제한되지 않 을 수 있다. 본 발명에서 생리활성 물질은 특정 목적을 위하여 체내에 투여될 수 있고， 체내에서 생리화학적 반응 또는 생화학적 반응을 일으키는 물질을 의미한다 . 본 발명의 일 실시형태에 따르면， 상기 생리활성 물질은 약제학적 조성물에 사용되는 물질일 수 있다. 예를 들면， 당뇨병， 비만， 지방간 질환， 과민성 장 증후 군， 신경퇴행성 질환， 골 질환， 골다공증， 인간 성장 호르몬 결핍증， 항암 또는 비 알코올성 지방간질환의 예방 또는 치료에 사용되는 물질일 수 있다. 이는 예시적인 것으로， 상기 생리활성 물질의 종류에 따라 적응증을 달리할 수 있으므로， 상기 적 응증에 제한되는 것은 아니다. 본 발명의 일 실시형태에 따르면， 상기 생리활성 물질은 이에 제한되지 않으 나， 예를 들면， 폴리펩티드， 또는 비펩티드성 중합체일 수 있다. 이에 제한되지 않 으나， 예를 들면， 폴리펩티드， 단백질， 다당류 (1)01 3£10(±£11 또는 이들의 유도 체일 수 있다. 이에 제한되지 않으나， 예를 들면， 상기 생리활성 물질은 글루카 곤 (Glugacon) , GLP-l(Glucagon_l ike pept ide-1) , GLP-2 ( G 1 ucagon- 1 i ke pept ide-2) , GIP(glucose_dependent insul inotropic polypept ide) , 엑센딘- 4(exendin_4) , 인슐 린， 부갑상선 호르몬， 인터페론， 에리트로포이에틴， 칼시토닌， 아밀린， 세로토닌， 리특시맙， 트라스트주맙， 우리카제， 조직 플라스미노겐 활성화제， 티모글로빈， 백 신， 헤파린 또는 헤파린 유사체， 안티트롬빈 III， 필그라스팀， 프라믈린티 드 (praml int ide) 아세테이트， 엑세나티드， 에프티피바티드 (ept i f ibat ide)， 안티베 닌 (ant ivenin) , IgG, IgM, HGH, 티록신， 혈액 응고 인자 VII 및 VIII , 치료제로서 작용하는 당지질， 및 이들의 유도체일 수 있다 . 본 발명의 일 실시형태에 따르면， 비오틴 모이어티는 생리활성 물질에 결합 될 수 있다. 비오틴 모이어티가 생리활성 물질에 결합하여 생리활성 물질의 생물학적 활 성을 저해시키지 않을 수 있고， 이에 따라 생리활성 물질과 동일한 생물학적 활성 또는 향상된 생물학적 활성을 가질 수 있다. 이에 제한되지 않으나， 예를 들면， 상기 생리활성 물질은 노출된 _ 기를 함 유하여 상기 _ 기에 비오틴 모이어티가 결합될 수 있다. 또한， 상기 생리활성 물 질은 노출된 -NH3+기 또는 -NH2기를 함유하여， 상기 노출된 -Nil 기 또는 -NH2기에 비 오틴 모이어티가 결합될 수 있다. 본 발명의 일 실시형태에 따르면， 비오틴 모이어티는 생리활성 물질과의 결 합 위치가 조절되어 활성을 나타내는 위치를 피하여 결합될 수 있다. 2022/112849 1»（그1’/182021/022237 또한， 본 발명의 일 실시형태에 따르면， 상기 지방산 모이어티는 생리활성 물질에 직접결합할 수 있다. 또한， 상기 지방산 모이어티의 일부는 비오틴 모이어 티와 공통될 수 있다. 예를 들어， 하기 실시 예의 일 양태에서， 비오틴 모이어티 635, 836는 지방산 모이어티의 일부분인 지방산 부분을 공통적으로 포함한다. 다 만， 이는 일 예시에 해당하는 것으로 이에 제한되는 것은 아니다. 또한， 본 발명의 일 실시형태에 따르면， 상기 지방산 모이어티는 생리활성 물질에 결합되고， 상기 비오틴 모이어티가 결합된 부위와 다른 부위에 결합된 것일 수 있다. 또한， 지방산 모이어티도 비오틴 모이어티와 동일하게 생리활성 물질의 활성 부위 또는 비활성 부위에 결합될 수 있으며， 상기 특성과 동일한 특성을 나타낼 수 있다. 본 발명의 일 실시형태에 따르면， 비오틴 모이어티와 지방산 모이어티가 모 두 생리활성 물질과 결합될 수 있고， 비오틴 모이어티와 지방산 모이어티가 모두 결합된 생리활성 물질 접합체는 비오틴 모이어티 또는 지방산 모이어티가 단독 결 합된 접합체와 비교하여， 경구흡수율， 약물동태， 효소분해억제， 장관 막 투과 등이 우수하게 나타날 수 있다. 본 발명의 일 실시형태에 따르면， 상기 생리활성 물질은 글루카곤， 칼시토 닌， 此 1， 此 2， 01?, 엑센딘- 4, 부갑상선 호르몬， 인슐린， 아밀린， 인간 성장 호르몬 또는 이의 유도체일 수 있다. 본 발명의 일 실시형태에 따르면， 상기 생리활성 물질은 하기 서열번호 1 내 2022/112849 1»（그1’/182021/022237 지 7 중 어느 하나의 아미노산 서열을 가지는 폴리펩티드 또는 이의 유도체일 수 있다. 구체적으로， 하기 서열번호 1 내지 7의 생리활성 물질은 각각 글루카곤 유도 체（서열번호 1）， 此 1（서열번호 2）， 此 2（서열번호 3），
Figure imgf000046_0001
（서열번호 4）， 엑센딘 -4（서열번호 5）， 부갑상선 호르몬（서열번호 6）， 글루카곤 （서열번호 7）를 의미한 다.
Figure imgf000046_0002
또한， 상기 생리활성 물질은 하기 서열번호 15 및 16의 아미노산 서열을 가 지는 단백질 또는 서열번호 17 및 16의 아미노산 서열을 가지는 단백질일 수 있다. 또한， 상기 생리활성 물질은 하기 서열번호 15 및 16의 아미노산 서열을 가 지는 단백질 또는 서열번호 17 및 16의 아미노산 서열을 가지는 단백질일 수 있고， 여기서 단백질은 서열번호 15 또는 17의 6번째 및 11번째 시스테인， 서열번호 15 또는 17의 7번째 및 서열번호 16의 7번째 시스테인， 및 서열번호 15 또는 17의 20 번째 및 서열번호 16의 19번째 시스테인 간 이황화결합으로 결합된다. 구체적으로， 2022/112849 1»（그1’/182021/022237 하기 서열번호 15 및 16의 아미노산 서열을 가지는 단백질 또는 서열번호 17 및 16 의 아미노산 서열을 가지는 생리활성 물질은 인슐린（서열번호 15（인슐린 쇼 사슬 유 도체） 및 16（인슐린 6 사슬） / 서열번호 17（인슐린 쇼 사슬） 및 16（인슐린 6 사슬）） 를 의미한다
Figure imgf000047_0001
본 발명의 일 실시형태에 따르면， 비오틴 모이어티와의 결합 위치를 조절하 기 위하여 폴리펩티드에 시스테인을 치환 또는 삽입할 수 있다. 이에 제한되지 않으나， 예를 들면， 상기 서열번호 1 내지 7로 표시되는 아미 노산 서열로 이루어진 군으로부터 선택되는 폴리펩티드의 아미노산 중 어느 하나 이상이 시스테인 아미노산으로 치환 또는 삽입될 수 있다. 이때 상기 시스테인 아 미노산의 _ 기에 비오틴 모이어티가 결합된다. 또한， 상기 아미노산 서열로 이루어진 군으로부터 선택되는 폴리펩티드의 아 미노산 중 어느 하나 이상이 리신 아미노산으로 치환 또는 삽입될 수 있다. 이때， 상기 리신 아미노산의 ¾기에 비오틴 모이어티가 결합된다. 또한， 상기 시스테인 아미노산이 삽입된 폴리펩티드는 하기 서열번호 8 내지 14 중 어느 하나의 아미노산 서열을 가지는 폴리펩티드일 수 있다. 구체적으로， 하 기 서열번호 8 내지 14의 생리활성 물질은 상기 서열번호 1 내지 7의 생리활성 물 2022/112849 1»（그1’/182021/022237 질로부터 시스테인 아미노산이 치환 또는 삽입된 생리활성 물질을 의미한다（예를 들면， 서열번호 8의 생리활성 물질은 서열번호 1의 생리활성 물질의 아미노산 중 어느 하나 이상이 시스테인으로 치환）
Figure imgf000048_0001
본 발명의 일 실시형태에 따르면， 비오틴 모이어티와의 결합 위치를 조절하 기 위하여 폴리펩티드의 일부를 치환할 수 있다. 또한， 본 발명의 일 실시형태에 따르면， 비오틴 모이어티와의 결합 위치를 조절하기 위하여 폴리펩티드에 리신 아미노산을 치환 또는 삽입할 수 있다. 이에 제한되지 않으나， 예를 들면， 상기 서열번호 5로 표시되는 아미노산 서 열의 아미노산 중 어느 하나 이상이 리신 아미노산으로 치환 또는 삽입될 수 있다. 또한， 이에 제한되지 않으나， 예를 들면 상기 서열번호 5로 표시되는 아미노 산 서열의 아미노산 중 어느 하나 이상이 2 -아미노이소부티르산（2-쇼1111110 0|3 八: 2022/112849 1»（그1’/182021/022237
301(1, 시 로 치환되고， 리신 아미노산이 삽입될 수 있다. 이때， 상기 리신 아미노 산의 ¾기에 비오틴 모이어티가 결합된다. 또한， 상기 폴리펩티드의 일부가 치환되거나， 리신 아미노산이 치환 또는 삽 입된 폴리펩티드는 하기 서열번호 18 내지 21 중 어느 하나의 아미노산 서열을 가 지는 폴리펩티드일 수 있다. 구체적으로， 하기 서열번호 18 내지 21의 생리활성 물 질은 상기 서열번호 5의 생리활성 물질로부터 아미노산 일부가 치환， 삽입된 것으 로 엑센딘- 4 유도체를 의미한다.
Figure imgf000049_0001
본 발명의 일 실시형태에 따르면， 상기 생리활성 물질은 하기 서열번호 22의 아미노산 서열을 가지는 폴리펩티드 또는 이의 유도체일 수 있다. 하기 서열번호 22의 생리활성 물질은 아밀린을 의미한다.
Figure imgf000049_0002
2022/112849 1»（그1’/182021/022237 본 발명의 일 실시형태에 따르면， 비오틴 모이어티와의 결합 위치를 조절하 기 위하여 상기 서열번호 22로 표시되는 아미노산 서열의 일부를 치환 또는 삽입할 수 있다. 이에 제한되지 않으나， 예를 들면， 상기 서열번호 22로 표시되는 아미노산 서열의 아미노산 중 어느 하나 이상이 프롤린， 아스파르트산， 아르기닌 아미노산으 로 치환될 수 있다. 또한， 이에 제한되지 않으나， 예를 들면， 상기 서열번호 22로 표시되는 아미노산 서열의 아미노산 중 어느 하나 이상이 리신 아미노산으로 치환 또는 삽입될 수 있다. 또한， 상기 서열번호 22로 표시되는 아미노산의 일부가 치환 또는 삽입된 폴 리펩티드는 하기 서열번호 23 내지 31 중 어느 하나의 아미노산 서열을 가지는 폴 리펩티드 일 수 있다. 구체적으로， 하기 서열번호 23 내지 31의 생리활성 물질은 상기 서열번호 22의 생리활성 물질로부터 아미노산 일부가 치환， 삽입된 것으로 아 밀린 유도체를 의미한다.
Figure imgf000050_0001
2022/112849 1»（그1’/182021/022237
Figure imgf000051_0001
본 발명의 일 실시형태에 따르면， 상기 생리활성 물질은 하기 서열번호 32의 아미노산 서열을 가지는 폴리펩티드 또는 이의 유도체일 수 있다. 구체적으로， 하 기 서열번호 32의 생리활성 물질은 각각 엑센딘- 4 유도체를 의미한다.
Figure imgf000051_0002
본 발명의 일 실시형태에 따르면， 비오틴 모이어티와의 결합 위치를 조절하 기 위하여 상기 서열번호 32의 아미노산 서열의 일부를 삭제， 치환， 또는 삽입할 수 있다. 이에 제한되지 않으나， 예를 들면， 상기 서열번호 32로 표시되는 아미노산 서열의 아미노산 중 어느 하나 이상이 메티오닌， 리신， 이소루신， 트립토판， 글리 신， 아미노산으로 치환될 수 있다. 또한， 이에 제한되지 않으나， 예를 들면， 상기 서열번호 32로 표시되는 아미노산 서열의 아미노산 중 어느 하나 이상이 삭제될 수 있다. 또한， 상기 서열번호 32로 표시되는 아미노산의 일부가 삭제， 치환 또는 삽 입된 폴리펩티드는 하기 서열번호 33 내지 37 중 어느 하나의 아미노산 서열을 가 지는 폴리펩티드 일 수 있다. 구체적으로， 하기 서열번호 33 내지 37의 생리활성 2022/112849 1»（그1’/182021/022237 물질은 상기 서열번호 32의 생리활성 물질로부터 아미노산 일부가 삭제， 치환， 삽 입된 것으로 엑센딘- 4 유도체를 의미한다. 서열번호
Figure imgf000052_0001
서열번호
Figure imgf000052_0002
서열번호
Figure imgf000052_0003
서열번호
Figure imgf000052_0004
서열번호
Figure imgf000052_0005
