WO2021201489A1 - 글루타민 생산능을 향상시키는 형질전환용 재조합 벡터 및 이를 도입한 균주 - Google Patents
글루타민 생산능을 향상시키는 형질전환용 재조합 벡터 및 이를 도입한 균주 Download PDFInfo
- Publication number
- WO2021201489A1 WO2021201489A1 PCT/KR2021/003633 KR2021003633W WO2021201489A1 WO 2021201489 A1 WO2021201489 A1 WO 2021201489A1 KR 2021003633 W KR2021003633 W KR 2021003633W WO 2021201489 A1 WO2021201489 A1 WO 2021201489A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- glna
- strain
- vector
- glutamine
- transformation
- Prior art date
Links
- 239000013598 vector Substances 0.000 title claims abstract description 44
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 title claims abstract description 24
- 230000009466 transformation Effects 0.000 title claims description 16
- 102000005396 glutamine synthetase Human genes 0.000 claims abstract description 34
- 108020002326 glutamine synthetase Proteins 0.000 claims abstract description 34
- 239000002773 nucleotide Substances 0.000 claims abstract description 15
- 125000003729 nucleotide group Chemical group 0.000 claims abstract description 15
- 150000001413 amino acids Chemical group 0.000 claims abstract description 12
- 101150062928 glnE gene Proteins 0.000 claims description 17
- 238000000034 method Methods 0.000 claims description 17
- 238000004519 manufacturing process Methods 0.000 claims description 11
- 230000014509 gene expression Effects 0.000 claims description 8
- 241000186226 Corynebacterium glutamicum Species 0.000 claims description 5
- 230000035897 transcription Effects 0.000 claims description 4
- 238000013518 transcription Methods 0.000 claims description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 3
- 108700007698 Genetic Terminator Regions Proteins 0.000 claims description 3
- 238000012258 culturing Methods 0.000 claims description 3
- 108010064177 glutamine synthetase I Proteins 0.000 description 35
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 27
- 230000000694 effects Effects 0.000 description 17
- 108010039224 Amidophosphoribosyltransferase Proteins 0.000 description 16
- 230000003321 amplification Effects 0.000 description 16
- 239000002609 medium Substances 0.000 description 16
- 238000003199 nucleic acid amplification method Methods 0.000 description 16
- 102100039239 Amidophosphoribosyltransferase Human genes 0.000 description 15
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 14
- 229920001817 Agar Polymers 0.000 description 13
- 239000008272 agar Substances 0.000 description 13
- 230000005764 inhibitory process Effects 0.000 description 10
- 108090000623 proteins and genes Proteins 0.000 description 10
- 238000012217 deletion Methods 0.000 description 9
- 230000037430 deletion Effects 0.000 description 9
- 239000001963 growth medium Substances 0.000 description 8
- 101150081163 glnA gene Proteins 0.000 description 7
- 229910052757 nitrogen Inorganic materials 0.000 description 7
- 229930182816 L-glutamine Natural products 0.000 description 6
- 238000010276 construction Methods 0.000 description 6
- 108020004414 DNA Proteins 0.000 description 5
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 4
- 229930006000 Sucrose Natural products 0.000 description 4
- 230000002779 inactivation Effects 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 239000005720 sucrose Substances 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- KWYUFKZDYYNOTN-UHFFFAOYSA-M Potassium hydroxide Chemical compound [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 description 3
- 229940041514 candida albicans extract Drugs 0.000 description 3
- 239000013611 chromosomal DNA Substances 0.000 description 3
- 238000004520 electroporation Methods 0.000 description 3
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 239000012138 yeast extract Substances 0.000 description 3
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 2
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 101100229207 Dictyostelium discoideum glnA3 gene Proteins 0.000 description 2
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 2
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 229910021529 ammonia Inorganic materials 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 210000004027 cell Anatomy 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 238000012136 culture method Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 235000019441 ethanol Nutrition 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 101150019449 glnB gene Proteins 0.000 description 2
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 230000006801 homologous recombination Effects 0.000 description 2
- 238000002744 homologous recombination Methods 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- -1 linoleic acid, alcohols Chemical class 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 238000011218 seed culture Methods 0.000 description 2
- 239000013605 shuttle vector Substances 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 230000005030 transcription termination Effects 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 239000012137 tryptone Substances 0.000 description 2
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- PAWQVTBBRAZDMG-UHFFFAOYSA-N 2-(3-bromo-2-fluorophenyl)acetic acid Chemical compound OC(=O)CC1=CC=CC(Br)=C1F PAWQVTBBRAZDMG-UHFFFAOYSA-N 0.000 description 1
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- ATRRKUHOCOJYRX-UHFFFAOYSA-N Ammonium bicarbonate Chemical compound [NH4+].OC([O-])=O ATRRKUHOCOJYRX-UHFFFAOYSA-N 0.000 description 1
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 1
- 239000004254 Ammonium phosphate Substances 0.000 description 1
- 101100242035 Bacillus subtilis (strain 168) pdhA gene Proteins 0.000 description 1
- 101100350224 Bacillus subtilis (strain 168) pdhB gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241001655326 Corynebacteriales Species 0.000 description 1
- 101100236536 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) glcB gene Proteins 0.000 description 1
- 241000186249 Corynebacterium sp. Species 0.000 description 1
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N DMSO Substances CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 101100465553 Dictyostelium discoideum psmB6 gene Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108010025815 Kanamycin Kinase Proteins 0.000 description 1
- 101100288095 Klebsiella pneumoniae neo gene Proteins 0.000 description 1
- 101100123255 Komagataeibacter xylinus aceC gene Proteins 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 101100063932 Micromonospora echinospora gacH gene Proteins 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 101710141658 Nitrogen regulatory protein P-II Proteins 0.000 description 1
- 108020004485 Nonsense Codon Proteins 0.000 description 1
- 235000021314 Palmitic acid Nutrition 0.000 description 1
- 239000001888 Peptone Substances 0.000 description 1
- 108010080698 Peptones Proteins 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 101100134871 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) aceE gene Proteins 0.000 description 1
- 101100406344 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) aceF gene Proteins 0.000 description 1
- 101100169519 Pyrococcus abyssi (strain GE5 / Orsay) dapAL gene Proteins 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 101100125907 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) ilvC1 gene Proteins 0.000 description 1
- 235000019486 Sunflower oil Nutrition 0.000 description 1
- 102000019197 Superoxide Dismutase Human genes 0.000 description 1
- 108010012715 Superoxide dismutase Proteins 0.000 description 1
- 241000209140 Triticum Species 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- 101150094017 aceA gene Proteins 0.000 description 1
- 101150036393 aceB gene Proteins 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000006154 adenylylation Effects 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 239000001099 ammonium carbonate Substances 0.000 description 1
- 235000012501 ammonium carbonate Nutrition 0.000 description 1
- 235000019270 ammonium chloride Nutrition 0.000 description 1
- 239000000908 ammonium hydroxide Substances 0.000 description 1
- 229910000148 ammonium phosphate Inorganic materials 0.000 description 1
- 235000019289 ammonium phosphates Nutrition 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 239000002518 antifoaming agent Substances 0.000 description 1
- 101150009206 aprE gene Proteins 0.000 description 1
- SCJNCDSAIRBRIA-DOFZRALJSA-N arachidonyl-2'-chloroethylamide Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)NCCCl SCJNCDSAIRBRIA-DOFZRALJSA-N 0.000 description 1
- 101150070136 axeA gene Proteins 0.000 description 1
- 239000013602 bacteriophage vector Substances 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- FPPNZSSZRUTDAP-UWFZAAFLSA-N carbenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C(O)=O)C1=CC=CC=C1 FPPNZSSZRUTDAP-UWFZAAFLSA-N 0.000 description 1
- 229960003669 carbenicillin Drugs 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 239000003240 coconut oil Substances 0.000 description 1
- 235000019864 coconut oil Nutrition 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 239000013601 cosmid vector Substances 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- 101150049887 cspB gene Proteins 0.000 description 1
- 101150041068 cspJ gene Proteins 0.000 description 1
- 101150010904 cspLB gene Proteins 0.000 description 1
- 101150011371 dapA gene Proteins 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- MNNHAPBLZZVQHP-UHFFFAOYSA-N diammonium hydrogen phosphate Chemical compound [NH4+].[NH4+].OP([O-])([O-])=O MNNHAPBLZZVQHP-UHFFFAOYSA-N 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 231100000221 frame shift mutation induction Toxicity 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 101150016365 gntK gene Proteins 0.000 description 1
- 101150092851 gntP gene Proteins 0.000 description 1
- 239000003630 growth substance Substances 0.000 description 1
- 101150090497 ilvC gene Proteins 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 150000002484 inorganic compounds Chemical class 0.000 description 1
- 229910010272 inorganic material Inorganic materials 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229910000358 iron sulfate Inorganic materials 0.000 description 1
- BAUYGSIQEAFULO-UHFFFAOYSA-L iron(2+) sulfate (anhydrous) Chemical compound [Fe+2].[O-]S([O-])(=O)=O BAUYGSIQEAFULO-UHFFFAOYSA-L 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 1
- 235000019341 magnesium sulphate Nutrition 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 235000019796 monopotassium phosphate Nutrition 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 230000037434 nonsense mutation Effects 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 235000014593 oils and fats Nutrition 0.000 description 1
- 101150047779 ompB gene Proteins 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 235000019319 peptone Nutrition 0.000 description 1
- PJNZPQUBCPKICU-UHFFFAOYSA-N phosphoric acid;potassium Chemical compound [K].OP(O)(O)=O PJNZPQUBCPKICU-UHFFFAOYSA-N 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920001522 polyglycol ester Polymers 0.000 description 1
- 101150031507 porB gene Proteins 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 239000013587 production medium Substances 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000008844 regulatory mechanism Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 1
- 229960000268 spectinomycin Drugs 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000002600 sunflower oil Substances 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 239000011573 trace mineral Substances 0.000 description 1
- 235000013619 trace mineral Nutrition 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/93—Ligases (6)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/34—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Corynebacterium (G)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms, e.g. protozoa; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/20—Bacteria; Culture media therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/52—Genes encoding for enzymes or proenzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
- C12N15/77—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for Corynebacterium; for Brevibacterium
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P13/00—Preparation of nitrogen-containing organic compounds
- C12P13/04—Alpha- or beta- amino acids
- C12P13/14—Glutamic acid; Glutamine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y603/00—Ligases forming carbon-nitrogen bonds (6.3)
- C12Y603/01—Acid-ammonia (or amine)ligases (amide synthases)(6.3.1)
- C12Y603/01002—Glutamate-ammonia ligase (6.3.1.2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
- C12R2001/15—Corynebacterium
Definitions
- the present invention relates to a recombinant vector for transformation that improves glutamine-producing ability, and a strain introduced thereto.
