WO2021183195A1 - Anti-coronavirus antibodies and methods of use - Google Patents
Anti-coronavirus antibodies and methods of use Download PDFInfo
- Publication number
- WO2021183195A1 WO2021183195A1 PCT/US2020/063991 US2020063991W WO2021183195A1 WO 2021183195 A1 WO2021183195 A1 WO 2021183195A1 US 2020063991 W US2020063991 W US 2020063991W WO 2021183195 A1 WO2021183195 A1 WO 2021183195A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- set forth
- variable region
- chain variable
- cdrs
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/215—Coronaviridae, e.g. avian infectious bronchitis virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/02—Inorganic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
- A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
- A61K47/183—Amino acids, e.g. glycine, EDTA or aspartame
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6839—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting material from viruses
- A61K47/6841—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting material from viruses the antibody targeting a RNA virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
- C07K14/08—RNA viruses
- C07K14/165—Coronaviridae, e.g. avian infectious bronchitis virus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/102—Coronaviridae (F)
- C07K16/104—Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5091—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing the pathological state of an organism
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
- G01N33/6857—Antibody fragments
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/165—Coronaviridae, e.g. avian infectious bronchitis virus
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/26—Infectious diseases, e.g. generalised sepsis
Definitions
- anti-coronavirus antibodies e.g., anti-SARS- CoV-2 antibodies
- antibody-like molecules e.g., human antibodies, antibody fragments, and nucleic-acid-vectored versions thereof
- methods for treating coronavirus infections, methods for prophylaxis against coronavirus infections, and immunoassays for the detection of coronaviruses BACKGROUND OF THE INVENTION [0006]
- SARS-CoV Severe Acute Respiratory Syndrome coronavirus
- West Nile West Nile
- Ebola Middle Eastern Respiratory Syndrome Coronavirus
- Zika and pandemic influenza.
- pandemic outbreaks present a serious risk to global security and trade.
- SARS-CoV-2 2019 novel coronavirus
- WHO World Health Organization
- Pandemic outbreaks present a serious risk to global security and trade.
- the 1918 H1N1 pandemic influenza virus (Spanish flu) claimed an estimated 50 million lives in a matter of months.
- the World Bank estimates that a pandemic to that scale would cost about 5% global gross domestic product (GDP), or about $3 trillion USD.
- H1N1 pandemic The more recent 2009 H1N1 pandemic is estimated to have infected 11-21% of the world’s population (80% under the age of 65) and claimed between 151,700 to 575,400 lives.
- WHO estimates three to five million cases of severe influenza, resulting in 250,000 to 500,000 global deaths.
- the propensity for rapid genetic change, antigenic diversity, and the breadth of potential hosts gives influenza type A significant pandemic potential.
- the rapid mutation of surface antigens allows the virus to evade the immune response, requiring an annual prediction of circulating strains to include in seasonal vaccines.
- a universal flu vaccine that could provide long-term and cross-strain protection has so far been elusive, and while there are candidates in preclinical and clinical trials, it will likely be several years before one becomes available. Less predictable than seasonal drifts, genetic reassortments (antigenic shift) of hemagglutinin or neuraminidase in zoonotic hosts can generate novel strains of influenza virus that can transfer to humans and cause a fast-spreading pandemic across an immunologically na ⁇ ve population.
- the California 2009 H1N1 strain was discovered to have originated in swine, and both the Spanish flu and Hong Kong 1957 pandemic strains are thought to have originated from an avian source.
- Coronaviruses are a large family of viruses that infect mammals and birds, with four endemic strains that circulate commonly in humans, including human coronavirus 229E, OC43, NL63 and HKU1.
- SARS-CoV-2 a new coronavirus
- COVID-19 a severe respiratory disease referred to as COVID-19
- SARS-Cov-2 is now the most serious coronavirus outbreak in history.
- MERS-CoV and SARS-CoV SARS-CoV-2 has spread rapidly on a global scale, with confirmed cases in more than 90 countries to date. In response to this outbreak, there is an urgent need for antibody-based therapeutics, prophylactics, and diagnostics to treat, prevent, and detect the disease.