본 발명의 일 실시형태에 따르면， 상기 서열번호 12로 표시되는 아미노산 서 열의 아미노산 중 어느 하나 이상이 2 -아미노이소부티르산（시 로 치환될 수 있다. 본 발명의 일 실시형태에 따르면， 상기 서열번호 12로 표시되는 아미노산 서 열의 아미노산 중 어느 하나 이상이 2 -아미노이소부티르산（시 로 치환되고， 하나 이상이 ¾3-£1 110-}1 （11）로 치환될 수 있는 폴리펩티드는 하기 서열번호 38 내지 39의 아미노산 서열을 가지는 폴리펩티드일 수 있다. 구체적으로， 하기 서열번호 38 또는 39의 생리활성 물질은 상기 서열번호 12의 생리활성 물질로부터 아미노산 이 치환된 것으로， 엑센딘- 4 유도체를 의미한다. 보다 더 구체적으로， 하기 서열번 호 39의 아미노산 서열의 생리활성 물질은 아미노산 중 하나 이상이
Figure imgf000052_0006
어）로 치환된 생리활성 물질이다.
Figure imgf000052_0007
2022/112849 1»（그1’/182021/022237
Figure imgf000053_0001
본 발명의 일 실시형태에 따르면， 상기 서열번호 8로 표시되는 아미노산 서 열의 아미노산 중 어느 하나 이상이 리신（1 또는 아르기닌（ 요）으로 치환될 수 있다. 상기 서열번호 8로 표시되는 아미노산 서열의 아미노산 중 어느 하나 이상이 리신 또는 아르기닌으로 치환된 폴리펩티드는 하기 서열번호 40 내지 41의 아미노 산 서열을 가지는 폴리펩티드일 수 있다. 구체적으로， 하기 서열번호 40 또는 41의 생리활성 물질은 상기 서열번호 8의 생리활성 물질로부터 아미노산 일부가 치환된 것으로 글루카곤 유도체를 의미한다.
Figure imgf000053_0002
본 발명의 일 실시형태에 따르면， 상기 생리활성 물질은 하기 서열번호 42 의 아미노산 서열을 가지는 폴리펩티드 또는 이의 유도체일 수 있다. 구체적으로， 하기 서열번호 42의 생리활성 물질은 인간 성장 호르몬 유도체를 의미한다. 서열번호 42：
Figure imgf000053_0003
SNLELLRISLLLIQSffLEPVQFLRSVFANSLWGASDSNWDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFD TNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF 본 발명의 일 실시형태에 따르면， 비오틴 모이어티를 가지는 생리활성 물질 접합체는 펩티드 및 비펩티드성 중합체， 지방산， 콜레스테롤， 항체， 항체 단편， 알 부민 및 이의 단편， 뉴클레오티드， 피브로넥틴 (f ibronect in) , 트렌스페린， FcRn 결 합물질， 사카라이드 (saccharide) , 엘라스틴， 헤파린 및 이들의 유도체로 이루어진 군에서 선택된 어느 하나 이상과 공유결합하거나 봉입체 (microsphere)를 형성할 수 있다. 상기 비펩티드성 중합체는 폴리에틸렌 글리콜 (PEG) , 폴리프로필렌 글리콜， 에틸렌 글리콜과 프로필렌 글리콜의 공중합체， 폴리옥시 에틸화 폴리올， 폴리비닐 알콜 (PVA) , 폴리사카라이드， 텍스트란， 폴리비닐에틸 에테르， PLA (폴리락트산， polylact ic acid) , PLGA (폴리락틱-글리콜산， polylact ic-glycol ic acid) , 지질 중 합체， 키틴， 히알루론산 및 이들의 조합으로 구성된 군으로부터 선택될 수 있다. 본 발명의 다른 측면은 비오틴 모이어티를 얻는 단계 ; 상기 비오틴 모이어티 와 생리활성 물질을 반응시키는 단계 ; 및 상기 반응 완료 후 비오틴 모이어티와 결 합된 생리활성 물질을 분리하는 단계를 포함하는 비오틴 모이어티와 결합된 생리활 성 물질의 제조방법을 제공하는 것이다. 또한， 본 발명의 다른 측면은 비오틴 모이어티를 얻는 단계 ; 상기 비오틴 모 이어티와 생리활성 물질을 반응시키는 단계 ; 상기 비오틴 모이어티와 생리활성 물 질의 반응 완료 후， 이와 지방산 모이어티를 반응시키는 단계 ; 및 상기 반응 완료 2022/112849 1»（그1’/182021/022237 후 비오틴 모이어티 및 지방산 모이어티와 결합된 생리활성 물질을 분리하는 단계 를 포함하는 비오틴 모이어티 및 지방산 모이어티와 결합된 생리활성 물질 접합체 의 제조방법을 제공하는 것이다. 본 발명의 일 실시형태에 따르면， 상기 비오틴 모이어티를 얻는 단계에서， 비오틴 모이어티는 상기 일반식 쇼로 표시되는 것일 수 있다. 본 발명의 일 실시형태에 따르면， 지방산 모이어티는 상기 일반식 8로 표시 되는 것일 수 있다. 본 발명의 일 실시형태에 따르면， 상기 혼합물을 얻는 단계에서 생리활성 물 질에 대한 비오틴 모이어티의 반응 몰비는 0.5 이상으로 하여 반응시킬 수 있다. 구체적으로 생리활성 물질에 대한 비오틴 모이어티의 반응 몰비는 0.5 내지 30일 수 있다. 적절한 상기 반응 몰비는 비오틴 모이어티의 분자 구조， 분자량， 용해도， 반응액의 ］내， 반응 온도， 반응 시간 등을 고려하여 선택할 수 있다. 본 발명의 일 실시형태에 따르면， 상기 혼합물을 얻는 단계에서 생리활성 물 질에 대한 지방산 모이어티의 반응 몰비는 0.5 이상으로 하여 반응시킬 수 있다. 구체적으로 생리활성 물질에 대한 지방산 모이어티의 반응 몰비는 0.5 내지 20일 수 있다. 적절한 상기 반응 몰비는 지방산 모이어티의 분자 구조， 분자량， 용해도， 반응액의 ］내， 반응 온도， 반응 시간 등을 고려하여 선택할 수 있다. 또한， 생리활성 물질의 형태에 따라， 상기 혼합물을 얻는 단계에서 생리활성 물질에 대한 비오틴 모이어티의 반응 몰비는 20 이상으로 하여 반응시킬 수 있다. 구체적으로 생리활성 물질에 대한 비오틴 모이어티의 반응 몰비는 20 내지 25일 수 있다. 또한， 생리활성 물질의 형태에 따라， 상기 혼합물을 얻는 단계에서 생리활성 물질에 대한 지방산 모이어티의 반응 몰비는 6 이상으로 하여 반응시킬 수 있다. 구체적으로 생리활성 물질에 대한 지방산 모이어티의 반응 몰비는 6 내지 12일 수 있다. 본 발명의 일 실시형태에 따르면 상기 반응은 완충용액 또는 유기 용매를 사 용하여 수행될 수 있다. 상기 완충용액 또는 유기용매는 특별한 제한이 없으며， 비 오틴 모이어티， 지방산 모이어티의 구조에 따라 당해 기술 분야에서 통상적으로 사 용되는 완충용액을 적절히 선택할 수 있다. 본 발명의 일 실시형태에서， 상기 반응 단계의 온도 및 시간은 사용되는 비 오틴 모이어티， 지방산 모이어티 및 생리활성 물질의 특성에 따라 적절하게 조절될 수 있다. 이에 제한되지 않으나， 예를 들면 4 °C에서 3시간 이상 수행될 수도 있으 며， 상온에서 더 짧은 시간 동안 수행할 수도 있다. 이는 사용되는 비오틴 모이어 티， 지방산 모이어티 또는 이의 조합의 반응성 정도와 관계될 수 있다. 적당한 반 응 시간의 경과되면 반응액의 pH를 낮춤으로써 반응을 멈추게 할 수 있다. 본 발명의 일 실시형태에 따르면， 상기 반응 단계 이후에 미반응물을 제거하 는 단계를 수행할 수 있다. 상기 미반응물을 제거하는 방법은 당해 기술 분야에서 통상적으로 사용되는 방법에 의해 수행될 수 있다. 이에 제한되는 것은 아니나， 예 를 들면， 적당한 완충용액， 예를 들면， PBS (phosphate buffered saline)와 같은 용액을 사용하여 투석법 (dialysis) 등에 의해 제거될 수 있다. 2022/112849 1»（그1’/182021/022237 본 발명의 일 실시형태에 따르면， 상기 분리 단계 후에 정제 단계를 포함할 수 있다. 상기 분리 및 정제 단계는 크기 배제 크로마토그래피， 역상 고성능 액체 크로마토그래피， 이온 교환 크로마토그래피 등을 사용하여 수행할 수 있으나， 이에 한정되지 않는다. 본 발명의 또 다른 측면은 상기에서 서술한 비오틴 모이어티， 지방산 모이어 티 또는 이의 조합과 결합된 생리활성 물질 접합체를 포함하는 약학적 조성물을 제 공하는 것이다. 구체적인 본 발명의 다른 측면은 상기에서 서술한 비오틴 모이어티 및 지방 산 모이어티와 결합된 생리활성 물질 접합체를 포함하는 약학적 조성물을 제공하는 것이다. 여기에서， 약학적 조성물의 용도는 생리활성 물질의 종류에 따라 결정될 수 있다 . 또한， 상기 약학적 조성물은 경구 투여용 조성물일 수 있다 . 본 발명의 일 실시형태에 따르면， 비오틴 모이어티， 지방산 모이어티 또는 이의 조합과 결합된 생리활성 물질 접합체를 포함하는 당뇨병， 비만， 지방간 질환， 과민성 장 증후군， 신경퇴행성 질환， 골 질환， 골다공증， 인간 성장 호르몬 결핍 증， 항암 또는 비알코올성 지방간질환의 예방 또는 치료용 약학적 조성물을 제공할 수 있다. 본 발명의 일 실시형태에 따르면， 상기 생리활성 물질이 此 1， 此 2, 이 인슐린， 아밀린 또는 이의 유도체인 경우， 상기 접합체는 당뇨병의 예방 또는 치료 에 사용될 수 있다. 구체적으로， 상기 서열번호 12의 생리활성 물질을 포함하는 접 2022/112849 1»（그1’/182021/022237 합체는 당뇨병의 예방 또는 치료에 사용될 수 있다. 다만， 이는 예시적인 것으로 이에 제한되는 것은 아니다. 또한， 본 발명의 일 실시형태에 따르면， 상기 생리활성 물질이 부갑상선 호 르몬 또는 이의 유도체인 경우， 상기 접합체는 골 질환의 예방 또는 치료에 사용될 수 있다. 구체적으로， 상기 서열번호 6의 생리활성 물질을 포함하는 접합체는 골 질환의 예방 또는 치료에 사용될 수 있다. 다만， 이는 예시적인 것으로 이에 제한 되는 것은 아니다. 본 발명의 일 실시형태에 따르면， 상기 생리활성 물질이 11매 또는 이의 유도 체인 경우， 상기 접합체는 인간 성장 호르몬 결핍증의 예방 또는 치료에 사용될 수 있다. 구체적으로， 상기 서열번호 42의 생리활성 물질을 포함하는 접합체는 인간 성장 호르몬 결핍증의 예방 또는 치료에 사용될 수 있다. 다만， 이는 예시적인 것 으로 이에 제한되는 것은 아니다. 본 발명의 다른 측면은 상기에서 서술한 비오틴 모이어티， 지방산 모이어티 또는 이의 조합과 결합된 생리활성 물질 접합체를 포함하는 경구 투여용 조성물을 제공하는 것이다. 구체적인 본 발명의 다른 측면은 상기에서 서술한 비오틴 모이어티 및 지방 산 모이어티와 결합된 생리활성 물질 접합체를 포함하는 경구 투여용 조성물을 제 공하는 것이다. 본 발명의 일 실시형태에 따른 비오틴 모이어티， 지방산 모이어티 또는 이의 조합과 결합된 생리활성 물질 접합체는 수용성 비타민의 한 종류인 비오틴과 결합 됨으로써 나트륨 의존성 멀티비타민 수송체를 통해 능동 수송으로 흡수될 수 있어 장관막을 투과하여 장내에서 흡수가 촉진될 수 있다. 보다 상세하게는 비오틴 모이 어티 및 지방산 모이어티가 모두 결합됨에 따라 우수한 효과를 나타낸다. 본 발명의 일 실시형태에 따르면， 상기 비오틴 모이어티와 결합된 생리활성 물질을 유효성분으로 함유하는 약학적 조성물은 다양한 경구 또는 비경구 투여 형 태로 제제화되어 투여될 수 있으나， 이에 한정되는 것은 아니다. 또한， 본 발명의 일 실시형태에 따르면， 상기 비오틴 모이어티， 지방산 모이 어티 또는 이의 조합과 결합된 생리활성 물질 접합체를 유효성분으로 함유하는 약 학적 조성물은 다양한 경구 또는 비경구 투여 형태로 제제화되어 투여될 수 있으 나， 이에 한정되는 것은 아니다. 제제화할 경우에는 보통 사용하는 충진제， 용해 보조제， 증량제， 결합제， 습 윤제， 붕해제， 계면활성제， 흡수촉진제 등의 희석제 또는 부형제를 사용하여 조제 할 수 있다. 경구 투여를 위한 고형제제에는 정제， 환제， 산제， 과립제， 캡슐제 등이 포 함되며， 이러한 고형제제는 화합물에 적어도 하나 이상의 부형제 예를 들면， 전분， 칼슘 카보네이트 (Calcium carbonate) , 수크로오스 (Sucrose) 또는 락토오 스 (Lactose) , 젤라틴 등을 섞어 조제할 수 있다. 또한， 단순한 부형제 이외에 마그네슘 스티레이트， 탈크 같은 윤활제들도 사 용된다. 경구를 위한 액상 제제로는 현탁제， 내용액제， 유제， 시럽제 등이 해당되 는데 흔히 사용되는 단순 희석제인 물， 리퀴드 파라핀 이외에 여러가지 부형제， 예 를 들면 습윤제， 감미제， 방향제， 보존제 등이 포함될 수 있다 . 비경구 투여를 위 한 제제에는 멸균된 수용액， 비수성용제， 현탁제， 유제， 동결건조제제， 좌제가 포 함된다. 비수성용제， 현탁용제로는 프로필렌 글리콜 (Propylene glycol ) , 폴리에틸 렌 글리콜 (PEG) , 올리브 오일과 같은 식물성 기름， 에틸올레이트와 같은 주사 가능 한 에스테르 등이 사용될 수 있다. 또한 증식성 질환 또는 자가면역질환의 치료제로서의 효능 증진을 위해 칼슘 이나 비타민 D3를 첨가할 수 있다. 본 발명의 일 실시형태에 따른 약학적 조성물의 투여량은 환자의 체중， 연 령， 성별， 건강상태， 식이， 투여시간， 투여방법， 배설율 및 질환의 중증도에 따라 그 범위가 다양화될 수 있지만， 일반적으로 1일 유효 투입량 범위 내에서 하루 한 번 또는 여러 번에 나누어 투여될 수 있다. 또한 1 내지 2주에 수회 투여로도 유효 투여량의 투여가 가능할 수 있다. 이하， 본 발명을 실시예 및 실험예에 의해 상세히 설명한다. 단， 하기 실시 예 및 실험예는 본 발명을 예시하는 것일 뿐， 본 발명의 내용이 하기 실시예 및 실 험예에 한정되는 것은 아니다.