- the activity of GS is regulated by glutamine synthetase adenylyltransferase (ATase, glnE).
- ATase regulates the activity of GS by catalyzing adenylation and deadenylation of GS, and is affected by nitrogen concentration in the medium.
- ATase activity is regulated by PII (nitrogen regulatory protein P-II Gene, glnB).
- PII nitrogen regulatory protein P-II Gene, glnB
- Japanese Patent JP4898441 discloses a strain in which glutamine production is increased by suppressing the activities of glnB and glnE genes involved in the reduction of GS activity, but there is still room for improvement.
- Patent Document 0001 Japanese Registration Publication JP 4898441 B2 (2012.01.06)
- a glutamine-producing strain comprising a vector comprising a nucleotide sequence encoding a glutamine synthetase (GS) consisting of the amino acid sequence of SEQ ID NO: 1.
- a vector for transformation comprising a nucleotide sequence encoding a glutamine synthetase (GS) consisting of the amino acid sequence of SEQ ID NO: 1.
- the glutamine synthetase is an enzyme for synthesizing glutamine from glutamate and ammonia. Since the glutamine synthetase having the amino acid sequence of SEQ ID NO: 1 has a lower degree of inhibition of activity by ATase than the glutamine synthetase having other sequences, it is possible to improve glutamine productivity.
- the nucleotide sequence encoding the glutamine synthetase may consist of the nucleotide sequence of SEQ ID NO: 2.
- the glnA gene consisting of the glutamine synthetase consisting of the amino acid sequence of SEQ ID NO: 1 and the nucleotide sequence of SEQ ID NO: 2 is derived from the Corynebacterium glutamicum strain of accession number KFCC10694. It could be According to one embodiment, as a result of comparing the homology of the glnA sequence derived from KFCC10694 to the glnA sequence derived from ATCC13032, which is another Corynebacterium glutamicum strain, the nucleotide sequence homology is 88.2%, the glutamine synthetase expressed therefrom. It was confirmed that the amino acid sequence homology was only 93.7%. Due to this sequence difference, the KFCC10694-derived glutamine synthetase may have a different degree of inhibition of activity by ATase than the glutamine synthetase composed of other sequences.
- the transformation vector may include a promoter operably linked to the nucleotide sequence encoding the glutamine synthetase.
- operably linked means that a gene requiring expression and its regulatory sequence are linked in such a way that they are functionally linked to each other to enable gene expression.
- the promoter may be a constitutive promoter or an inducible promoter.
- the constitutive promoter may be P cspB , P aprE , P 180 , P sod , P dapA , P porB , P ilvC , P L10 , P L26 , P I16 , P I51 , P H30 , P H36 and , the inducible promoter may be P lacUV5 , P tac , P trc , P popB , P aceA/aceB , P gntP/gntK , P CJ1OX2 , P tac-M , P malE1 , P BAD .
- the promoter may be a P sod (superoxide dismutase) promoter.
- the transformation vector may include an expression control sequence such as an enhancer.
- the transformation vector may include a transcription terminator sequence operably linked to the nucleotide sequence encoding the glutamine synthetase.
- the transcription terminator sequence may be an rrnBT1T2 sequence.
- the transformation vector is an antibiotic (eg, neomycin, carbenicillin, kanamycin, spectinomycin or hygromycin, etc.) resistance gene (eg, neomycin phosphotransferase (nptII) or hygromycin) as a selection marker. phosphotransferase (hpt), etc.).
- antibiotic eg, neomycin, carbenicillin, kanamycin, spectinomycin or hygromycin, etc.
- resistance gene eg, neomycin phosphotransferase (nptII) or hygromycin
- hpt phosphotransferase
- the vector includes, but is not limited to, a plasmid vector, a cosmid vector, a bacteriophage vector, a viral vector, and the like.
- the transformed strain may be one in which the native glnA gene is inactivated.
- the term “native” refers to a gene naturally possessed by a microorganism.
- the inactivation refers to a modification on a gene that results in impairment of transcription, translation, or activity of a gene product of a corresponding gene, and may include inactivation of a promoter. Specific inactivation of these genes may be performed through methods established in the art. For example, truncation of a gene by deletion of a gene and insertion of a heterogeneous sequence, nonsense mutation, frameshift mutation, missense mutation, etc. can be performed through methods established in the art. For example, truncation of a gene by deletion of a gene and insertion of a heterogeneous sequence, nonsense mutation, frameshift mutation, missense mutation, etc. can be performed through methods established in the art. For example, truncation of a gene by deletion of a gene and insertion of a heterogeneous sequence, nonsense
- the transformed strain may be an endogenous (native) glnE gene inactivated.
- endogenous glnE gene When the expression of the endogenous glnE gene is reduced or lost, the expression of ATase, which inhibits the activity of glutamine synthetase, is reduced, so that glutamine production ability can be improved.
- the transformed strain may be a Corynebacterium sp. strain, for example, a glutamicum deposited with accession number KFCC10694 ( Corynebacterium glutamicum ) It may be a strain.
- an appropriate vector introduction technique may be selected according to the host cell, as is known in the art.
- vector introduction can be performed by electroporation, heat-shock, calcium phosphate (CaPO4) precipitation, calcium chloride (CaCl2) precipitation, microinjection, polyethylene glycol (PEG) method, DEAE- Dextran method, cationic liposome method, lithium acetate-DMSO method, or a combination thereof can be carried out.
- it provides a glutamine production method comprising the step of culturing the transformed strain.
- the culture may be performed according to an appropriate medium and culture conditions known in the art. In addition, those skilled in the art can easily adjust the medium and culture conditions for use.
- the medium may be a liquid medium, but is not limited thereto.
- the culture method may include, for example, batch culture, continuous culture, fed-batch culture, or a combination culture thereof, but is not limited thereto.
- a culture medium for a Corynebacterial strain may refer to a known literature (Manual of Methods for General Bacteriology. American Society for Bacteriology. Washington D.C., USA, 1981).
- various carbon sources, nitrogen sources and trace elements may be included in the medium.
- carbon sources examples include sugars and carbohydrates such as glucose, sucrose, lactose, fructose, maltose, starch, cellulose, oils and fats such as soybean oil, sunflower oil, castor oil, coconut oil, palmitic acid, Fatty acids such as stearic acid and linoleic acid, alcohols such as glycerol and ethanol, and organic acids such as acetic acid may be included. These substances can be used individually or as a mixture.
- Nitrogen sources that can be used include peptone, yeast extract, broth, malt extract, corn steep liquor, soybean wheat and urea or inorganic compounds, and may include, for example, ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and ammonium nitrate. have.
- the nitrogen sources can also be used individually or as a mixture.
- Sources of phosphorus that may be used may include potassium dihydrogen phosphate or dipotassium hydrogen phosphate or the corresponding sodium-containing salt.
- the culture medium may contain a metal salt such as magnesium sulfate or iron sulfate necessary for growth.
- essential growth substances such as amino acids and vitamins may be included.
- precursors suitable for the culture medium may be used.
- the medium or individual components may be added batchwise or continuously by a method appropriate to the culture medium during the culturing process.
- compounds such as ammonium hydroxide, potassium hydroxide, ammonia, phosphoric acid and sulfuric acid can be added to the microorganism culture in an appropriate manner to adjust the pH of the culture broth.
- an antifoaming agent such as fatty acid polyglycol ester during culture can suppress the formation of bubbles.
- oxygen or oxygen-containing gas eg, air
- the temperature of the culture medium may be usually 20 °C to 45 °C, for example, 25 °C to 40 °C.
- the incubation period may be continued until a desired amount of L-glutamine is produced, and may be, for example, 10 to 160 hours.
- the production method may include recovering L-glutamine from the cultured microorganism or medium.