［실시예］
＜비오틴 모이어티 제조＞ 약어 목록
HBTU： 3 -［비스 (디메틸아미노)메틸륨일］- 3H-벤코트리아졸- 1-옥사이드 핵사플 2022/112849 1^(:1^ 2021/022237 루오로포스페이트(: 3-[Bis(dimethylamino)methyliumy1]-3H-benzotriazo1-l~oxide hexafluorophosphate)
DIEA:에틸디이소프로필아민 (Ethyldiisopropylamine)
HATU： 1- [비스 (디메틸아
Figure imgf000061_0001
-트리아콜로[4,5-b]피리디늄-3 옥사이드 핵사플루오로포스페이트
(l-[Bis(dimethylamino)methylene]-lH-l,2,3-triazolo[4,5-b]pyridinium 3-oxide hexafluorophosphate)
DIC:디이소프로필카보디이미드 (Diisopropylcarbodiimide)
HOBt:: 1-하이드록시벤조트리아졸 (1-Hydroxybenzotriazo1e)
MBHA:4-메틸벤즈히드릴아민 히드로클로라이드 (4-Methylbenzhydrylamine hydrochloride)
Fmoc:9-플루오레닐메틸옥시카르보닐 (9-Fluorenylmethoxycarbonyl)
DMF:디메틸포름아미드 (dimethylformamide)
SPPS： 고체상 펩티드 합성
HPLC： 고성능 액체 크로마토그래피
LCMS： 액체 크로마토그래피 질량분석 일반적인 SPPS 방법 일부 경우에서 펩티드의 고체상 합성은 산성 조건 하에서 절단될 수 있는 기 , 예를 들어 , 2-Fmoc-옥시-4 -메톡시벤질 , 또는 2,4,6-트라이메톡시벤질을 가진 디-펩티드 아미드 결합에서 보호된 디-펩티드의 사용에 의해 개선될 수 있다. 사용 2022/112849 1^(:1^ 2021/022237 된 Fmoc-보호된 아미노산 유도체가 권장된 표준이었다: 예를 들어 Anaspec, Bachem, Iris Biotech,또는 Novabiochem으로부터 공급된 Fmoc-Ala-OH, Fmoc- Arg(Pbf)_0H, Fmoc-Asn(Trt)-0H, Fmoc-Asp(OtBu)-OH, Fmoc-Cys(Trt)_0H, Fmoc- Gln(Trt)-0H, Fmoc-Glu(0tBu)-0H, Fmoc-Gly-OH, Fmoc_His(Trt)_0H, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Met-OH, Fmoc-Phe-OH, Fmoc-Pro-OH, Fmoc- Ser(tBu)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Tyr(tBu)-OH, 또는, Fmoc-Val-OH등. N_말단 아미노산은 알파 아미노기에서 보호된 Boc였다.예를 들 어, Anaspec, Bachem, Iris Biotech,또는 Novabiochem으로부터 공급된 Fmoc-8 -아 미노-3,6 -다이옥사옥탄산, Fmoc-트라넥사민산, Fmoc-아이소니페코트산, Fmoc-Glu- OtBu,Fmoc-Lys(Fmoc)-0H를 사용하였다.
SPPS름 이용한 펩타이드 합성 펩타이드는 HBTU/DIEA, HATU/DIEA,혹은 DIC/HOBt를 커플링 시약으로서 이용 하여, 링크 아마이드 MBHA수지에서 일반적인 Fmoc화학을 이용하여 합성될 수 있 다. 합성에 이용되는 반응물과 커플링 시약은 다음의 조합들을 포함한다.
【표 1】
Figure imgf000062_0001
Figure imgf000063_0001
SPPS를 이용한 펩타이드 합성 과정의 예시적인 프로토콜은 하기 내용을 포함 한다. 1) 링크 아마이드 MBHA 수지를 포함하는 용기에 DMF를 첨가하여 2시간동안 팽창한다 (sub: 0.68 mmol/g, 1.0 mmol , 1.47 g 혹은 5 mmol , 7.35 g, sub: 0.68 mmol/g) . 2) 20% piper idine/DMF를 첨가한 꾸， 30분간 섞는다. 3) 1)-2)의 용매를 제거 후 DMF을 이용하여 (30초 X 5번 ) 세척한다. 4) 반응물 (#1〜 #5의 반응물 중 1가 지 )을 첨가하여 30초간 섞어준 뒤， 반응물에 해당하는 커플링 시약 (#1〜 #5의 커플링 시약 중 1가지 )을 첨가하여 1시간 동안 질소 버블링을 진행한다. 5) 20% pi per idine/DMF를 첨가한 후， 30분간 섞는다. 상기 1)〜 5)의 예시적인 프로토콜은 #1〜 #5의 반응물과 커플링 시약의 조합을 한 번 이상 사용하여 반복적인 합성을 진 행할 수 있다. Fmoc 제거를 위하여 20% piper idine/DMF 용액을 30분간 처리하였다. 펩타이. ᄃ- 정제 및 분석음 위한 일반적인 과정 미정제 펩타이드를 물과 TFA, ACN의 적당한 혼합물에 녹인 뒤， 분취 HPLC를 이용하여 정제한 후， 건조하여 정량하였다. 분취 HPLC를 이용한 정제 조건은 하기 표 2에 나타난 것을 포함한다.
【표 2】
Figure imgf000064_0002
분취 卵比를 이용한 정제 후에는 분석 卵比， 또는比 를 이용하여 최종 산 물의 특성을 분석하였다.분석결과， 하기 표 3에 따른 비오틴 모이어티를 수득하였
【표 3]
Figure imgf000064_0003
B1：
Figure imgf000064_0001
Figure imgf000065_0001
B3
Figure imgf000066_0001
B4：
Figure imgf000067_0001
\¥02022/112849 1(17182021/022237
Figure imgf000068_0001
또한， 상기 를 이용한 펩타이드 합성 1）〜 5）의 프로토콜， 정제 및 분석을 통해 하기의 비오틴 모이어티 66 내지 837을 수득하였다 . 하기 표 4에서 X, I 및 묘는 본 명세서 일반식 쇼의 정의에 포함된다 .
【표 4]
Figure imgf000068_0002
Figure imgf000069_0001
Figure imgf000070_0002
B35：
Figure imgf000070_0001
B36：
Figure imgf000071_0001
B37
Figure imgf000072_0001
2022/112849 1»（그1’/182021/022237
638：
Figure imgf000073_0001
＜지방산 모이어티＞ 지방산 모이어티는 해당기술 분야에서 공지된 방법에 의해 제조되거나 상업 적으로 수득된 물질을 사용할 수 있다. 지방산 모이어티는 하기 표 5에 따른 지방산 모이어티를 사용하였다.
【표 5]
Figure imgf000073_0002
Figure imgf000074_0004
FI：
Figure imgf000074_0001
F2：
Figure imgf000074_0003
F4：
Figure imgf000074_0002
F5
Figure imgf000075_0001
F8
Figure imgf000076_0001
Figure imgf000077_0001
2022/112849 1»（그1’/182021/022237 凡5 :
Figure imgf000079_0001
＜폴리펩티드＞ 폴리펩티드는 해당 기술 분야에서 공지된 방법에 의해 제조되거나 상업적으 로 수득된 물질을 사용할 수 있다. 본 발명에서 비오틴 모이어티， 지방산 모이어티 또는 이의 조합과 결합한 폴리펩티드의 서열은 하기 표 6에 나타난 바와 같다.
【표 6】
Figure imgf000079_0002
Figure imgf000080_0001
Figure imgf000081_0001
＜실시예 : 비오틴 모이어티 , 지방산 모이어티 또는 이의 조합과 결합된 생리 활성 물질 제조 ñ
［제조예］ 반응 용매를 0.3 % 트리에틸아민 (TEA, Sigma사)이 첨가된 DMS0용액으로 하 여， 상기 표 6의 폴리펩티드 및 상기 표 3내지 표 4의 비오틴 모이어티를 몰 비율 1 : 표로 하여 혼합물을 실온에서 30분 이상 반응시켰다. 이후， 폴리펩티드-비오틴 모이어티 혼합물에 상기 표 5의 지방산 모이어티를 몰 비율 1 : Y로 하여 혼합물을 제조하여 실온에서 90분 이상 반응시켰다. 반응은 혼합물의 부피와 같은 부피의 1% 트리플루오로아세트산 (Trifluoroacetic acid)용액을 가하여 멈추게 하였다.
［분리 정제 및 확인］ 상기 반응 생성물을 역상 고성능 액체 크로마토그래피 (high performance liquid chromatography)로 분리 및 정제하였다. 칼럼은 SUPERSIL 0DS-1 column (10x250 mm, 5 um, LB Science, South Korea)을 사용하였으며， 이동상 조건은 30- 50 % 용매 B (0.1 % TFA가 첨가된 아세토나이트릴 )과 용매 A(0.1 % TFA가 첨가된 증류수)로 4.7 mL/min 유속을 유지하면서 선형적으로 변화시켰다 . UV흡광계 280 nm 에서 모니터링하여 10분에서 20분 사이에 검출되는 피크를 수거하였다. 수거된 피 크는 유기용매 및 TFA를 진공하에서 휘발시킨 후 적절한 분자량 컷오프를 가진 ultracentri fugal f i lter를 사용하여 농—， 정제하였다 . 정제된 물질의 순도는 HPLC 분석법을 통해 확인하였다. 실온 부근의 일정 온도에서 Gemini C18 칼럼 (4.6 X 250 mm, 5 um; Phenomenex , CA, USA)을 사용하여 분석하였다 . 분석은 트리플루오 로아세트산시 액 : 아세토니트릴혼합액 (혼합비를 변경되도록 한다)으로 이루어진 이 동상을 사용하여 1 mL/min의 유속에서 gradient elut ion 방법에 의해 수행되었다 . UV 흡광도는 280 nm에서 관찰하였다 .
［분자량 확인］ 상기 반응 생성물의 분자량을 측정하였다 . 분자량은 MALDI-T0F 질량분석법을 통해 확인하였다 . 매트릭스 용액으로는 CHCA( a-Cyano-4-hydr oxyc i nnami c acid)를 0.1 % TFA를 함유한 50 % 아세토니트릴에 포화시킨 용액을 사용하였다 . 질량 스펙트럼은 선형 및 양성 모드에서 확인하였으 며， 최종 물질의 농도를 0.1 mg/mL로 하여 분자량을 확인하였다 . 이를 통해， 분리 한 물질들의 분자량이 이론상의 분자량과 일치함을 확인하였다 .
＜실시예 : 비오틴 모이어티 , 지방산 모이어티 또는 이의 조합과 결합된 폴리 펩티드＞ 2022/112849 1»(그1’/182021/022237 비오틴 모이어티， 지방산 모이어티 및 폴리펩티드는 상기 기재된 물질을 사 용하였으며 ， 비오틴 모이어티， 지방산 모이어티 또는 이의 조합과 폴리펩티드의 결 합방법은 해당 기술 분야에서 공지된 방법 또는 상기 실시 예의 방법에 의해 수행하 였다 . 비오틴 모이어티， 지방산 모이어티 또는 이의 조합이 결합된 폴리펩티드는 하기 표 7에 나타난 바와 같다 . （여기에서， 분자량은 분자량 측정에 따라 측정된 분자량 또는 이론상 분자량을 나타낸다 .）
【표 7]
Figure imgf000083_0001
2022/112849 1^(:1^ 2021/022237
Figure imgf000084_0001
Figure imgf000085_0001
Figure imgf000086_0001
2022/112849 1^(:1^ 2021/022237
Figure imgf000087_0001
Figure imgf000088_0001
(상기 표에서 B는 Native biotin을 의미한다.) 접합체 14 내지 17
1)제조 예 하기 표 8의 접합체는 하기와 같은 방법에 의해 제조하였다. 반응 용매를 0.3 %트리에틸아민 奸묘 £111£1사)이 첨가된 « 용액으로 하 여 ， 상기 표 6에 기재된 서열번호 12의 폴리펩티드 및 상기 표 3내지 표 4에 기재 된 비오틴 모이어티를 몰 비율 1 : 2로 하여 혼합물을 제조하여 실온에서 30분 이 상 반응시켰다.또한 ， 폴리펩티드-비오틴 모이어티 혼합물에 상기 표 5에 기재된 지방산 모이어티를 몰 비율 1 : 1내지 1 : 2로 하여 혼합물을 제조하여 실온에서 90분 이상 반응시켰다.반응은 혼합물의 부피와 같은 부피의 1 %트리플루오로아세 트산 (1＞ 11101'0 八： 301(1)용액을 가하여 멈주게 하였다. 【표 8]
Figure imgf000089_0001
2) 분리 정제 및 순도 확인상기 접합체 14 내지 17의 반응 생성물을 역상 고 성능 액체 크로마토그래피 (high performance l iquid chromatography, 이하 “로 분리 및 정제하였다. 칼럼은 SUPERS IL 0DS-1 column (10 x 250 mm, 5 um, LB Science, South Korea)을 사용하였으며， 이동상 조건은 용매 A (0.1% TFA가 첨가된 증류수)와 용매 B (0.1% TFA가 첨가된 아세토나이트릴 )을 4.7 ml/min 유속을 유지하면서 접합체 14： 30-80 %, 접합체 15: 40-70%, 접합체 16: 30-60%, 접합체 17: 40-60%로 선형적 으로 변화시켰다. 이후， UV흡광계 280 nm에서 모니터링하여 10분에서 17분 사이 (접합체 14: 15분， 접합체 15: 16분， 접합체 16: 16분， 접합체 17: 11분)에 검출되 는 피크를 수거하였다. 수거된 피크는 유기용매 및 TFA를 진공하에서 휘발시킨 후 적절한 분자량 컷오프를 가진 초원심 필터 (ultracentr i fugal f i lter)를 사용하여 농축， 정제하였다 . 정제된 물질의 순도는 HPLC 분석법을 통해 확인하였다 . 실온 부 근의 일정 온도에서 Gemini C18 칼럼 (4.6 x 250 mm, 5 um; Phenomenex , CA, USA)을 사용하여 분석하였다 . 분석은 트리플루오로아세트산시 액 : 아세토나이트릴혼합액 (혼 합비를 70 : 30에서 20분 후 20 : 80이 되도록 하였다)으로 이루어진 이동상을 사 용하여 1 mL/min의 유속에서 구배 용출 (gradient elut ion) 방법에 의해 수행되었 다 . UV 흡광도는 280 nm에서 관찰하였다 . 측정결과， 접합체 14 내지 17의 정제 크로마토그램은 도 1에 나타난 바와 같 다 . 또한， UV 검출기로 분석한 결과， 비오틴 모이어티 및 지방산 모이어티와 결합 된 폴리펩티드 이외의 다른 피크는 관찰되지 않았으며， 각각의 크로마토그램으로부 터 발생한 피크의 면적을 백분율로 나타냈을 때， 접합체 14 내지 17의 순도가 95 % 이상인 것을 확인하였다 .
3) 분자량 확인 상기 접합체 14 내지 17에서 얻어진 최종 물질의 분자량을 측정하였다 . 분자량은 MALDI-T0F 질량분석법을 통해 확인하였다 . 매트릭스 용액으로는 CHCA( a-Cyano-4-hydr oxyc i nnami c acid)를 0.1% TFA를 함유한 50 % 아세토나이트릴 에 포화시킨 용액을 사용하였다 . 질량 스펙트럼은 선형 및 양성 모드에서 확인하였 으며， 최종 물질의 농도를 0.1 mg/mL로 하여 분자량을 확인하였다 . 분석결과는 상 기 표 8에 나타난 바와 같다 . 접합체 18 내지 19 1) 제조예 하기 표 9의 접합체는 하기와 같은 방법에 의해 제조하였다. 반응 용매를 0.3 % 트리에틸아민 奸묘 £111£1사)이 첨가된 « 용액으로 하 여， 상기 표 6에 기재된 서열번호 12의 폴리펩티드 및 상기 표 3 내지 표 4의 비오 틴 모이어티를 몰 비율 1 : 2로 하여 혼합물을 제조하여 실온에서 30분 이상 반응 시켰다. 반응은 혼합물의 부피와 같은 부피의 1 % 트리플루오로아세트산
(1＞ 11101'0 八： 301(1) 용액을 가하여 멈주게 하였다.
【표 9]
Figure imgf000091_0001
2) 분리 정제 및 순도 확인 상기 접합체 18 내지 19의 반응 생성물을 역상 고성능 액체 크로마토그래피 (high performance liquid chromatography)로 분리 및 정제하였다. 칼럼은 SUPERS IL 0DS-1 column (10 x 250 mm, 5 um, LB Science, South Korea)을 사용하였으며， 이동상 조건은 용매 A(0.1% TFA가 첨가된 증류수)와 용매 B(0.1% TFA가 첨가된 아세토나이트릴)을 4.7 ml/min 유속을 유지하면서 30-80 %로 선형적으로 변화시켰다. UV흡광계 280 nm에서 모니터링하여 12분에서 13분 사이에 검출되는 피크를 수거하였다. 수거된 피크는 유기용매 및 TFA를 진공하에서 휘발시 킨 꾸 적절한 분자량 컷오프를 가진 ultracentrifugal filter를 사용하여 농—， 정 제하였다. 정제된 물질의 순도는 HPLC분석법을 통해 확인하였다. 실온 부근의 일 정 온도에서 Gemini C18 칼럼 (4.6 x 250 mm, 5 um; Phenomenex , CA, USA)을 사용하 여 분석하였다. 분석은 트리플루오로아세트산시액 : 아세토나이트릴혼합액 (혼합비를 70 : 30에서 20분 후 20 : 80이 되도록 한다)으로 이루어진 이동상을 사용하여 1 mL/min의 유속에서 gradient elution방법에 의해 수행되었다. UV톱광도는 280 nm 에서 관찰하였다. 측정결과， 접합체 18 내지 19의 정제 크로마토그램은 도 2에 나타난 바와 같 다. 또한， UV검출기로 분석한 결과， 비오틴 모이어티 및 지방산 모이어티와 결합 된 폴리펩티드 이외의 다른 피크는 관찰되지 않았으며， 각각의 크로마토그램으로부 터 발생한 피크의 면적을 백분율로 나타냈을 때， 접합체 18 내지 19의 순도가 95 % 이상인 것을 확인하였다.
3) 분자량 확인 상기 접합체 18 내지 19에서 얻어진 최종 물질의 분자량을 측정하였다. 분자량은 MALDI-T0F질량분석법을 통해 확인하였다. 매트릭스 용액으로는 CHCA(a-Cyano-4-hydroxycinnamic acid)를 0.1 % TFA를 함유한 50 %아세토나이트릴 에 포화시킨 용액을 사용하였다. 질량 스펙트럼은 선형 및 양성 모드에서 확인하였 으며， 최종 물질의 농도를 0.1 mg/mL로 하여 분자량을 확인하였다. 분석결과는 표 9에 나타난 바와 같다. 접합체 20 및 24
1) 제조예 접합체 20 및 24은 상기 일반적인 방법에 의해 하기 표 10의 접합체를 합성하였다.
【표 10]
Figure imgf000093_0001
2) 순도 확인상기 접합체 20 및 24의 정제된 물질의 순도는 HPLC 분석법을 통해 확인하였다. 실온 부근의 일정 온도에서 Gemini C18 칼럼 (4.6 x 250 mm, 5 um； Phenomenex, CA, USA)을 사용하여 분석하였다. 분석은 트리플루오로아세트산시 액 : 아세토나이트릴혼합액 (혼합비를 70 : 30에서 20분 후 50 : 50가 되도록 한다) 으로 이루어진 이동상을 사용하여 1 mL/min의 유속에서 gradient elut ion 방법에 의해 수행되었다. UV 흡광도는 280 nm에서 관찰하였다. 측정결과， 접합체 20 및 24의 정제 크로마토그램은 도 3에 나타난 바와 같 다. 또한， UV 검출기로 분석한 결과， 비오틴 모이어티 및 지방산 모이어티와 결합 된 폴리펩티드 이외의 다른 피크는 관찰되지 않았으며， 각각의 크로마토그램으로부 터 발생한 피크의 면적을 백분율로 나타냈을 때， 접합체 20 및 24의 순도가 95 % 2022/112849 1»（그1’/182021/022237 이상인 것을 확인하였다.
3） 분자량 확인 상기 접합체 20 및 24에서 얻어진 최종 물질의 분자량을 측정하였다. 분자량은 111）1 - 에 질량분석법을 통해 확인하였다. 매트릭스 용액으로는
Figure imgf000094_0001
함유한 50% 아세토나이트릴에 포화시킨 용액을 사용하였다. 질량 스펙트럼은 선형 및 양성 모드에서 확인하였으 며， 최종 물질의 농도를 0.1 /1此로 하여 분자량을 확인하였다. 분석결과는 표 10 에 나타난 바와 같다. 접합체 51 내지 54
1） 제조예
- 접합체 51 내지 54은 아래의 표준적인 1¾00 제조법에 의해 하기 표 12의 접합체를 합성하였다. 표준적인 1¾00 제조법이라 함은 하기 방법에 의해 수행한 것을 의미한다.
: 1¾00 묘 뇨 꽤1（16 이 들어 있는 용기에 ]®'를 첨가하고 2시간동안 팽윤시킨다.
Figure imgf000094_0002
첨가하고 30분간 혼합한다. ?세척 후 1¾0（：-아미노산 용액을 30초간 혼합하고 활성화 완충액을 가한 후 1시간 동안 질 소기체를 투여한다. 상기 과정을 목적하는 펩티드 배열을 완성할 때까지 차례대로 반복하며 이 때 1¾0（：-아미노산 시약은 하기 표 11 내에 있는 물질을 포함한다.
【표 11] 2022/112849 1^(:1^ 2021/022237
Figure imgf000095_0001
2022/112849 1»(그1’/182021/022237
Figure imgf000096_0002
- 접합체 53 내지 54는 하기 방법에 의해 제조하였다. 반응 용매를 0.3 % 트 리에틸아민 奸묘 £111£1사)이 첨가된
Figure imgf000096_0001
용액으로 하여， 상기 표 6에 기재된 서열 번호 39 내지 40의 폴리펩티드 및 상기 표 3 내지 표 4에 기재된 비오틴 모이어티 를 몰 비율 1 : 2로 하여 혼합물을 제조하여 실온에서 10분 이상 반응시켰다. 폴리 펩티드-비오틴 모이어티 혼합물에 상기 표 5에 기재된 지방산 모이어티를 몰 비율 1 : 3로 하여 혼합물을 제조하여 실온에서 90분 이상 반응시켰다. 반응은 혼합물의 부피와 같은 부피의 1 % 트리플루오로아세트산 (竹 11101'0£ 아八： 301(1) 용액을 가 하여 멈추게 하였다.
【표 12】
Figure imgf000096_0003
2) 분리 정제 및 순도 확인 상기 접합체 51 내지 54의 반응 생성물을 역상 고성능 액체 크로마토그래피 (high performance l iquid chromatography)로 분리 및 정제하였다. 칼럼은 Gemini C18 칼럼 （10 x 250 mm, 5 um; Phonomenex , CA, USA）을 사용 하였으며， 이동상 조건은 용매 A（0.1% TFA가 첨가된 증류수）와 용매 B（0.1% TFA가 첨가된 아세토나이트릴）을 4.7 ml/min 유속을 유지하면서 40-60%로 선형적으로 변 화시켰다. UV흡광계 280 nm에서 모니터링하여 11분에서 13분 사이（접합체 53： 12 분， 접합체 54： 13분）에 검출되는 피크를 수거하였다. 수거된 피크는 유기용매 및 TFA를 진공하에서 휘발시킨 후 적절한 분자량 컷오프를 가진 ultracentri fugal f i lter를 사용하여 농축， 정제하였다. 정제된 물질의 순도는 HPLC 분석법을 통해 확인하였다. 실온 부근의 일정 온도에서 Gemini C18 칼럼（4.6 x 250 mm, 5 um； Phenomenex, CA, USA）을 사용하여 분석하였다. 분석은 트리플루오로아세트산시액 : 아세토나이트릴혼합액（혼합비를 70 : 30에서 20분 후 20 : 80가 되도록 한다）으로 이루어진 이동상을 사용하여 1 mL/min의 유속에서 gradient elut ion 방법에 의해 수행되었다. UV 흡광도는 280 nm에서 관찰하였다. 측정결과， 접합체 51 내지 52의 최종 물질에 대한 크로마토그램은 도 5에 나 타난 바와 같고， 접합체 53 내지 54의 정제 크로마토그램은 도 6에 나타난 바와 같 다. 또한， UV 검출기로 분석한 결과， 비오틴 모이어티 및 지방산 모이어티와 결합 된 폴리펩티드 이외의 다른 피크는 관찰되지 않았으며， 각각의 크로마토그램으로부 터 발생한 피크의 면적을 백분율로 나타냈을 때， 접합체 51 내지 54의 순도가 95 % 이상인 것을 확인하였다. 2022/112849 1»（그1’/182021/022237