- the method for recovering the L-glutamine is not particularly limited, and may be recovered using a suitable method known in the art according to the culture method. For example, centrifugation, filtration, anion exchange chromatography, crystallization, HPLC, and the like can be used.
- the glutamine synthetase expressed by the strain according to one embodiment has a low effect on the feedback inhibition by ATase, it is possible to significantly increase the glutamine production.
- FIG. 3 shows a pk19ms/ ⁇ glnE vector according to an embodiment.
- FIG. 4 shows a pa'-glnA (ATCC13032) vector according to an embodiment.
- FIG. 5 shows a pa'-glnA (KFCC10694) vector according to an embodiment.
- Example 1 Construction of a vector for deletion of glnA and glnE genes on the KFCC-10694 chromosome
- the materials used for vector production were Wizard Genomic DNA Purification Kit (Promega, USA), PrimeSTAR Max DNA Polymerase (Takara, Japan), DNA ligation kit (Takara, Japan), HindIII, BamHI (NEB, England).
- PCR was performed with primers 1 and 2 using the chromosomal DNA of the KFCC-10694 strain ( Corynebacterium glutamicum MWM-891020) as a template to obtain the left arm amplification product of glnA of KFCC-10694. Similarly, PCR was performed with a combination of primers 3 and 4 to obtain a right arm amplification product of glnA.
- the left arm and right arm amplification product of glnA was subjected to crossover PCR with a combination of primer 1 and primer 4 to obtain an amplification product in which the left arm and right arm were combined, and inserted into the BamHI position of the pK19mobSacB vector.
- the constructed vector for deletion of glnA was named pK19ms/ ⁇ glnA. (See Fig. 1)
- PCR was performed with a combination of primers 5 and 6 to obtain the left arm amplification product of glnE of KFCC-10694, and PCR was performed with a combination of primers 7 and 8 to determine the right of glnE. arm amplification products were obtained.
- the left arm and right arm amplification products of glnE were amplified by crossover PCR using a combination of primers 5 and 8 to obtain a product in which the left and right arms were combined, which was inserted into the HindIII position of the pK19mobSacB vector.
- the constructed vector for deletion of glnE was named pK19ms/ ⁇ glnE. (See Fig. 2)
- Primer 1 5 g ggatcc atacccaagatggcatgg Primer 2 6 gctggaggatttagatttggtgactcctcattgaca Primer 3 7 tgtcaatgaggagtcaccaaatctaaatcctccagc Primer 4 8 g ggatcc cttaaaaagcttttcgac Primer 5 9 gg aagctt cttgacctgcatgatctcg Primer 6 10 gccaatcgagaacgcatgcccactactttacggtca Primer 7 11 atgaccgtaaagtagtgggcatgcgttctcgattggc Primer 8 12 gg aagctt tacaccaaccacaactgc
- PCR was performed using a combination of primers 9 and 10 to obtain a glnA(AT) amplification product.
- PCR was performed using a combination of primers 11 and 12 with the glnA gene DNA of KFCC10694 as a template to obtain a glnA(KF) amplification product.
- the sod promoter is the first sod promoter amplified product amplified by a combination of primer 13 (forward) and primer 14 (backward) using ATCC13032 chromosomal DNA as a template, and the second amplified by a combination of primer 13 (forward) and primer 15 (backward) Sod promoter amplification product was prepared.
- the reason that the reverse primers were used separately as primers 14 and 15 is because of the difference in the glnA sequence, and the sod promoter sequence is the same. (See gggtaaaaaatcctttcg in Table 2 below)
- the rrnBT1T2 transcription termination factor (terminator) sequence is a first rrnBT1T2 amplification product amplified by a combination of primer 16 (forward) and primer 17 (backward) using E. coli DH5a chromosomal DNA as a template; and a second rrnBT1T2 amplification product amplified by a combination of primer 18 (forward) and primer 17 (backward).
- the reason that the forward primers were used separately as primers 16 and 18 is because of the difference in the glnA sequence, and the sequences of the transcription termination factors are the same. (See agaatttgcctggcggca in Table 2 below)
- crossover PCR using a combination of primer 13 and primer 17 was performed to convert the second sod promoter amplification product, glnA(KF), and the second rrnBT1T2 terminator amplification product into the pa' vector, an E. Coli-Corynebacterium shuttle vector.
- a pa'-glnA (KF) vector was constructed by inserting it into the BamHI position. (See Fig. 5)
- Example 2 Experimental materials used in Example 2 are PrimeSTAR Max DNA Polymerase (Takara, Japan), DNA ligation kit (Takara, Japan), BamHI (NEB, England).
- the nucleotide sequences of the primers 9 to 18 are shown in Table 3 below.
- Example 3 Construction of KFCC10694 strain in which glnA gene and/or glnE gene is deleted
- the pK19ms/ ⁇ glnA vector prepared in Example 1 was introduced into the KFCC10694 strain made of competent cells by electroporation, plated on 2YT KM AGAR medium, and cultured in an incubator at 30° C. for 4 days to obtain colonies. .
- the transformed colonies were cultured in 2YT liquid medium for 12 hours and then plated on 2YT Sucrose GM AGAR medium, and the antibiotic marker was removed through the second homologous recombination. It was finally confirmed whether the glnA gene was removed as intended through PCR and sequencing of the selected colonies.
- the strain in which the glnA gene produced through the above process was deleted was named D10694A.
- a strain in which the glnA and glnE genes were simultaneously deleted was prepared using the pK19ms/ ⁇ glnE vector prepared in Example 1 in the D10694A strain.
- glutamine was added at a concentration of 100 mg/L.
- D10694AE The strain in which both the glnA and glnE genes produced through the above process were deleted was named D10694AE.
- Example 3 The experimental materials used in Example 3 were 2YT AGAR (Tryptone 16g/L, Yeast extract 10g/L, NaCl 5g/L, AGAR 1.5%), 2YT KM AGAR (2YT AGAR, Kanamycine 15mg/L), 2YT Sucrose GM AGAR (2YT AGAR, Sucrose 100g/L, Glutamine 100mg/L), and an electrophorator (BIO-RAD, USA).
- 2YT AGAR Tryptone 16g/L, Yeast extract 10g/L, NaCl 5g/L, AGAR 1.5%)
- 2YT KM AGAR (2YT AGAR, Kanamycine 15mg/L)
- 2YT Sucrose GM AGAR 2YT AGAR, Sucrose 100g/L, Glutamine 100mg/L
- an electrophorator BIO-RAD, USA.
- the pa'-glnA (ATCC13032) vector and pa'-glnA (KFCC10694) vector constructed in Example 2 were introduced into the D10694A and D10694AE strains prepared in Example 3 by electroporation.
- the vector-introduced strains were plated on 2YT KM AGAR medium and cultured for 3 days in an incubator at 30° C. to obtain colonies.
- the strains produced through the above process were named D10694A/pa-glnA(AT), D10694A/pa-glnA(KF), D10694AE/pa-glnA(AT), and D10694AE/pa-glnA(KF).
- Example 4 Experimental materials used in Example 4 were 2YT AGAR (Tryptone 16g/L, Yeast extract 10g/L, NaCl 5g/L, AGAR 1.5%), 2YT KM AGAR (2YT AGAR, Kanamycine 15mg/L), Electrophorator (BIO- RAD, USA).
- 20ml of the seed medium was dispensed into a 500ml Erlenmeyer flask, autoclaved according to a conventional method, and the strain was inoculated and cultured with shaking at 30°C for 24 hours as a seed culture medium.
- 100ml of the production medium was dispensed into a 500ml Erlenmeyer flask, autoclaved according to a conventional method, and 100ml of a pre-prepared seed culture solution was inoculated and cultured with shaking at 30°C for 72 hours.
- 100 mg/L of glutamine was added to the medium.
- the determination of the L-glutamine content in the culture termination solution was quantified by a conventional HPLC method.
- D10694A strain and D10694AE did not produce L-glutamine because glnA (GS expression gene) was deleted.
- D10694A / Pa-glnA (AT) and D10694A / Pa-glnA (KF) in Table 3 D10694A / Pa-glnA (AT) showed a decrease in L-glutamine productivity than the parent KFCC10694, whereas D10694A / Pa -glnA(KF) had improved productivity than the parent strain, KFCC10694. Although both strains introduced the same sod promoter, the productivity was significantly higher when glnA(KF) was introduced than glnA(AT). This suggests that glnA(AT) and glnA(KF) differ in the degree of feedback inhibition.
- D10694AE/Pa-glnA(AT) and D10694AE/Pa-glnA(KF) which does not receive feedback inhibition due to inactivation of ATase
- the D10694AE/Pa-glnA(AT) strain is D10694A/Pa-glnA(AT)
- the productivity was improved by about 1.91%, indicating that there was a large difference depending on the ATase activity.
- the D10694AE/Pa-glnA(KF) strain improved productivity by 0.07% than that of D10694A/Pa-glnA(KF), but the extent was not large, so it could be seen that the difference according to ATase activity was not significant. This means that glnA(KF) has little effect on feedback inhibition by ATase.
- the D10694A / Pa-glnA (KF) strain showed about 47% increased productivity compared to the parental strain
- the D10694AE / Pa-glnA (KF) strain showed about 49% increased productivity compared to the parental strain. It is noteworthy here that the difference in productivity between D10694A/Pa-glnA(KF) and D10694AE/Pa-glnA(KF) was only 2% compared to the parental strain, so it was not large.
- D10694AE/Pa-glnA(KF) additionally deleted the glnE gene involved in GS feedback inhibition, compared to D10694A/Pa-glnA(KF), it showed a productivity improvement of only 2% compared to the parental strain, so ATase activity
- the difference in glutamine productivity according to the presence or absence of glutamine was not significant. This suggests that the productivity increase by glnA(KF) introduction was not simply due to the contribution of the sod promoter, but also contributed to the resistance to the feedback inhibition of glnA(KF).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Tropical Medicine & Parasitology (AREA)
- Virology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
본 발명은 서열번호 1의 아미노산 서열로 이루어진 글루타민합성효소를 암호화하는 염기서열을 포함하는 벡터로 형질전환됨으로서 글루타민 생산성이 향상된 균주에 대한 것이다.
Description
본 발명은 글루타민 생산능을 향상시키는 형질전환용 재조합 벡터 및 이를 도입한 균주에 관한 것이다.
GS의 활성은 글루타민합성효소 아데닐릴트랜스퍼라제(glutamine synthetase adenylyltransferase, ATase, glnE)에 의해 조절된다. ATase는 GS의 아데닐화(adenylylation)와 탈아데닐화(deadenylation)를 촉매하여 GS의 활성을 조절하며, 배지내 질소농도의 영향을 받는다. ATase의 활성은 PII(nitrogen regulatory protein P-II Gene, glnB)에 의해 조절된다. 도 1을 참조하면, 질소농도가 높으면 PII와 ATase의 활성화에 의해 GS의 활성이 저하되는 기전이 개시되어 있다. 따라서, 글루타민을 생산하기 위해서 질소원을 공급하면, 공급된 질소원에 의해 GS의 활성이 되먹임 저하(feedback inhibition)되어 글루타민 생산이 저하되는 문제가 있다.
따라서 글루타민 생산 효율을 증가시키기 위해서는 ATase에 의한 GS 의 되먹임 저하를 억제하는 것이 요구된다. 일본특허 JP4898441에 따르면 GS 활성 저하에 관여하는 glnB 및 glnE 유전자의 활성을 억제함으로서 글루타민 생산이 증가된 균주를 개시하고 있으나, 개선의 여지는 여전히 남아있다.
[선행기술문헌]
(특허문헌 0001) 일본 등록공보 JP 4898441 B2 (2012.01.06)
일 구체예에 따르면 서열번호 1의 아미노산 서열로 이루어진 글루타민합성효소(glutamine synthetase, GS)를 암호화하는 염기서열을 포함하는 벡터를 포함하는 글루타민 생산 균주를 제공한다.
일 양상에 따르면, 서열번호 1의 아미노산 서열로 이루어진 글루타민합성효소(glutamine synthetase, GS)를 암호화하는 염기서열을 포함하는 형질전환용 벡터를 제공한다.
상기 글루타민합성효소는 글루타메이트(glutamate)와 암모니아로부터 글루타민을 합성하는 효소이다. 상기 서열번호 1의 아미노산 서열로 이루어진 글루타민합성효소는 다른 서열로 이루어진 글루타민합성효소보다 ATase에 의해 활성이 억제되는 정도가 낮기 때문에 글루타민 생산성을 향상시킬 수 있다.
일 구체예에 따르면, 상기 글루타민합성효소를 암호화하는 염기서열은 서열번호 2의 염기서열로 이루어진 것일 수 있다.
일 구체예에 따르면, 상기 서열번호 1의 아미노산 서열로 이루어진 글루타민합성효소 및 상기 서열번호 2의 염기서열로 이루어진 glnA 유전자는 기탁번호 KFCC10694의 코리네박테리움 글루타미컴(
Corynebacterium glutamicum) 균주에서 유래한 것일 수 있다. 일 실시예에 따르면, 상기 KFCC10694 유래 glnA 서열은 다른 코리네박테리움 글루타미컴 균주인 ATCC13032 유래 glnA 서열의 상동성을 비교한 결과, 염기서열 상동성이 88.2%, 이로부터 발현한 글루타민합성효소의 아미노산 서열 상동성이 93.7%에 불과한 것으로 확인되었다. 이러한 서열 차이로 인해 KFCC10694 유래 글루타민합성효소는 다른 서열로 이루어진 글루타민합성효소보다 ATase에 의해 활성이 억제되는 정도에서 차이가 있을 수 있다.
일 구체예에 따르면, 상기 형질전환용 벡터는 상기 글루타민합성효소를 암호화하는 염기서열과 작동가능하게 연결된 프로모터를 포함하는 것일 수 있다. 용어 "작동가능하게 연결되어 있는 (operably linked)"는 발현이 필요한 유전자와 이의 조절 서열이 서로 기능적으로 결합되어 유전자 발현을 가능케 하는 방식으로 연결된 것을 의미한다. 상기 프로모터에 의해 GS의 발현량이 증가하면 ATase에 의한 억제가 저해되어 글루타민 생산성이 향상될 수 있다. 상기 프로모터는 구성적(constitutive) 프로모터 또는 유도성(inducible) 프로모터일 수 있다. 예를 들면, 상기 구성적 프로모터는 P
cspB, P
aprE, P
180, P
sod, P
dapA, P
porB, P
ilvC, P
L10, P
L26, P
I16, P
I51, P
H30, P
H36일 수 있으며, 유도성 프로모터는 P
lacUV5, P
tac, P
trc, P
popB, P
aceA/aceB, P
gntP/gntK, P
CJ1OX2, P
tac-M, P
malE1, P
BAD일 수 있다. 일 실시예에 따르면, 상기 프로모터는 P
sod(superoxide dismutase) 프로모터일 수 있다. 상기 형질전환용 벡터는 인핸서(enhancer)와 같은 발현 조절 서열을 포함할 수 있다.
일 구체예에 따르면, 상기 형질전환용 벡터는 상기 글루타민합성효소를 암호화하는 염기서열과 작동가능하게 연결된 전사종결인자 서열을 포함하는 것일 수 있다. 일 실시예에 따르면, 상기 전사종결인자 서열은 rrnBT1T2 서열일 수 있다.
상기 형질전환용 벡터는 선택 표지로서 항생제(예컨대, 네오마이신, 카베니실린, 카나마이신, 스펙티노마이신 또는 하이그로마이신 등) 내성 유전자(예컨대, 네오마이신 포스포트랜스퍼라아제(nptⅡ) 또는 하이그로마이신 포스포트랜스퍼라아제(hpt) 등)를 포함할 수 있다.
상기 벡터는 플라스미드 벡터, 코즈미드 벡터, 박테리오파아지 벡터, 바이러스 벡터 등을 포함하나 이에 한정되는 것은 아니다.
다른 양상에 의하면, 상기 형질전환용 벡터로 형질전환된 균주를 제공한다.
일 구체예에 따르면, 상기 형질전환된 균주는 내생(native) glnA 유전자가 불활성화된 것일 수 있다. 용어 "내생(native)"는 미생물이 천연적으로 가지고 있는 유전자를 의미한다. 상기 불활성화(inactivation)은 해당 유전자의 전사, 해독, 유전자 산물의 활성의 손상을 초래하는 유전자 상의 변형을 의미하며, 프로모터의 불활성화도 포함될 수 있다. 이러한 유전자의 특이적 불활성화는 당 분야에서 확립된 방법을 통하여 수행할 수 있다. 예를 들면, 유전자의 결실 및 이형 서열(heterogenous sequence)의 삽입에 의한 유전자의 절단(truncation), 넌센스 돌연변이(nonsense mutation), 프레임쉬프트 돌연변이(frameshift mutation), 미스센스 돌연변이(missense mutation) 등에 의할 수 있다.
일 구체예에 따르면, 상기 형질전환된 균주는 내생(native) glnE 유전자가 불활성화된 것일 수 있다. 상기 내생 glnE 유전자의 발현이 저하 또는 상실되면 글루타민합성효소의 활성을 저해하는 ATase의 발현이 감소하므로 글루타민 생산능이 향상될 수 있다.
일 구체예에 따르면, 상기 형질전환된 균주는 코리네박테리움속 균주일 수 있으며, 예를 들면 기탁번호 KFCC10694로 기탁된 글루타미컴(
Corynebacterium glutamicum) 균주일 수 있다.
상기 형질전환은 당해 분야에 공지된 바와 같이 숙주 세포에 따라 적합한 벡터 도입 기술을 선택할 수 있다. 예를 들면, 벡터 도입은 전기천공법 (electroporation), 열 충격 (heat-shock), 인산칼슘 (CaPO4) 침전, 염화칼슘 (CaCl2) 침전, 미세주입법 (microinjection), 폴리에틸렌글리콜 (PEG)법, DEAE-덱스트란법, 양이온 리포좀법, 초산 리튬-DMSO법, 또는 이들의 조합에 의해 수행될 수 있다.
또 다른 양상에 따르면, 상기 형질전환된 균주를 배양하는 단계를 포함하는 글루타민 생산방법을 제공한다.