3) 분자량 확인 상기 접합체 51 내지 54에서 얻어진 최종 물질의 분자량을 측정하였다. 분자량은 111)1 - 에 질량분석법을 통해 확인하였다. 매트릭스 용액으로는 0¾1(3-0 3110-4-]¾년1 («：7(^1111_八: )를 0.1
Figure imgf000098_0001
함유한 50 % 아세토나이트릴 에 포화시킨 용액을 사용하였다. 질량 스펙트럼은 선형 및 양성 모드에서 확인하였 으며， 최종 물질의 농도를 0.1 11¾/1 로 하여 분자량을 확인하였다. 분석결과는 표 12에 나타난 바와 같다. 접합체 55 내지 59
- 접합체 56은 상기 접합체 51 내지 54에 사용된 표준적인 1¾00 제조법을 이 용하여 합성되었다.
- 접합체 55 및 접합체 57 내지 59는 하기 방법에 의해 제조하였다. 반응 용 매를 0.3 % 트리에틸아민 奸묘
Figure imgf000098_0002
첨가된 « 용액으로 하여， 상기 표 6 에 기재된 서열번호 8， 서열번호 40 및 서열번호 41의 폴리펩티드 및 상기 표 3 내 지 표 4에 기재된 비오틴 모이어티를 몰 비율 1 : 2로 하여 혼합물을 제조하여 실 온에서 10분 이상 반응시켰다. 폴리펩티드-비오틴 모이어티 혼합물에 상기 표 5에 기재된 지방산 모이어티를 몰 비율 1 : 1 또는 1 : 2로 하여 혼합물을 제조하여 실 온에서 90분 이상 반응시켰다. 반응은 혼합물의 부피와 같은 부피의 1% 트리플루오 로아세트산 (1＞ 111010 八： 301(1) 용액을 가하여 멈주게 하였다.
【표 13]
Figure imgf000099_0001
2) 분리 정제 및 순도 확인 상기 접합체 55 내지 59의 반응 생성물을 역상 고성능 액체 크로마토그래피 (high performance l iquid chromatography)로 분리 및 정제하였다 . 칼럼은 Gemini C18 칼럼 (10 x 250 mm, 5 um; Phonomenex , CA, USA)을 사용 하였으며， 이동상 조건은 용매 A(0.1% TFA가 첨가된 증류수)와 용매 B(0.1% TFA가 첨가된 아세토나이트릴 )을 4.7 ml/min 유속을 유지하면서 접합체 55 및 57 :
40-60 %, 접합체 58 내지 59： 40-70%로 선형적으로 변화시켰다 . UV흡광계 280 nm에 서 모니터링하여 10분에서 15분 사이 (접합체 55 : 13분， 접합체 57： 10분， 접합체 58： 13분， 접합체 59： 15분)에 검출되는 피크를 수거하였다 . 수거된 피크는 유기용 매 및 TFA를 진공하에서 휘발시킨 후 적절한 분자량 컷오프를 가진 ultracentr i fugal f i lter를 사용하여 농—， 정제하였다 . 정제된 물질의 순도는 HPLC 분석법을 통해 확인하였다. 일정 온도 (35°C )에서 Gemini C18 칼럼 (4.6 x 250 mm, 5 um; Phenomenex , CA, USA)을 사용하여 분석하였다 . 분석은 트리플루오로아세 트산시 액 : 아세토나이트릴혼합액 (혼합비를 60 : 40에서 20분 후 30 : 70가 되도록 한다)으로 이루어진 이동상을 사용하여 1 mL/min의 유속에서 gradient elut ion 방 법에 의해 수행되었다. UV 흡광도는 280 nm에서 관찰하였다. 측정결과， 접합체 55 및 접합체 57 내지 59의 정제 크로마토그램은 도 8에 나타난 바와 같고， 접합체 56의 최종물질 크로마토그램은 도 9에 나타난 바와 같 다. 또한， UV 검출기로 분석한 결과， 비오틴 모이어티 및 지방산 모이어티와 결합 된 폴리펩티드 이외의 다른 피크는 관찰되지 않았으며， 각각의 크로마토그램으로부 터 발생한 피크의 면적을 백분율로 나타냈을 때， 접합체 55 내지 접합체 59의 순도 가 95 % 이상인 것을 확인하였다.
3) 분자량 확인 상기 접합체 55 내지 접합체 59에서 얻어진 최종 물질의 분자량을 측정하였 다. 분자량은 MALDI-T0F 질량분석법을 통해 확인하였다. 매트릭스 용액으로는 CHCA( a-Cyano-4-hydr oxyc i nnami c acid)를 0.1 % TFA를 함유한 50 % 아세토나이트릴 에 포화시킨 용액을 사용하였다. 질량 스펙트럼은 선형 및 양성 모드에서 확인하였 으며， 최종 물질의 농도를 0.1 mg/mL로 하여 분자량을 확인하였다. 분석결과는 표 13에 나타난 바와 같다. 접합체 60 내지 64
1) 제조예 하기 표 14의 접합체는 하기 방법에 의해 제조하였다. 반응 용매를 0.3 % 트리에틸아민 奸묘 £111£1사)이 첨가된 « 용액으로 하 여， 상기 표 6에 기재된 서열번호 22, 서열번호 24, 서열번호 26, 서열번호 28 및 서열번호 30의 폴리펩티드 및 상기 표 3 내지 표 4에 기재된 비오틴 모이어티를 몰 비율 1 : 1로 하여 혼합물을 제조하여 실온에서 30분 이상 반응시켰다. 폴리펩티드 -비오틴 모이어티 혼합물에 상기 표 5에 기재된 지방산 모이어티를 몰 비율 1 : 2 로 하여 혼합물을 제조하여 실온에서 120분 이상 반응시켰다. 반응은 혼합물의 부 피와 같은 부피의 1% 트리플루오로아세트산 (竹 11101'0 아八： 301(1) 용액을 가하여 멈추게 하였다.
【표 14]
Figure imgf000101_0001
2) 분리 정제 및 순도 확인상기 접합체 60 내지 64의 반응 생성물을 역상 고 성능 액체 크로마토그래피 (high performance liquid chromatography)로 분리 및 정제하였다. 칼럼은 Gemini C18 칼럼 （10 x 250 mm, 5 um; Phonomenex , CA, USA）을 사용 하였으며， 이동상 조건은 용매 A（0.1% TFA가 첨가된 증류수）와 용매 B（0.1% TFA가 첨가된 아세토나이트릴）을 4.7 ml/min 유속을 유지하면서 실시예 18 내지 20： 30- 60%, 실시예 21 내지 22： 25-50%로 선형적으로 변화시켰다. UV흡광계 280 nm에서 모니터링하여 5분에서 18분 사이 （실시예 18: 20분， 실시예 19: 15분， 실시예 20： 13분， 실시예 21： 17분 실시예 15분）에 검출되는 피크를 수거하였다. 수거된 피크 는 유기용매 및 TFA를 진공하에서 휘발시킨 후 적절한 분자량 컷오프를 가진 ultracentrifugal f i lter를 사용하여 농—， 정제하였다. 정제된 물질의 순도는 HPLC 분석법을 통해 확인하였다. 일정 온도 （35°C）에서 Gemini C18 칼럼（4.6 x 250 mm, 5 um; Phenomenex , CA, USA）을 사용하여 분석하였다. 분석은 트리플루오로아세 트산시액 : 아세토나이트릴혼합액（혼합비를 75:25에서 20분 후 50:50가 되도록 한 다）으로 이루어진 이동상을 사용하여 1 mL/min의 유속에서 gradient elution 방법 에 의해 수행되었다. UV 흡광도는 280 nm에서 관찰하였다. 측정결과， 접합체 60 내지 64의 정제 크로마토그램은 도 11에 나타난 바와 같다.
UV 검출기로 분석한 결과， 비오틴 모이어티 및 지방산 모이어티와 결합된 폴 리펩티드 이외의 다른 피크는 관찰되지 않았으며， 각각의 크로마토그램으로부터 발 생한 피크의 면적을 백분율로 나타냈을 때， 접합체 60 내지 64의 순도가 95 % 이상 인 것을 확인하였다.
3） 분자량 확인 2022/112849 1»（그1’/182021/022237 상기 접합체 60 내지 64에서 얻어진 최종 물질의 분자량을 측정하였다. 분자량은 111)1 - 에 질량분석법을 통해 확인하였다. 매트릭스 용액으로는 0¾1(3-0 3110-4-]¾，(11，(«:7( 1111_八: )를
Figure imgf000103_0001
함유한 50 % 아세토나이트릴 에 포화시킨 용액을 사용하였다. 질량 스펙트럼은 선형 및 양성 모드에서 확인하였 으며， 최종 물질의 농도를 0.1 11¾/1 로 하여 분자량을 확인하였다. 분석결과는 표 14에 나타난 바와 같다. 접합체 66
1) 제조예 하기 표 15의 접합체는 하기 방법에 의해 제조하였다. 반응 용매를 0.3 % 트리에틸아민 奸묘 £111£1사)이 첨가된 « 용액으로 하 여， 상기 표 6의 서열번호 15의 6번째 및 11번째 시스테인， 서열번호 15의 7번째 및 서열번호 16의 7번째 시스테인， 및 서열번호 15의 20번째 및 서열번호 16의 19 번째 시스테인 간 이황화결합으로 결합된 폴리펩티드와 상기 표 3 내지 표 4에 기 재된 비오틴 모이어티를 몰 비율 1 : 1로 하여 혼합물을 제조하여 실온에서 30분 이상 반응시켰다. 폴리펩티드-비오틴 모이어티 혼합물에 상기 표 5에 기재된 지방 산 모이어티를 몰 비율 1 : 2로 하여 혼합물을 제조하여 실온에서 120분 이상 반응 시켰다. 반응은 혼합물의 부피와 같은 부피의 1 % 트리플루오로아세트산
(1＞ 11101'0 八： 301(1) 용액을 가하여 멈주게 하였다.
【표 15]
Figure imgf000104_0001
2) 분리 정제 및 순도 확인 상기 접합체 66의 반응 생성물을 역상 고성능 액체 크로마토그래피 (high performance l iquid chromatography)로 분리 및 정제하였다. 칼럼은 Gemini C18 칼 럼 (10 X 250 mm, 5 um; Phonomenex , CA, USA)을 사용하였으며， 이동상 조건은 용 매 A(0.1% TFA가 첨가된 증류수)와 용매 B(0.1% TFA가 첨가된 아세토나이트릴 )을 4.7 ml/min 유속을 유지하면서 35-45%로 선형적으로 변화시켰다. UV흡광계 280 nm 에서 모니터링하여 13분에서 14분 사이에 검출되는 피크를 수거하였다. 수거된 피 크는 유기용매 및 TFA를 진공하에서 휘발시킨 후 적절한 분자량 컷오프를 가진 ultracentri fugal f i lter를 사용하여 농—， 정제하였다. 정제된 물질의 순도는 HPLC 분석법을 통해 확인하였다. 일정 온도 (35°C )에서 Gemini C18 칼럼 (4.6 x 250 mm, 5 um; Phenomenex , CA, USA)을 사용하여 분석하였다. 분석은 트리플루오로아세 트산시 액 : 아세토나이트릴혼합액 (혼합비를 70 : 30에서 20분 후 40 : 60가 되도록 한다)으로 이루어진 이동상을 사용하여 1 mL/min의 유속에서 gradient elut ion 방 법에 의해 수행되었다. UV 흡광도는 280 nm에서 관찰하였다. 측정결과， 접합체 66의 정제 크로마토그램은 도 13에 나타난 바와 같다. 또 한， UV 검출기로 분석한 결과， 비오틴 모이어티 및 지방산 모이어티와 결합된 폴리 2022/112849 1»（그1’/182021/022237 펩티드 이외의 다른 피크는 관찰되지 않았으며， 각각의 크로마토그램으로부터 발생 한 피크의 면적을 백분율로 나타냈을 때， 접합체 66의 순도가 95 % 이상인 것을 확 인하였다.
3) 분자량 확인 상기 접합체 66에서 얻어진 최종 물질의 분자량을 측정하였다. 분자량은 111)1 - 에 질량분석법을 통해 확인하였다. 매트릭스 용액으로는 0¾1(3-0 3110-4-]¾년1(«：7(^1111_八: )를 0.1
Figure imgf000105_0001
함유한 50 % 아세토나이트릴 에 포화시킨 용액을 사용하였다. 질량 스펙트럼은 선형 및 양성 모드에서 확인하였 으며， 최종 물질의 농도를 0.1 11¾/1 로 하여 분자량을 확인하였다. 분석결과는 표 15에 나타난 바와 같다. 접합체 69
1) 제조예 하기 표 16의 접합체는 하기 방법에 의해 제조하였다. 상기 표 6의 서열번호 42의 폴리펩티드를
Figure imgf000105_0002
7.8 인산염완충액에 녹인 후, 비오틴 모이어티를 에 녹여서 준비한 후 각 물질의 부피비를 90 : 10으로 하여 반응을 시켰다. 몰비는 1 : 22로 하여 실온에서 60분 이상 반응시켰다. 폴리펩티드 -비오틴 모이어티 혼합물에 상기 표 5에 기재된 지방산 모이어티를 몰 비율 1:9로 하여 혼합물을 제조하여 실온에서 60분 이상 반응시켰다. 반응은 반응물을 4도로 물질 보관온도를 낮추어 반응이 저해되도록 한 후 곧바로 정제하였다. 2022/112849 1»(그1’/182021/022237
【표 16]
Figure imgf000106_0001
2) 분리 정제 및 순도 확인 상기 접합체 69의 반응 생성물은 역상 크로마토그래피 분석법을 통하여 반응 이 진행되었고 해당 물질이 생성되었음을 확인하였으며， 정제는 적절한 분자량 컷 오프를 가진 1111；대06111；1' 1 31 를사용하여 실시하였다. 측정결과， 접합체 69의 정제 크로마토그램은 도 15에 나타난 바와 같다. 또 한， 검출기로 분석한 결과， 비오틴 모이어티 및 지방산 모이어티와 결합된 폴리 펩티드 이외의 다른 피크는 관찰되지 않았으며， 각각의 크로마토그램으로부터 발생 한 피크의 면적을 백분율로 나타냈을 때， 접합체 69의 순도가 95 % 이상인 것을 확 인하였다
3) 분자량 확인 상기 접합체 69에서 얻어진 최종 물질의 분자량을 측정하였다. 분자량은 MALDI-T0F질량분석법을 통해 확인하였다. 매트릭스 용액으로는 CHCA(a-Cyano-4-hydroxycinnamic acid)를 0.1 % TFA를 함유한 50 %아세토나이트릴 에 포화시킨 용액을 사용하였다. 질량 스펙트럼은 선형 및 양성 모드에서 확인하였 으며， 최종 물질의 농도를 0.1 mg/mL로 하여 분자량을 확인하였다. 반응 전후의 평 균 분자량을 통해 비오틴 모이어티의 평균 결합수를 구하였다. 접합체 69의 평균 비오틴 결합수는 10〜 20으로 확인되었다. 분석결과는 표 16에 나타난 바와 같다. 실험예 . In vitro활성시험
GLP-1 수용체 효력 확인 접합체 3 , 14 내지 20 상기 접합체 3， 14 내지 20 의 in vitro활성을 측정하였다. 먼저， GLP-1 수용체에 대한 효력을 확인하기 위하여 Eurofins에서 CH0-K1세 포에 인간 GLP-1 수용체가 발현되는 세포를 구매하여 이용하였으며， 96웰 플레이트 에 각 웰당 7 X 103개의 세포를 분주하고 37 의 온도조건으로 C02 배양기에서 배 양하였다. 24시간 이후， 각 웰에 배양액을 제거 후 0.5mM IBMX를 30 ul로 15분 처 리한다. 이후， 각 실시 예 0.001 - 1000 nM및 Exendin-4를 처리한 후 30분 동안 37 °C의 온도조건으로 C02 배양기에서 배양하였다. 그 후， HitHunter(R)cAMP assay kit 을 사용하여 cAMP(Luciferase acitivity)의 생성량을 측정하여 GLP-1의 수용체에 대한 ECso값을 산출하였다. 측정결과는 표 17에 나타난 바와 같다.
【표 17] 2022/112849 1»（그1’/182021/022237
Figure imgf000108_0002
흡수율 측정 접합체 3 , 14 내지 20 약물의 흡수율을 확인하기 위하여 약학적 거동을 비교하였다. 체중이 200 § 정도인 실험용 쥐 대1）에 시료를 100 및 500地/1¾ 의 양으 로 각각 소장의 십이지장 내로 투여한 후 혈액을 채취하였다. 각 시료는 투여 용량 에 따라 0.02% 폴리소베이트 80가 함유된 101 표 入幻에 용해한
Figure imgf000108_0001
를 각각 681 /1¾， 3½요/1¾ 첨가하여 1，000대111에서 20분간 혼합한 후 투여하였다. 시간에 따른 혈중 약물농도의 변화를 효소결합 면역흡착검사 방법（此 시으로 측정 하였다. 혈액 샘플은 경정맥으로부터 채취하였다. 결과는 평균 값으로 계산하였고， 그 결과는 표 18에 나타난 바와 같다.
【표 18】
Figure imgf000108_0003
상기 접합체 15 내지 17를 실험용 쥐 묘 ）에 정맥 투여 후 , 약학적 거동 을 확인하였다. 실험결과는 하기 표 19에 나타난 바와 같다. 【표 19】
Figure imgf000109_0001
혈당 조절능 측정 접합체 3, 17 및 20 내당능을 확인하기 위해 경구용 GLP-1 작용제 제형을 마우스에 경구 투여 후 복강 내 당부하 검사（Intraper itoneal Glucose tolerance test: IPGTT）를 통해 혈 당조절 효능을 측정하였다. 동물모델에서의 복강 내당력을 측정하기 위해 9주령 된 수컷 마우스 （C57BL/6）에 시료 100 （10 ug/mouse, 서열번호 1 기준）를 -60분에 경구 투여한 후， 200 uL의 글루코오스 （2 g/kg）를 복강주사 하고 -60， 0， 20， 40， 60， 90， 120 분에 꼬리 정맥에서 채취한 혈액에서의 혈당 변화를 관찰하였다. 서열번호 5의 아 미노산 서열을 가지는 폴리펩티드를 피하 투여한 것을 대조군 1로 하고， 경구 투여 한 것은 대조군 2로 하였다.
【표 20]
Figure imgf000109_0002
2022/112849 1»（그1’/182021/022237 접합체 20 및 24상기 접합체 20 및 24를， 마우스에 경구 투여 후， 당부하 검 사를 통해 혈당 조절 효능을 측정하였다. 측정결과는 도 4에 나타난 바와 같으며， 접합체 20 및 24의 접합체 투여 군 이 무처리군에 비해 혈당이 현저하게 낮아진 것을 확인하였다. 접합체 53 내지 54 상기 접합체 53 내지 54를 당부하 검사를 통해 혈당 조절 효능을 측정하였 다. 접합체를 마우스에 경구 투여 후， 6시간 경과 후에 글루코오스를 복강으로 투 여한 후 혈당 변화를 측정하였다. 측정결과는 도 7에 나타난 바와 같으며， 접합체 53 내지 54 투여 군이 무처 리군에 비해 혈당이 현저하게 낮아진 것을 확인하였다. 접합체 65 및 66 상기 접합체 65 및 66을， 마우스에 경구 투여 후， 당부하 검사를 통해 혈당 조절 효능을 측정하였다. 동물모델에서의 복강 내당력을 측정하기 위해 8주령 된 수컷 마우스 ᄄ57此/6)에 시료를 -20분에 경구 투여한 후， 글루코오스 (2 §/1¾)를 복강주사 하 고 -20， 0， 20， 40， 60， 90， 120분에 꼬리 정맥에서 채취한 혈액에서의 혈당 변화 를 관찰하였다. 대조군은 서열번호 15의 6번째 및 11번째 시스테인， 서열번호 15의
7번째 및 서열번호 16의 7번째 시스테인， 및 서열번호 15의 20번째 및 서열번호 16 의 19번째 시스테인 간 이황화결합으로 결합된 폴리펩티드를 경구 투여 하였다. 측정결과는 도 14에 나타난 바와 같다. 도 14에 나타난 바와 같이 무처리 군 에 비해 접합체 투여군의 혈당이 현저하게 감소하였다.
Caco-2 세 ?막 투과도 측정 접합체 17, 51， 72 및 73 상기 접합체 51을 Hanks Balanced Salt Solut ion (HBSS)에 녹여， Caco-2 세 포막 투과도를 측정하였다. 먼저， Caco-2 세포단층막 형성을 위하여 12 -트랜스웰 플레이트에 각 웰당 1.5 X 105개의 세포를 분주하고 37 °C CO2 조건에서 3~4주간 배 양하였다. 처음 일주일 동안은 2일에 한번씩 배양배지를 갈아주었으며 그 후에는 3 일 간격으로 배양배지를 갈아서 배양하였다. 실험에는 시딩 (seeding) 후 3~4주 사 이의 것을 사용하였다. 세포단층막 형성을 검증하기 위하여 TEER 값 및 Luci fer yel low 값을 측정하여， TEER값이 300 Q x cirf 이상 그리고 Luci fer yel low의 투과 도 측정값이 3% 이내인 세포단층막만을 시험에 사용하였다. 각 시험에 사용할 트랜 스웰을 Tranport media(HBSS)로 워싱 후 37 °C , CO2배양기에서 1시간동안 배양한 후 조제한 약물 및 투과성 마커 (Permeabi 1 ity marker)를 정단부 (apical side)에 200 y L씩 가하고 기저즉부 (basolateral side)에는 약물이 함유되지 않은 수송 배 지 (Transport media)를 1 mL씩 처리한 꾸 37 °C , CO2배양기에서 2시간동안 배 양 ( incubat ion)시켰다. 2시간 꾸， basolateral side에서 각 1 mL씩 샘플링한 꾸 약 물의 투과계수 (papp vaiue)는 효소결합 면역흡착검사 방법 (ELISA)으로 측정하였다. 투과계수 (Papp)값은 다음과 같이 계산하였으며， 분석결과는 표 21에 나타난 바와 같다. (이 때， 각 접합체는 상기 제조예와 동일한 방식에 의해 제조된 것을 사용하 였다)
[ Papp(10 6, 0111/3) = ((10/(11; ) X / (쇼 X (X) ]
(*(10-투과된 샘플의 농도， (11:-약물 처리시간， ¥1시33301 6데 용적， 쇼- 면적， -초기 가한 약물농도)
【표 21]
Figure imgf000112_0001
접합체 68 및 69 상기 접합체 68 및 69를 Hanks Balanced Salt Solut ion (HBSS)에 녹여， Caco-2 세포 내 축적량을 측정하였다. 먼저， 세포 내 축적양을 확인하기 위하여 Caco-2 세포를 96웰 플레이트에 각 웰당 7 x 104개로 분주하고 37 °C의 온도조건으 로 C02 배양기에서 배양하였다. 24시간 이후， 각 웰의 배양액을 제거 후 HBSS로 워 싱 후 조제한 약물을 100 ul씩 가하고 37 °C , CO2배양기에서 배양하였다. 8분 후， 각 웰을 PBS로 워싱한 후 10% 포르말린으로 100 ul씩 처리한 후， 실온에서 반응시 켰다. 10분 후， 각 웰을 PBS로 워싱한 후 0.1% TRITON X-100을 100 씩 처리한 후 실온에서 반응시켰다. 10분 후, 각 웰을 PBS로 워싱한 후 1% BSA로 1시간 블로 킹 (Blocking)시켰다. 이꾸， HRP Ant i -Growth Hormone antibody (1:1000)으로 처리 하였다. 1시간 후， 각 웰을 PBST로 워싱한 후 Ultra TMB substrate solution을 가 하였다. 10분 후， 각 웰에 2N HCL stop solution을 처리하고 450 nM에서 흡광도를 측정하여 각 물질의 세포 내 축적양을 계산하였다. 결과는 hGH를 100% 기준으로 하 였으며， 측정결과는 표 22 및 도 16에 나타난 바와 같다. (이 때， 접합체는 상기 제조예와 동일한 방식에 의해 제조된 것을 사용하였다)
【표 22]
Figure imgf000113_0001
체중 변화 및 사 섭취량측정 접합체 58 및 59 상기 접합체 58 및 59를 비만 모델 마우스에 2주간 피하 투여 후 체중 변화 를 측정하였다. 도 10에 나타난 바와 같이， 무처리군에 비해 접합체 58 및 59를 투여한 경 우， 체중이 현저하게 감소한 것을 확인하였다. 2022/112849 1»（그1’/182021/022237 접합체 33, 36, 39, 42 및 61 내지 64 폴리펩티드， 상기 접합체 61 내지 64， 접합체 33， 36, 39 및 42를 마우스에 경구 투여 후， 24시간 동안의 체중감소 및 사료 섭취량을 측정하였다. (이 때， 각 접합체는 상기 제조예와 동일한 방식에 의해 제조된 것을 사용하였다) 측정결과， 체중감소는 하기 표 23에 나타난 바와 같고， 사료 섭취량은 도 12 에 나타난 바와 같다. 무처리군에 비해 단일 폴리펩티드 투여군이 체중 감량， 사료 섭취량의 감소가 있었으나， 단일 폴리펩티드 투여군에 비하여 접합체 투여군의 체 중감량 및 사료섭취량 감소 효과가 우수하게 나타났다.
【표 23]
Figure imgf000114_0001
당업자는 본 명세서에 기재된 본 발명의 특정 구체예에 대한 다수의 균등물 에 대해， 단지 일상적 실험을 사용하여 이를 인식하거나， 또는 확인할 수 있을 것 이다. 이러한 균등물은 다음의 청구범위에 포함되는 것으로 의도된다. 전술한 본원 2022/112849 1»（그1’/182021/022237 의 설명은 예시를 위한 것이며， 본원이 속하는 기술분야의 통상의 지식을 가진 자 는 본원의 기술적 사상이나 필수적인 특징을 변경하지 않고서 다른 구체적인 형태 로 쉽게 변형이 가능하다는 것을 이해할 수 있을 것이다. 그러므로 이상에서 기술 한 실시예들은 모든 면에서 예시적인 것이며 한정적이 아닌 것으로 이해해야만 한 다. 예를 들어， 단일형으로 설명된 각 구성 요소는 분산되어 실시될 수도 있으며， 마찬가지로 분산된 것으로 설명된 구성 요소들도 결합된 형태로 실시될 수 있다. 후술하는 특허청구범위의 의미 및 범위， 그리고 그 균등 개념으로부터 도출되는 모 든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석될 수 있다.
2022/112849 1»（：1/¾2021/022237
【산업상 이용가능성】 본 발명은 경구 흡수율이 향상됨에 따라 의약학 분야에서 유용하게 사용될 수 있다.