상기 배양은 당업계에 알려진 적절한 배지와 배양조건에 따라 이루어질 수 있다. 또한 통상의 기술자라면 배지 및 배양 조건을 용이하게 조정하여 사용할 수 있다. 구체적으로, 상기 배지는 액체 배지일 수 있으나 이에 한정되는 것은 아니다. 배양 방법은 예를 들면, 회분식 배양 (batch culture), 연속식 배양 (continuous culture), 유가식 배양 (fed-batch culture) 또는 이들의 조합 배양을 포함할 수 있으나, 이에 한정되지 않는다.
상기 배지는 적절한 방식으로 특정 균주의 요건을 충족해야 하며, 통상의 기술자에 의해 적절하게 변형될 수 있다. 예를 들면, 코리네박테리아 균주에 대한 배양 배지는 공지된 문헌 (Manual of Methods for General Bacteriology. American Society for Bacteriology. Washington D.C., USA, 1981)을 참조할 수 있다. 또한 배지에 다양한 탄소원, 질소원 및 미량원소 성분을 포함할 수 있다. 사용될 수 있는 탄소원의 예를 들면 글루코스, 수크로스, 락토스, 프락토스, 말토스, 전분, 셀룰로스와 같은 당 및 탄수화물, 대두유, 해바라기유, 피마자유, 코코넛유 등과 같은 오일 및 지방, 팔미트산, 스테아린산, 리놀레산과 같은 지방산, 글리세롤, 에탄올과 같은 알코올, 아세트산과 같은 유기산이 포함될 수 있다. 이들 물질은 개별적으로 또는 혼합물로서 사용될 수 있다. 사용될 수 있는 질소원으로는 펩톤, 효모 추출물, 육즙, 맥아 추출물, 옥수수 침지액, 대두밀 및 요소 또는 무기 화합물이 있고, 예를 들면 황산 암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄이 포함될 수 있다. 질소원 또한 개별적으로 또는 혼합물로서 사용할 수 있다. 사용될 수 있는 인의 공급원으로는 인산이수소칼륨 또는 인산수소이칼륨 또는 상응하는 나트륨-함유 염이 포함될 수 있다. 배양 배지는 성장에 필요한 황산마그네슘 또는 황산철과 같은 금속염을 함유할 수 있다. 그 외에, 아미노산 및 비타민과 같은 필수 성장 물질이 포함될 수 있다. 또한 배양 배지에 적절한 전구체들이 사용될 수 있다. 상기 배지 또는 개별 성분은 배양과정에서 배양액에 적절한 방식에 의해 회분식으로 또는 연속식으로 첨가될 수 있다.
배양 중에 수산화암모늄, 수산화칼륨, 암모니아, 인산 및 황산과 같은 화합물을 미생물 배양액에 적절한 방식으로 첨가하여 배양액의 pH를 조정할 수 있다. 또한, 배양 중에 지방산 폴리글리콜 에스테르와 같은 소포제를 사용하여 기포 생성을 억제할 수 있다. 추가적으로, 배양액의 호기 상태를 유지하기 위하여, 배양액 내로 산소 또는 산소-함유 기체 (예, 공기)를 주입할 수 있다. 배양액의 온도는 통상 20℃내지 45℃ 예를 들면 25℃ 내지 40℃일 수 있다. 배양기간은 원하는 양의 L-글루타민이 생성될 때까지 지속될 수 있으며, 예를 들면 10 내지 160 시간일 수 있다.
상기 생산방법은 배양한 미생물 또는 배지로부터 L-글루타민을 회수하는 단계를 포함할 수 있다. 상기 L-글루타민을 회수하는 방법은 특별히 한정되는 것은 아니며, 배양방법에 따라 당해 분야에 공지된 적합한 방법을 이용하여 회수될 수 있다. 예를 들면 원심분리, 여과, 음이온 교환 크로마토그래피, 결정화, HPLC 등이 사용될 수 있다.
일 구체예에 따른 균주가 발현하는 글루타민합성효소는 ATase에 의한 되먹임 억제에 대한 영향이 낮으므로 글루타민 생산량을 현저히 증가시킬 수 있다.
도 1은 글루타민합성효소 활성의 조절 기전을 나타낸 것이다.
도 2는 일 실시예에 따른 pk19ms/△glnA 벡터를 나타낸 것이다.
도 3은 일 실시예에 따른 pk19ms/△glnE 벡터를 나타낸 것이다.
도 4는 일 실시예에 따른 pa'-glnA(ATCC13032) 벡터를 나타낸 것이다.
도 5는 일 실시예에 따른 pa'-glnA(KFCC10694) 벡터를 나타낸 것이다.
이하 하나 이상의 구체예를 실시예를 통해 보다 상세하게 설명한다. 그러나, 이들 실시예는 하나 이상의 구체예를 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
실시예 1: KFCC-10694 염색체 상의 glnA, glnE 유전자 결손용 벡터 제작
벡터 제작에 사용한 재료는 Wizard Genomic DNA Purification Kit (Promega, USA), PrimeSTAR Max DNA Polymerase (Takara, Japan), DNA ligation kit (Takara, Japan), HindIII, BamHI(NEB, England)를 사용하였다.
1-1. glnA 결실용 벡터 제작
KFCC-10694 균주(
Corynebacterium glutamicum MWM-891020)의 염색체 DNA를 주형으로 프라이머 1 및 프라이머 2로 PCR을 실시하여 KFCC-10694의 glnA의 left arm 증폭산물을 얻었다. 마찬가지로 프라이머 3 및 프라이머 4의 조합으로 PCR을 실시하여 glnA의 right arm 증폭 산물을 얻었다.
상기 glnA의 left arm과 right arm 증폭 산물을 프라이머 1 및 프라이머 4 조합으로 크로스오버 PCR을 실시하여 left arm과 right arm이 결합된 증폭산물을 얻고, pK19mobSacB 벡터의 BamH I 위치에 삽입하였다. 제작된 glnA 결실용 벡터는 pK19ms/△glnA로 명명하였다. (도 1 참조)
1-2. glnE 결실용 벡터 제작
상기 glnA 결실용 벡터와 동일한 방법으로, 프라이머 5와 프라이머 6의 조합으로 PCR을 실시하여 KFCC-10694의 glnE의 left arm 증폭 산물을 얻고, 프라이머 7과 프라이머 8의 조합으로 PCR을 실시하여 glnE의 right arm 증폭 산물을 얻었다.
상기 glnE의 left arm과 right arm 증폭 산물을 프라이머 5와 프라이머 8의 조합을 이용한 크로스오버 PCR로 증폭하여 left arm과 right arm이 결합된 산물을 얻고, 이를 pK19mobSacB 벡터의 HindIII위치에 삽입하였다. 제작된 glnE 결실용 벡터는 pK19ms/△glnE로 명명하였다. (도 2 참조)
상기 KFCC-10694의 glnA, KFCC-10694의 glnE, 프라이머 1 내지 8의 염기서열에 대한 정보는 하기 표 1에 개시되어 있다.
프라이머 | 서열목록 | 서열 (5’→3’) |
Primer 1 | 5 | g ggatccatacccaagatggcatgg |
Primer 2 | 6 | gctggaggatttagatttggtgactcctcattgaca |
Primer 3 | 7 | tgtcaatgaggagtcaccaaatctaaatcctccagc |
Primer 4 | 8 | g ggatcccttaaaaagcttttcgac |
Primer 5 | 9 | gg aagcttcttgacctgcatgatctcg |
Primer 6 | 10 | gccaatcgagaacgcatgcccactactttacggtca |
Primer 7 | 11 | atgaccgtaaagtagtgggcatgcgttctcgattggc |
Primer 8 | 12 | gg aagctttacaccaaccacaactgc |
실시예 2: glnA 과발현 벡터 2종 제작
ATCC13032의 glnA 유전자 DNA를 주형으로 프라이머 9 및 프라이머 10 조합으로 PCR을 실시하여 glnA(AT) 증폭산물을 얻었다.
이와 별개로, KFCC10694의 glnA 유전자 DNA를 주형으로 프라이머 11 및 프라이머 12를 조합으로 PCR을 실시하여 glnA(KF)증폭산물을 얻었다.
상기 glnA(AT)와 glnA(KF)의 상동성을 확인한 결과, 염기서열 상동성이 88.2%, 아미노산 서열 상동성이 93.7%에 불과한 것으로 확인되었다. glnA(AT)와 glnA(KF)의 아미노산 서열과 염기서열은 하기 표 2에 기재되어 있다.