Claims

【청구의 범위】
【청구항 1] 비오틴 모이어티 (moiety), 지방산 모이어티 또는 이의 조합이 생리활성 물질 과 결합되는， 생리활성 물질 접합체.
【청구항 2] 제 1항에 있어서， 상기 생리활성 물질은 글루카곤 (Glugacon)， GLP-l(Glucagon_l ike peptide- 1)， GLP-2 ( G 1 ucagon- 1 i ke peptide-2) , GIP(glucose_dependent insul inotropic polypeptide) , 엑센딘- 4(exendin_4) , 인슐린， 부갑상선 호르몬， 인터페론， 에리트 로포이에틴， 칼시토닌， 아밀린， 세로토닌， 리특시맙， 트라스트주맙， 우리카제， 조 직 플라스미노겐 활성화제， 티모글로빈， 백신， 헤파린 또는 헤파린 유사체， 안티트 롬빈 III， 필그라스팀， 프라믈린티드 (pramlintide) 아세테이트， 엑세나티드， 에프 티피바티드 (ept i f ibat ide)， 안티베닌 (antivenin)， IgG, IgM, HGH, 티록신， 혈액 응 고 인자 VII 및 VIII, 치료제로서 작용하는 당지질， 및 이들의 유도체로 이루어진 군에서 선택되는 것인， 생리활성 물질 접합체.
【청구항 3] 제 1항에 있어서， 상기 생리활성 물질은， 서열번호 1 내지 서열번호 14 및 서열번호 18 내지
42로 표시되는 아미노산 서열로 이루어진 폴리펩티드 또는 이의 유도체로 이루어진 2022/112849 1»（그1’/182021/022237 군으로부터 선택된 1종인， 생리활성 물질 접합체 .
【청구항 4] 제 1항에 있어서， 상기 생리활성 물질은， 서열번호 15 및 서열번호 16으로 표시되는 아미노산 서열로 이루어진 폴리펩티드 또는 이의 유도체 ; 또는 서열번호 17 및 서열번호 16 으로 표시되는 아미노산 서열로 이루어진 폴리펩티드 또는 이의 유도체인， 생리활 성 물질 접합체 .
【청구항 5] 제 1항에 있어서， 상기 비오틴 모이어티는 하기 일반식 쇼로 표시되는 것인， 생리활성 물질 접 합체 :
[일반식 시
Figure imgf000118_0001
상기 일반식 쇼에서，
X는 상기 생리활성 물질과 결합할 수 있는 작용기이고， 는 스페이서이며，
2는 바인딩 유닛이고， 2022/112849 1»（그1’/182021/022237 표는 하기 화학식 /ᅡ1로 표시되며， [화학식 쇼-1]
2
Figure imgf000119_0001
연결되고，는 말단기이며， m은 1 내지 10의 정수이고，
II은 0 또는 1 내지 10의 정수이며， 11=0인 경우 는 6 또는 에 직접결합하 고，
I）는 0 또는 1의 정수이다.
【청구항 6] 제 5항에 있어서， 상기 V己 말레이미드， 석신이미드， I하이드록시석신이미드， 석신이미딜 석 시네이트， 석신이미딜 글루타레이트， 석신이미딜 메틸에스터， 석신이미딜 펜틸에스 터， 석신이미딜 카보네이트， 니트로페닐카보네이트， 알데하이드， 아민， 티올， 옥 시아민， 아이오도아세트아마이드， 아미녹실， 하이드라지드， 하이드록시， 프로피오 네이트， 피리딜， 알킬할라이드， 비닐술폰， 카복실， 하이드라지드， 할로겐 아세트아 2022/112849 1»（그1’/182021/022237 마이드， 02-5 알키닐， 06-20 아릴디설파이드， 05-20 헤테로아릴디설파이드， 이소시아네 이트， 티오에스테르， 이미노에스테르， 및 이의 유도체로 이루어진 그룹으로부터 선 택되는 것인， 생리활성 물질 접합체.
【청구항 7] 제 5항에 있어서， 상기 는 부재하거나 치환되거나 비치환된 선형 또는 분지형 01-50 알킬렌， 치환되거나 비치환된 선형 또는 분지형 01-50 헤테로알킬렌， 치환되거나 비치환된 06- 50 아릴렌， 또는 치환되거나 비치환된 06-50 헤테로아릴렌이며， 치환된 경우 =0， (0) 2， _예， -⑶예， - ， =■ 및 - 2로 구성된 그룹으로 부터 선택된 하나 이상을 포함하는 것인， 생리활성 물질 접합체.
【청구항 8] 제 5항에 있어서， 상기 는 -0(0)-(0012抑 2^-· -를 반복단위로 포함하고， 여기에서 II은 1 내지 20의 정수인， 생리활성 물질 접합체.
【청구항 9] 제 5항에 있어서， 상기 는 글루탐산 (£1 3111八： 301(1) , 글루타민 (£1 311^116) , 글리신 (요1 ( 116) , 이소류신 ( 01611(^116) , 또는 리신 (11 !16)을 구성 일부로 포함하는， 생리활성 물질 2022/112849 1»（그1’/182021/022237 접합체 .
【청구항 10】 제 5항에 있어서， 상기 는 하기 중 어느 하나이고 각각 독립적으로 선택되는 것인， 생리활성 물질 접합체: 시 표와 함께 또는 표와 별도로， 아미노산 또는 이의 유도체를 형성하거나; 치환되거나 비치환된 선형 또는 분지형 01-50 헤테로알킬렌이며， 여기에서 치환된 경우， =0， (0) 2， _예， -⑶예， - ， =■ 및 - 2로 구성 된 그룹으로부터 선택된 하나 이상을 포함한다.
【청구항 11】 제 5항에 있어서， 상기 는 아민， 01-8 알킬， 01-8 알케닐， 할로， 하이드록시， 티올， 설폰산， 카 르복실， 페닐， 벤질， 알데하이드， 아자이드， 사이아네이트， 아이소사이아네이트， 티오사이아네이트， 아이소티오사이아네이트， 나이트릴 및 포스폰산으로 구성된 그 룹으로부터 선택되는 것인， 생리활성 물질 접합체.
【청구항 12】 제 1항에 있어서， 상기 비오틴 모이어티는，
Figure imgf000122_0001
Figure imgf000123_0001
Figure imgf000124_0001
Figure imgf000125_0001
Figure imgf000126_0001
Figure imgf000127_0001
Figure imgf000128_0001
Figure imgf000129_0001
Figure imgf000130_0001
Figure imgf000132_0001
Figure imgf000133_0001
Figure imgf000134_0001
2022/112849 1^(:1^2021/022237
Figure imgf000135_0001
것인, 생리활성 물질 접합체.
【청구항 13】 2022/112849 1»（그1’/182021/022237 제 1항에 있어서 상기 지방산 모이어티는 생리활성 물질에 결합되고， 상기 비오틴 모이어티가 결합된 생리활성 물질의 부위와 다른 부위에 결합 된 것인， 생리활성 물질 접합체 .
【청구항 14】 제 1항에 있어서， 상기 지방산 모이어티는 하기 일반식 8로 표시되는 것인， 생리활성 물질 접 합체 :
［일반식 «
X게 상기 식에서，은 상기 생리활성 물질과 결합할 수 있는 작용기이고，
^는 스페이서이며，
V는 지방산이다.
【청구항 15】 제 14항에 있어서， 상기 은 말레이미드， 석신이미드， I하이드록시석신이미드， 석신이미딜 석 시네이트， 석신이미딜 글루타레이트， 석신이미딜 메틸에스터， 석신이미딜 펜틸에스 터， 석신이미딜 카보네이트， 니트로페닐카보네이트， 알데하이드， 아민， 티올， 옥 2022/112849 1»（그1’/182021/022237 시아민， 아이오도아세트아마이드， 아미녹실， 하이드라지드， 하이드록시， 프로피오 네이트， 피 리 딜， 알킬할라이드， 비 닐술폰， 카복실， 하이드라지드， 할로겐 아세트아 마이드， 02-5 알키 닐， 06-20 아릴디설파이드， 05-20 헤테로아릴디설파이드， 이소시아네 이트， 티오에스테르， 이미노에스테르， 테트라플루오로페닐 에스테르， 니트로페닐 카보네이트， 니트로페닐 및 이의 유도체로 이루어진 그룹으로부터 선택되는 것인， 생리활성 물질 접합체 .
【청구항 16】 제 14항에 있어서， 상기 는 치환되거나 비치환된 선형 또는 분지 형 01-60 알킬렌， 치환되거나 비치환된 선형 또는 분지 형 01-60 알케닐렌， 치환되거나 비치환된 선형 또는 분지 형 01-60 헤테로알킬렌， 또는 치환되거나 비치환된 선형 또는 분지 형 01-60 헤테로알케닐 렌이며， 치환된 경우 =0， -◦(0) 2， _예， -⑶예， - ， =■， - 2， 및 할로로 구성된 그룹으로부터 선택된 하나 이상으로 치환되는 것인， 생리활성 물질 접합체 .
【청구항 17】 제 1항에 있어서， 상기 지방산 모이 어티는 다음 일반식 의 화학식으로 표시되는 것인， 생리 활성 물질 접합체 :
[일반식 ¾] 2022/112849 1»(그1’/182021/022237 1 - ^ -。(0)斗1 1은 말레이미드， I하이드록시석신이미드， 알데하이드， 아민， 테트라플루 오로페닐 에스테르 또는 니트로페놀이고， ’은 스페이서이며， 凡은 06-28 치환 또는 비치환된 선형 또는 분지형 알킬렌， 치환 또는 비치환된 선형 또는 분지형 헤테로 알킬렌이다.
【청구항 18】 제 14항 또는 제 17항에 있어서， 상기 ^는 직접결합에 해당하거나， 의 구조 내에 치환 또는 비치환된 01-50 선형 알킬렌， 치환 또는 비치환된 01-50 비선형 알킬렌， 치환 또는 비치환된 01-50 선 형 헤테로알킬렌， 치환 또는 비치환된 01-50 비선형 헤테로알킬렌， 치환 또는 비치환 된 01-50 아릴렌， 치환 또는 비치환된 01-50 헤테로아릴렌， -0 -, -0(0) , - 0川묘 -， -0(0)0 -, -·- 또는 - 예 -로 구성된 그룹으로부터 하나 이상을 포함하고， 여 기에서 묘은 수소， 치환 또는 비치환된 01-50 알킬， 치환 또는 비치환된 아릴， 또 는 에틸렌글리콜 반복단위 (_(抑 20120^ -， II은 1 이상 20이하의 정수)인， 생리활성 물 질 접합체 .
【청구항 19】 제 14항 또는 제 17항에 있어서， 상기 ［는 -0(0)-(0012抑 2^-· -를 반복단위로 포함하고， 여기에서 II은 1 내 지 20의 정수인， 생리활성 물질 접합체 .
【청구항 20] 제 14항 또는 제 17항에 있어서， 상기 Y’는 글루탐산(glutamic acid) , 글루타민 (glutamine) , 글리 신 (glycine) , 이소류신 (isoleucine) , 또는 리신 (Lysine)을 구성 일부로 포함하는， 생리활성 물질 접합체 .
【청구항 21】 제 1항에 있어서， 상기 지방산 모이어티는
Figure imgf000139_0001
Figure imgf000140_0001
Figure imgf000141_0001
Figure imgf000142_0001
2022/112849 1»（：1/¾2021/022237
Figure imgf000143_0001
로 구성된 그룹으로부터 선택된 것인, 생리활성 물질 접합체. 2022/112849 1»（그1’/182021/022237
【청구항 22] 제 1항 내지 제 21항 중 어느 한 항에 따른 생리활성 물질 접합체를 포함하는， 당뇨병， 비만， 지방간 질환， 과민성 장 증후군， 신경퇴행성 질환， 골 질환， 골다공 증， 인간 성장 호르몬 결핍증， 항암 또는 비알코올성 지방간질환의 예방 또는 치료 용 약학적 조성물 .
【청구항 23】 제 1항 내지 제 21항 중 어느 한 항에 따른 생리활성 물질 접합체를 포함하는， 경구 투여용 조성물 .
PCT/IB2021/022237 2020-11-27 2021-11-29 비오틴 모이어티, 지방산 모이어티 또는 이의 조합이 결합된 생리활성 물질 접합체 WO2022112849A1 (ko)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CN202180092431.3A CN116916965A (zh) 2020-11-27 2021-11-29 具有所偶联的生物素部分、脂肪酸部分或它们的组合的生物活性材料缀合物
AU2021386899A AU2021386899A1 (en) 2020-11-27 2021-11-29 Biologically active material conjugate having biotin moiety, fatty acid moiety, or combination thereof coupled thereto
IL303229A IL303229A (en) 2020-11-27 2021-11-29 A biologically active substance conjugate is linked to a biotin unit, a fatty acid unit or a combination thereof
JP2023532340A JP2023553362A (ja) 2020-11-27 2021-11-29 ビオチン部分、脂肪酸部分またはその組合せを連結されて有する生物学的活性材料結合体
GB2309455.0A GB2617717A (en) 2020-11-27 2021-11-29 Biologically active material conjugate having biotin moiety, fatty acid moiety, or combination thereof coupled thereto
CA3200366A CA3200366A1 (en) 2020-11-27 2021-11-29 Biologically active material conjugate having biotin moiety, fatty acid moiety, or combination thereof coupled thereto
MX2023006188A MX2023006188A (es) 2020-11-27 2021-11-29 Conjugado de material biologicamente activo que tiene acoplado un resto de biotina, un resto de acido graso o una combinacion de estos.
EP21897261.0A EP4252780A1 (en) 2020-11-27 2021-11-29 Biologically active material conjugate having biotin moiety, fatty acid moiety, or combination thereof coupled thereto

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20200163363 2020-11-27
KR10-2020-0163363 2020-11-27

Publications (1)

Publication Number Publication Date
WO2022112849A1 true WO2022112849A1 (ko) 2022-06-02

Family

ID=81754120

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2021/022237 WO2022112849A1 (ko) 2020-11-27 2021-11-29 비오틴 모이어티, 지방산 모이어티 또는 이의 조합이 결합된 생리활성 물질 접합체

Country Status (10)

Country Link
EP (1) EP4252780A1 (ko)
JP (1) JP2023553362A (ko)
KR (1) KR20220074813A (ko)
CN (1) CN116916965A (ko)
AU (1) AU2021386899A1 (ko)
CA (1) CA3200366A1 (ko)
GB (1) GB2617717A (ko)
IL (1) IL303229A (ko)
MX (1) MX2023006188A (ko)
WO (1) WO2022112849A1 (ko)

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030199451A1 (en) * 2000-01-28 2003-10-23 Mogensen John Patrick Combination therapy using a dual PPAR-a/PPAR-y activator and a GLP-1 derivative for the treatment of metabolic syndrome and related diseases and disorders
KR20060032140A (ko) * 2003-05-30 2006-04-14 센토코 인코포레이티드 트랜스글루타미나아제를 이용한 신규 에리트로포이에틴접합체의 형성
KR20080042045A (ko) * 2005-05-23 2008-05-14 에스디지,인코포레이티드 포유동물로의 인터페론 전달용 지질 구조물
KR20080064840A (ko) * 2005-09-22 2008-07-09 바이오컴페터블즈 유케이 리미티드 펩티다아제 저항성이 증가된 ｇｌｐ―1（글루카곤 유사펩티드―1） 융합 폴리펩티드
KR20100109896A (ko) * 2007-09-28 2010-10-11 에스디지,인코포레이티드 경구 생체이용가능한 지질-기재 구조물
KR20110004366A (ko) * 2008-03-18 2011-01-13 노보 노르디스크 에이/에스 프로테아제 안정화되고, 아실화된 인슐린 유사체
KR20180039726A (ko) * 2015-09-04 2018-04-18 더 캘리포니아 인스티튜트 포 바이오메디칼 리써치 인슐린 면역글로불린 융합 단백질
KR20200138084A (ko) * 2019-05-31 2020-12-09 ㈜ 디앤디파마텍 비오틴 모이어티와 결합된 생리활성 물질 및 이를 포함하는 경구 투여용 조성물
KR102193211B1 (ko) * 2019-11-27 2020-12-18 (주)디앤디파마텍 비오틴 모이어티가 결합된 폴리펩티드 및 이를 포함하는 경구 투여용 약학적 조성물

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030199451A1 (en) * 2000-01-28 2003-10-23 Mogensen John Patrick Combination therapy using a dual PPAR-a/PPAR-y activator and a GLP-1 derivative for the treatment of metabolic syndrome and related diseases and disorders
KR20060032140A (ko) * 2003-05-30 2006-04-14 센토코 인코포레이티드 트랜스글루타미나아제를 이용한 신규 에리트로포이에틴접합체의 형성
KR20080042045A (ko) * 2005-05-23 2008-05-14 에스디지,인코포레이티드 포유동물로의 인터페론 전달용 지질 구조물
KR20080064840A (ko) * 2005-09-22 2008-07-09 바이오컴페터블즈 유케이 리미티드 펩티다아제 저항성이 증가된 ｇｌｐ―1（글루카곤 유사펩티드―1） 융합 폴리펩티드
KR20100109896A (ko) * 2007-09-28 2010-10-11 에스디지,인코포레이티드 경구 생체이용가능한 지질-기재 구조물
KR20110004366A (ko) * 2008-03-18 2011-01-13 노보 노르디스크 에이/에스 프로테아제 안정화되고, 아실화된 인슐린 유사체
KR20180039726A (ko) * 2015-09-04 2018-04-18 더 캘리포니아 인스티튜트 포 바이오메디칼 리써치 인슐린 면역글로불린 융합 단백질
KR20200138084A (ko) * 2019-05-31 2020-12-09 ㈜ 디앤디파마텍 비오틴 모이어티와 결합된 생리활성 물질 및 이를 포함하는 경구 투여용 조성물
KR102193211B1 (ko) * 2019-11-27 2020-12-18 (주)디앤디파마텍 비오틴 모이어티가 결합된 폴리펩티드 및 이를 포함하는 경구 투여용 약학적 조성물

Also Published As

Publication number Publication date
GB2617717A (en) 2023-10-18
IL303229A (en) 2023-07-01
GB202309455D0 (en) 2023-08-09
KR20220074813A (ko) 2022-06-03
EP4252780A1 (en) 2023-10-04
MX2023006188A (es) 2023-07-13
CA3200366A1 (en) 2022-06-02
JP2023553362A (ja) 2023-12-21
AU2021386899A1 (en) 2023-06-22
CN116916965A (zh) 2023-10-20

Similar Documents

Publication Publication Date Title
KR102005385B1 (ko) 부위-특이적 모노-치환 페길화 엑센딘 유사체 및 그것의 제조방법
US20100021480A1 (en) Bioactive substance-blood protein conjugate and stabilization of a bioactive substance using the same
JP2015536314A (ja) 成長ホルモン送達のための脂肪酸アシル化アミノ酸
AU2004298424A1 (en) Novel GLP-1 compounds
CN102321170A (zh) 利拉鲁肽变构体及其缀合物
KR102480393B1 (ko) 비오틴 모이어티와 결합된 생리활성 물질 및 이를 포함하는 경구 투여용 조성물
KR102005294B1 (ko) 엑세나타이드 수식물 및 그 용도
US20130143815A1 (en) Growth hormone conjugates
CN108676084B (zh) 艾塞那肽的修饰物及其应用
US20230000834A1 (en) Physiologically active substance bound to biotin moiety, and composition for oral administration including same
WO2022112849A1 (ko) 비오틴 모이어티, 지방산 모이어티 또는 이의 조합이 결합된 생리활성 물질 접합체
CN104945499B (zh) 结构修饰的glp-1类似物及其制备方法
CA3195872A1 (en) Glp-1 prodrugs and uses hereof
US20240000803A1 (en) Oral formulation of biologically active material conjugate having biotin moiety, fatty acid moiety, or combination thereof coupled thereto
CN114746437A (zh) 生物素部分缀合的多肽和包括其的用于口服施用的药物组合物
KR100778633B1 (ko) 비오틴과 비오틴-폴리에틸렌글리콜이 접합된 ｇｌｐ-1유도체, 이의 제조방법 및 이를 포함하는 약학 조성물
CN116490212A (zh) Glp-1前药及其用途
KR20230159805A (ko) 프로드러그 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21897261

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3200366

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2023532340

Country of ref document: JP

Ref document number: 18039130

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023010197

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 202309455

Country of ref document: GB

Kind code of ref document: A

Free format text: PCT FILING DATE = 20211129

Ref document number: 2021386899

Country of ref document: AU

Date of ref document: 20211129

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021897261

Country of ref document: EP

Effective date: 20230627

WWE Wipo information: entry into national phase

Ref document number: 202180092431.3

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 112023010197

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230525

WWE Wipo information: entry into national phase

Ref document number: 523440895

Country of ref document: SA