목록 | 서열목록 | 서열정보 |
KFCC10694
GS 아미노산 |
1 | vafntpeeivkfikdenvefvdvrftdvpgteqhfsipaalfdeeaieeglafdgssirgfttidesdmnllpdlgtatidpfrkaktlnikffvhdpftreafsrdprnvarkaeqylastgiadtcnfgaeaefylfdsvrystdinssfyhvdtnegwwnrgretnldgtpnlgaknrvkggyfpvapydqtveirddmvnylsnagfqlerfhhevgggqqeinyrfntmlhaaddiqtfkyiikntahlhgktatfmpkplagdngsgmhahqslwkdgkplfhdesgyaglsdiaryyiggilhhagavlaftnptlnsyhrlvpgfeapinlvysqrnrsaavripitgsnpkakriefrapdpsgnpyfgfaammmagldgiknriephapvdkdlyelppeeaasipqaptsleaslkalqedsdfltesdvftedliesyiqykydneitpvrlrptpqefemyfdc |
KFCC10694 glnA 염기 | 2 | gtggcgtttaataccccggaagaaatagtcaagttcatcaaagacgagaacgtcga
attcgtagacgttcgcttcaccgatgtaccaggaactgaacagcacttcagcatcc cagccgccctcttcgatgaagaggccatcgaagaaggcctagcattcgacggatcc tcgatccgcggattcaccaccatcgatgagtctgacatgaacctcctaccagacct cggaactgccaccattgacccgttccgcaaggccaagactctgaacatcaagttct tcgttcatgatccattcacccgcgaagctttctcccgcgacccacgcaatgtggca cgcaaggcagagcagtacctcgcctccaccggcattgcagatacctgcaacttcgg cgcagaagccgagttctacctctttgattcagtccgctactccaccgatattaact ccagcttctaccacgttgataccaatgaaggctggtggaaccgtggccgggaaacc aaccttgatggcaccccaaaccttggcgccaagaaccgtgtcaagggcggatactt ccctgttgcaccatatgaccaaaccgtggaaatccgcgatgatatggtcaactacc tctcaaacgctggtttccaacttgagcgtttccaccacgaggtcggcggtggacag caggagatcaactaccgcttcaacaccatgctgcacgcggctgatgatattcagac attcaagtacatcatcaagaacaccgctcacctccacggcaagaccgcaaccttta tgcctaagccactggctggcgacaacggctctggaatgcacgcacaccagtcccta tggaaggacggcaagccactcttccacgatgagtccggttacgcaggcctatctga catcgcccgctactacattggtggcatcctgcaccacgcaggtgcagtattggcgt tcaccaacccaaccctgaactcctaccaccgtttagttcctggcttcgaggcgcca atcaacttggtgtactcccagcgcaaccgctctgctgctgtacgtatcccaatcac cggatccaacccaaaggcaaagcgcatcgagttccgcgctccggacccatcaggca acccatacttcggcttcgctgccatgatgatggctggccttgacggcatcaagaac cgcatcgagccacacgcaccagtggataaggatctctacgagcttccaccagagga agctgcctccatcccacaggctccaacctcccttgaagcttcattgaaggctcttc aggaagattccgacttcctcaccgagtctgatgtcttcaccgaagatctcatcgag tcctacatccagtacaagtacgacaacgagatcaccccagtccgtttgcgcccaac tcctcaagagttcgaaatgtacttcgactgctaa |
ATCC13032 GS 아미노산 | 3 | vafetpeeivkfikdenvefvdvrftdlpgteqhfsipaasfdadtieeglafdgssirgfttidesdmnllpdlgtatldpfrkaktlnvkffvhdpftreafsrdprnvarkaeqylastgiadtcnfgaeaefylfdsvrystemnsgfyevdteegwwnrgketnldgtpnlgaknrvkggyfpvapydqtvdvrddmvrnlaasgfalerfhhevgggqqeinyrfntmlhaaddiqtfkyiikntarlhgkaatfmpkplagdngsgmhahqslwkdgkplfhdesgyaglsdiaryyiggilhhagavlaftnatlnsyhrlvpgfeapinlvysqrnrsaavripitgsnpkakriefrapdpsgnpylgfaammmagldgiknriephapvdkdlyelppeeaasipqaptsleaslkalqedtdfltesdvftedlieayiqykydneispvrlrptpqefelyfdc |
ATCC13032 glnA 염기 | 4 | gtggcgtttgaaaccccggaagaaattgtcaagttcatcaaggatgaaaacgtcga
gttcgttgacgttcgattcaccgaccttcccggcaccgagcagcacttcagcatcc cagctgccagcttcgatgcagatacaatcgaagaaggtctcgcattcgacggatcc tcgatccgtggcttcaccacgatcgacgaatctgacatgaatctcctgccagacct cggaacggccacccttgatccattccgcaaggcaaagaccctgaacgttaagttct tcgttcacgatcctttcacccgcgaggcattctcccgcgacccacgcaacgtggca cgcaaggcagagcagtacctggcatccaccggcattgcagacacctgcaacttcgg cgccgaggctgagttctacctcttcgactccgttcgctactccaccgagatgaact ccggcttctacgaagtagataccgaagaaggctggtggaaccgtggcaaggaaacc aacctcgacggcaccccaaacctgggcgcaaagaaccgcgtcaagggtggctactt cccagtagcaccatacgaccaaaccgttgacgtgcgcgatgacatggttcgcaacc tcgcagcttccggcttcgctcttgagcgtttccaccacgaagtcggtggcggacag caggaaatcaactaccgcttcaacaccatgctccacgcggcagatgatatccagac cttcaagtacatcatcaagaacaccgctcgcctccacggcaaggctgcaaccttca tgcctaagccactggctggcgacaacggttccggcatgcacgctcaccagtccctc tggaaggacggcaagccactcttccacgatgagtccggctacgcaggcctgtccga catcgcccgctactacatcggcggcatcctgcaccacgcaggcgctgttctggcgt tcaccaacgcaaccctgaactcctaccaccgtctggttccaggcttcgaggctcca atcaacctggtgtactcacagcgcaaccgttccgctgctgtccgtatcccaatcac cggatccaacccgaaggcaaagcgcatcgaattccgcgctccagacccatcaggca acccatacctgggctttgcagcgatgatgatggccggcctcgacggcatcaagaac cgcatcgagccacacgctccagtggacaaggacctctacgaactaccaccagagga agctgcatccattccacaggcaccaacctccctggaagcatccctgaaggcactgc aggaagacaccgacttcctcaccgagtctgacgtcttcaccgaggatctcatcgag gcgtacatccagtacaagtacgacaacgagatctccccagttcgcctgcgcccaac cccgcaggaattcgaattgtacttcgactgctaa |
sod 프로모터는 ATCC13032 염색체 DNA를 주형으로 프라이머 13(forward)과 프라이머 14(backward)의 조합으로 증폭한 제 1 sod 프로모터 증폭산물, 프라이머 13(forward)과 프라이머 15(backward)의 조합으로 증폭한 제 2 sod 프로모터 증폭산물을 제작하였다. 역방향 프라이머를 프라이머 14 및 15로 구별하여 사용한 이유는 glnA 서열 차이 때문이며, sod 프로모터 서열은 동일하다.(하기 표 2의 gggtaaaaaatcctttcg 참조)
rrnBT1T2 전사종결인자(터미네이터) 서열은 대장균 DH5a 염색체 DNA를 주형으로 하여 프라이머 16(forward)과 프라이머 17(backward)의 조합으로 증폭한 제 1 rrnBT1T2 증폭산물; 및 프라이머 18(forward) 및 프라이머 17(backward)의 조합으로 증폭한 제 2 rrnBT1T2 증폭산물을 얻었다. 정방향 프라이머를 프라이머 16 및 18로 구별하여 사용한 이유는 glnA 서열 차이 때문이며, 전사종결인자의 서열은 동일하다. (하기 표 2의 agaatttgcctggcggca 참조)
프라이머 13과 프라이머 17의 조합을 이용한 크로스오버 PCR을 실시하여 상기 제 1 sod 프로모터 증폭산물, glnA(AT), 및 제 1 rrnBT1T2 터미네이터 증폭산물을 E. Coli-Corynebacterium 셔틀벡터인 pa'벡터 내 BamHI 위치에 삽입하여 pa'-glnA(AT) 벡터를 제작하였다. (도 4 참조)
마찬가지로, 프라이머 13과 프라이머 17의 조합을 이용한 크로스오버 PCR을 실시하여 상기 제 2 sod 프로모터 증폭산물, glnA(KF), 및 제 2 rrnBT1T2 터미네이터 증폭산물을 E. Coli-Corynebacterium 셔틀벡터인 pa'벡터 내 BamHI 위치에 삽입하여 pa'-glnA(KF) 벡터를 제작하였다. (도 5 참조)
실시예 2에서 사용된 실험 재료는 PrimeSTAR Max DNA Polymerase (Takara, Japan), DNA ligation kit (Takara, Japan), BamHI(NEB, England)이다.
상기 프라이머 9 내지 18의 염기서열은 하기 표 3에 개시되어 있다.
프라이머 | 서열목록 | 서열 (5’→3’) |
Primer 9 | 13 | cgaaaggattttttacccgtggcgtttgaaaccccg |
Primer 10 | 14 | tgccgccaggcaaattctttagcagtcgaagtacaa |
Primer 11 | 15 | cgaaaggattttttacccgtggcgtttaataccccgg |
Primer 12 | 16 | ctgccgccaggcaaattctttagcagtcgaagtacat |
Primer 13 | 17 | gggatccagctgccaattattccggg |
Primer 14 | 18 | cggggtttcaaacgccac gggtaaaaaatcctttcg |
Primer 15 | 19 | ccggggtattaaacgccac gggtaaaaaatcctttcg |
Primer 16 | 20 | ttgtacttcgactgctaa agaatttgcctggcggca |
Primer 17 | 21 | gggatccttcgttttatttgatgcc |
Primer 18 | 22 | atgtacttcgactgctaa agaatttgcctggcggcag |
실시예 3:
glnA 유전자 및/또는 glnE유전자가 결손된 KFCC10694 균주 제작
컴피턴트 세포로 만들어진 KFCC10694 균주에 상기 실시예 1에서 제작된 pK19ms/△glnA 벡터를 전기충격요법(electroporation)으로 도입하고, 2YT KM AGAR 배지에 도말 후, 30℃ 배양기에서 4일간 배양하여 콜로니를 얻었다. 1차 상동재조합이 유도된 콜로니 중 형질전환이 확인된 콜로니를 2YT액체배지에서 12시간 배양후 2YT Sucrose GM AGAR배지에 도말하고 2차 상동재조합을 통해 항생제 마커를 제거하였다. 선별된 콜로니를 PCR 및 서열분석을 통해 glnA 유전자가 의도대로 제거 되었는지를 최종확인 하였다. 상기 과정을 통해 제작된 glnA 유전자가 결손된 균주를 D10694A로 명명하였다.
동일한 방법으로, 상기 D10694A균주에 상기 실시예 1에서 제작한 pK19ms/△glnE벡터를 사용하여 glnA와 glnE유전자가 동시에 결손된 균주를 제작하였다. 본 실험에 사용된 배지에는 glutamine을 100mg/L의 농도로 첨가하여 사용하였다. 상기 과정을 통해 제작된 glnA 및 glnE 유전자가 모두 결손된 균주를 D10694AE로 명명하였다.
상기 실시예 3에서 사용된 실험 재료는 2YT AGAR (Tryptone 16g/L, Yeast extract 10g/L, NaCl 5g/L, AGAR 1.5%), 2YT KM AGAR (2YT AGAR, Kanamycine 15mg/L), 2YT Sucrose GM AGAR(2YT AGAR, Sucrose 100g/L, Glutamine 100mg/L), electrophorator(BIO-RAD, USA) 이다.
실시예 4: pa'-glnA(AT) 벡터 또는 pa'-glnA(KF) 벡터 도입 균주 제작
실시예 2에서 제작된 pa'-glnA(ATCC13032) 벡터, pa'-glnA(KFCC10694) 벡터를 상기 실시예 3에서 제작한 D10694A 및 D10694AE 균주에 전기충격요법 (electroporation)으로 도입하였다. 벡터를 도입한 균주들을 2YT KM AGAR 배지에 도말하고 30℃ 배양기에서 3일간 배양하여 콜로니를 얻었다. 상기 과정을 통해 제작된 균주들을 D10694A/pa-glnA(AT), D10694A/pa-glnA(KF), D10694AE/pa-glnA(AT), D10694AE/pa-glnA(KF) 로 명명하였다.
실시예 4에서 사용된 실험 재료는 2YT AGAR (Tryptone 16g/L, Yeast extract 10g/L, NaCl 5g/L, AGAR 1.5%), 2YT KM AGAR (2YT AGAR, Kanamycine 15mg/L), Electrophorator(BIO-RAD, USA)이다.
실시예 5: 실시예 4에서 제작된 균주의 글루타민 생산성 확인
종배지 20ml를 500ml 삼각 플라스크에 분주하여 통상의 방법에 따라 가압 멸균한 후 균주를 접종하여 30℃에서 24 시간 동안 진탕배양한 것을 종균배양액으로 하였다. 생산배지 100ml를 500ml 삼각 플라스크에 분주하여 통상의 방법에 따라 가압 멸균한 후 미리 준비한 종균배양액 100ml를 접종하여 30℃에서 72시간 진탕 배양 하였다. D10694A와 D10694AE균주에 대한 생산성 비교에는 배지에 100mg/L의 글루타민을 첨가하였다. 배양 종료액에서의 L-글루타민 함량의 결정은 통상의 HPLC법으로 정량하였다.
글루타민 생산성 실험결과는 하기 표 4에 기재되어 있다.
균주명 | OD(1/100) | △(L-GLN(%)) |
KFCC10694 | 0.256 | 3.56 |
D10694A (glnA 결손) | 0.135 | n.d. |
D10694AE (glnA 및 glnE 결손) | 0.185 | n.d. |
D10694A/Pa-glnA(AT) | 0.138 | 1.97 |
D10694A/Pa-glnA(KF) | 0.202 | 5.24 |
D10694AE/Pa-glnA(AT) | 0.209 | 3.88 |
D10694AE/Pa-glnA(KF) | 0.217 | 5.31 |
상기 표 3의 실험결과에 따르면, D10694A 균주 및 D10694AE는 glnA(GS 발현 유전자)가 결손되어 L-글루타민이 생산되지 않았다.
상기 표 3의 D10694A/Pa-glnA(AT)와 D10694A/Pa-glnA(KF)의 글루타민 생산을 살펴보면, D10694A/Pa-glnA(AT)는 모주인 KFCC10694보다 L-글루타민 생산성이 감소한 반면 D10694A/Pa-glnA(KF)는 모주인 KFCC10694보다 생산성이 향상되었다. 양균주는 동일한 sod 프로모터를 도입하였음에도 불구하고, glnA(AT)보다 glnA(KF)를 도입한 경우 생산성이 현저히 높았다. 이는 glnA(AT)와 glnA(KF)는 되먹임 억제 정도에서 차이가 있음을 시사한다.
ATase가 불활성화되어 되먹임 억제를 받지 않는 D10694AE/Pa-glnA(AT)와 D10694AE/Pa-glnA(KF)의 글루타민 생산을 살펴보면, D10694AE/Pa-glnA(AT) 균주는 D10694A/Pa-glnA(AT)보다 생산성이 약 1.91% 향상되었으므로 ATase 활성 여부에 따른 차이가 크다는 것을 알 수 있었다. 그러나, D10694AE/Pa-glnA(KF) 균주는 D10694A/Pa-glnA(KF)보다 생산성이 0.07% 향상되었으나 그 정도는 크지 않았으므로 ATase 활성 여부에 따른 차이가 크지 않다는 것을 알 수 있었다. 이는 glnA(KF)는 ATase에 의한 되먹임 억제의 영향이 적다는 것을 의미한다.
보다 자세히 살펴보면, D10694A/Pa-glnA(KF) 균주는 모주 대비 약 47% 증가된 생산성을 나타내었으며, D10694AE/Pa-glnA(KF) 균주는 모주 대비 약 49% 증가된 생산성을 나타내었다. 여기서 주목할 것은, D10694A/Pa-glnA(KF)와 D10694AE/Pa-glnA(KF)의 생산성 차이가 모주 대비 2%에 불과하여 크지 않았다는 점이다. D10694AE/Pa-glnA(KF)는 D10694A/Pa-glnA(KF)보다 GS의 되먹임 저해에 관여하는 glnE유전자를 추가적으로 결손시켰음에도 불구하고, 모주 대비 단 2%의 생산성 향상을 나타내었으므로, ATase 활성의 유무에 따른 글루타민 생산성 차이가 크지 않은 것이다. 이는 glnA(KF) 도입에 의한 생산성 증가는 단순히 sod 프로모터의 기여에 의한 것만 아니라 glnA(KF)의 되먹임 저해에 대한 저항이 기여하였음을 시사한다.
Claims (8)
- 서열번호 1의 아미노산 서열로 이루어진 글루타민합성효소를 암호화하는 염기서열을 포함하는 형질전환용 벡터.
- 제1항에 있어서,상기 글루타민합성효소를 암호화하는 염기서열은 서열번호 2의 염기서열로 이루어진 것인,형질전환용 벡터.
- 제1항에 있어서,상기 형질전환용 벡터는 상기 글루타민합성효소를 암호화하는 염기서열과 작동가능하게 연결된 프로모터를 포함하는 것인,형질전환용 벡터.
- 제1항에 있어서,상기 형질전환용 벡터는 상기 글루타민합성효소를 암호화하는 염기서열과 작동가능하게 연결된 전사종결인자 서열을 포함하는 것인,형질전환용 벡터.
- 제1항의 형질전환용 벡터로 형질전환된 균주.
- 제5항에 있어서,상기 균주는 내생 glnE 유전자의 발현이 불활성화된 것인,균주.
- 제5항에 있어서,상기 균주는 코리네박테리움 글루타미컴( Corynebacterium glutamicum)인,균주.
- 제5항의 균주를 배양하는 단계를 포함하는,글루타민 생산 방법.
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/916,331 US20230220430A1 (en) | 2020-03-30 | 2021-03-24 | Recombinant vector for transformation improving glutamine productivity, and strain employing same |
CN202180026206.XA CN115349012B (zh) | 2020-03-30 | 2021-03-24 | 用于进行提高谷氨酰胺生产力的转化的重组载体和使用其的菌株 |
JP2022560115A JP7415041B2 (ja) | 2020-03-30 | 2021-03-24 | グルタミン生産能を向上させる形質転換用組換えベクターおよびこれを導入した菌株 |
EP21780977.1A EP4130255A4 (en) | 2020-03-30 | 2021-03-24 | RECOMBINANT TRANSFORMATION VECTOR TO IMPROVE GLUTAMINE PRODUCTIVITY AND STRAIN THEREFOR |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020200038628A KR102216450B1 (ko) | 2020-03-30 | 2020-03-30 | 글루타민 생산능을 향상시키는 형질전환용 재조합 벡터 및 이를 도입한 균주 |
KR10-2020-0038628 | 2020-03-30 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2021201489A1 true WO2021201489A1 (ko) | 2021-10-07 |
Family
ID=74731394
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2021/003633 WO2021201489A1 (ko) | 2020-03-30 | 2021-03-24 | 글루타민 생산능을 향상시키는 형질전환용 재조합 벡터 및 이를 도입한 균주 |
Country Status (6)
Country | Link |
---|---|
US (1) | US20230220430A1 (ko) |
EP (1) | EP4130255A4 (ko) |
JP (1) | JP7415041B2 (ko) |
KR (1) | KR102216450B1 (ko) |
CN (1) | CN115349012B (ko) |
WO (1) | WO2021201489A1 (ko) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR102216450B1 (ko) * | 2020-03-30 | 2021-02-17 | 대상 주식회사 | 글루타민 생산능을 향상시키는 형질전환용 재조합 벡터 및 이를 도입한 균주 |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1424397A1 (en) * | 2002-11-26 | 2004-06-02 | Ajinomoto Co., Inc. | Method for producing L-glutamine and L-glutamine producing bacterium |
EP1783203A1 (en) * | 2004-06-25 | 2007-05-09 | Kyowa Hakko Kogyo Co., Ltd. | Process for producing substances |
JP2017079705A (ja) * | 2015-10-30 | 2017-05-18 | 味の素株式会社 | グルタミン酸系l−アミノ酸の製造法 |
KR102216450B1 (ko) * | 2020-03-30 | 2021-02-17 | 대상 주식회사 | 글루타민 생산능을 향상시키는 형질전환용 재조합 벡터 및 이를 도입한 균주 |
Family Cites Families (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR920005975B1 (ko) * | 1990-06-30 | 1992-07-25 | 미원식품주식회사 | 미생물에 의한 l-글루타민의 제조방법 |
KR20070087035A (ko) * | 1999-06-25 | 2007-08-27 | 바스프 악티엔게젤샤프트 | 대사 경로 단백질을 코딩하는 코리네박테리움 글루타미쿰유전자 |
JP4560998B2 (ja) * | 2001-02-05 | 2010-10-13 | 味の素株式会社 | 発酵法によるl−グルタミンの製造法及びl−グルタミン生産菌 |
KR101481782B1 (ko) * | 2012-12-28 | 2015-01-13 | 대상 주식회사 | Gogat의 불활성화에 의한 아미노산 고생산능 변이 균주 |
CN106635946A (zh) * | 2016-12-29 | 2017-05-10 | 廊坊梅花生物技术开发有限公司 | 一种谷氨酸棒杆菌及其构建方法与应用 |
-
2020
- 2020-03-30 KR KR1020200038628A patent/KR102216450B1/ko active IP Right Grant
-
2021
- 2021-03-24 US US17/916,331 patent/US20230220430A1/en active Pending
- 2021-03-24 CN CN202180026206.XA patent/CN115349012B/zh active Active
- 2021-03-24 EP EP21780977.1A patent/EP4130255A4/en active Pending
- 2021-03-24 JP JP2022560115A patent/JP7415041B2/ja active Active
- 2021-03-24 WO PCT/KR2021/003633 patent/WO2021201489A1/ko unknown
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1424397A1 (en) * | 2002-11-26 | 2004-06-02 | Ajinomoto Co., Inc. | Method for producing L-glutamine and L-glutamine producing bacterium |
EP1783203A1 (en) * | 2004-06-25 | 2007-05-09 | Kyowa Hakko Kogyo Co., Ltd. | Process for producing substances |
JP4898441B2 (ja) | 2004-06-25 | 2012-03-14 | 協和発酵バイオ株式会社 | 物質の製造法 |
JP2017079705A (ja) * | 2015-10-30 | 2017-05-18 | 味の素株式会社 | グルタミン酸系l−アミノ酸の製造法 |
KR102216450B1 (ko) * | 2020-03-30 | 2021-02-17 | 대상 주식회사 | 글루타민 생산능을 향상시키는 형질전환용 재조합 벡터 및 이를 도입한 균주 |
Non-Patent Citations (3)
Title |
---|
"Manual of Methods for General Bacteriology", 1981, AMERICAN SOCIETY FOR BACTERIOLOGY |
NOLDEN L. ET AL.: "Glutamine synthetase of Corynebacterium glutamicum: transcriptional control and regulation of activity", FEMS MICROBIOLOGY LETTERS, NO LONGER PUBLISHED BY ELSEVIER, vol. 201, 1 January 2001 (2001-01-01), pages 91 - 98, XP003015031, ISSN: 0378-1097, DOI: 10.1111/j.1574-6968.2001.tb10738.x * |
See also references of EP4130255A4 |
Also Published As
Publication number | Publication date |
---|---|
JP2023521310A (ja) | 2023-05-24 |
JP7415041B2 (ja) | 2024-01-16 |
EP4130255A1 (en) | 2023-02-08 |
US20230220430A1 (en) | 2023-07-13 |
CN115349012A (zh) | 2022-11-15 |
CN115349012B (zh) | 2023-07-18 |
EP4130255A4 (en) | 2024-04-24 |
KR102216450B1 (ko) | 2021-02-17 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2021162189A1 (ko) | L-글루탐산 생산능이 향상된 코리네박테리움 글루타미쿰 변이주 및 이를 이용한 l-글루탐산의 생산 방법 | |
WO2023158029A1 (ko) | Atp 신타아제 신규 변이체 및 이를 이용한 l-방향족 아미노산 생산 방법 | |
WO2015064917A1 (ko) | L-라이신 생산능이 향상된 코리네박테리움 속 미생물 및 이를 이용한 l-라이신 생산방법 | |
WO2011115439A2 (ko) | 5'-크산틸산 및 5'-구아닐산 생산능이 향상된 미생물 및 이를 이용한 5'-크산틸산 또는 5'-구아닐산의 생산방법 | |
WO2021201489A1 (ko) | 글루타민 생산능을 향상시키는 형질전환용 재조합 벡터 및 이를 도입한 균주 | |
WO2015174655A1 (ko) | L-라이신을 생산하는 코리네박테리움 속 미생물 및 이를 이용한 l-라이신의 생산방법 | |
WO2010071367A2 (en) | A corynebacteria strain having enhanced 5'-xanthosine monophosphate productivity and a method of producing 5'-xanthosine monophosphate using the same | |
EP3119875A1 (en) | Microorganisms producing l-amino acids and process for producing l-amino acids using the same | |
WO2023158175A1 (ko) | 수송단백질 신규 변이체 및 이를 이용한 l-방향족 아미노산 생산 방법 | |
WO2021125494A1 (ko) | 다중약물 유출펌프 변이체, 상기 변이체를 코딩하는 폴리뉴클레오티드, 상기 변이체를 포함하는 미생물, 및 이를 이용하여 비올라세인 또는 디옥시비올라세인을 제조하는 방법 | |
WO2022050527A1 (ko) | L-라이신 생산능이 향상된 코리네박테리움 글루타미쿰 변이주 및 이를 이용한 l-라이신의 생산 방법 | |
WO2022191357A1 (ko) | L-라이신 생산능이 향상된 코리네박테리움 글루타미쿰 변이주 및 이를 이용한 l-라이신의 생산 방법 | |
US7344855B2 (en) | Fermentation process | |
WO2010071366A2 (en) | A corynebacteria strain for enhancement of 5'-guanosine monophosphate productivity and a method of producing 5'-guanosine monophosphate using the same | |
WO2017065457A1 (ko) | L-쓰레오닌 생산능을 가지는 미생물 및 그를 이용하여 l-쓰레오닌을 생산하는 방법 | |
WO2023158176A1 (ko) | 스트레스 단백질 신규 변이체 및 이를 이용한 l-방향족 아미노산 생산 방법 | |
WO2023158030A1 (ko) | 징크 바인딩 디하이드로게나제 신규 변이체 및 이를 이용한 l-방향족 아미노산 생산 방법 | |
WO2022191358A1 (ko) | L-라이신 생산능이 향상된 코리네박테리움 글루타미쿰 변이주 및 이를 이용한 l-라이신의 생산 방법 | |
WO2023063547A1 (ko) | L-라이신 생산능이 향상된 코리네박테리움 글루타미쿰 변이주 및 이를 이용한 l-라이신의 생산 방법 | |
WO2023158174A1 (ko) | 시그마 38 신규 변이체 및 이를 이용한 l-방향족 아미노산 생산 방법 | |
WO2022231054A1 (ko) | L-라이신 생산능이 향상된 코리네박테리움 글루타미쿰 변이주 및 이를 이용한 l-라이신의 생산 방법 | |
WO2022231049A1 (ko) | L-라이신 생산능이 향상된 코리네박테리움 글루타미쿰 변이주 및 이를 이용한 l-라이신의 생산 방법 | |
WO2022050524A1 (ko) | L-라이신 생산능이 향상된 코리네박테리움 글루타미쿰 변이주 및 이를 이용한 l-라이신의 생산 방법 | |
WO2022231056A1 (ko) | L-라이신 생산능이 향상된 코리네박테리움 글루타미쿰 변이주 및 이를 이용한 l-라이신의 생산 방법 | |
WO2023106543A1 (ko) | L-라이신 생산능이 향상된 코리네박테리움 글루타미쿰 변이주 및 이를 이용한 l-라이신의 생산 방법 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21780977 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2022560115 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2021780977 Country of ref document: EP Effective date: 20221031 |