- This high- throughput interrogation of natural immune-reservoirs can identify rare cross-reactive and potent mAbs, which can reduce dosing frequency and, with it, the unit cost of treatment.
- Molecular engineering can additionally improve both potency and cross-reactivity, and extend mAb half-life.
- Recent advances in nucleic acid-based mAb delivery have shown promise to decrease both costs and dosing frequencies.
- Clinical studies have demonstrated that administration of mRNA-encoded antibodies against Chikungunya virus could generate neutralizing titers without toxicity in human patients. These can furthermore be produced at commercial scale with high purity, and formulated to facilitate storage and shipping, which are all important factors in deploying mAbs rapidly and globally.
- Pandemic Response As part of our participation in the Pandemic Prevention Platform (P3) program of the US Defense Advanced Research Projects Agency (DARPA), we aim to build an ultra-rapid response pipeline for the discovery and delivery of field-ready therapeutic countermeasures in response to any viral outbreaks. Under P3, in a simulated pandemic scenario, we used microfluidic high-throughput single B cell screening to discover mAbs against pandemic 2009 H1N1 influenza directly from a human donor. We designed machine learning tools to automate high-confidence selection of mAbs during screening, rapidly sequenced hundreds of H1-reactive mAbs, and downselected candidates for preclinical testing using a bioinformatic pipeline and data visualization software.
- P3 Pandemic Prevention Platform
- DRPA US Defense Advanced Research Projects Agency
- the present disclosure relates to methods, compositions of matter, and articles of manufacture that may be used in the diagnosis, monitoring, and treatment or prevention of SARS- Co-V and SARS-CoV-2-linked diseases such as COVID-19.
- S spike
- SARS-CoV-2-linked diseases such as COVID-19.
- SARS-CoV- 2 spike protein of coronaviruses
- the sequences of the heavy chain and light chain variable regions (VH and VL) of these antibodies were originally identified from a convalescent patient following infection with a coronavirus, converted to full-length human IgG1 isotype (e.g., IgG1m3 allotype), and the recombinant versions of these antibodies were subsequently produced and characterized as described herein. Therefore, these antibodies are recombinant in nature.
- the antibodies provided herein each binds to the spike protein of SARS-CoV-2 virus, and some of the antibodies cross- react with the spike protein of one or more other coronaviruses.
- the library is stored as a collection of electronic DNA sequences of the heavy and light chain variable regions of each member of the library.
- the library is stored as DNA molecules that encode the heavy and light chain variable regions of each member in the library.
- the library is stored as antibody protein molecules for rapid testing.
- the library is stored as nucleic acid-encoded versions of the antibody proteins, in mRNA or DNA formats and expression vectors suitable for direct administration to humans as nucleic acids instead of proteins.
- Nucleic acids encoding the heavy chain variable regions (VH) of these antibodies are set forth in odd numbered sequences in SEQ ID NOs: 1-660, 1321-2750, and 4181-4748 detailed herein.
- Nucleic acids encoding the light chain variable regions (VL) of these antibodies are set forth in even numbered sequences in SEQ ID NOs: 1-660, 1321-2750, and 4181-4748 detailed herein.
- Amino acid sequences of the heavy chain variable regions (VH) of these antibodies are set forth in odd numbered sequences in SEQ ID NOs: 661-1320, 2751-4180, and 4749-5316 detailed herein.
- Amino acid sequences of the light chain variable regions of these antibodies are set forth in even numbered sequences of SEQ ID NOs: 661-1320, 2751-4180, and 4749-5316 detailed herein.
- the four sequences pertaining to any particular antibody will be separated by sequences pertaining to other antibodies.
- the SEQ ID NOs assigned to the first antibody are SEQ ID NOs: 1, 2, 661 and 662
- the SEQ ID NOs assigned to the second antibody are SEQ ID NOs: 3, 4, 663 and 664 and so on all the way to the one thousand three hundred and twenty ninth antibody (designated 1587), which is assigned SEQ ID NOs: 4747, 4748, 5315, and 5316.
- the anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- antigen-binding fragment thereof comprises (a) a heavy chain variable region comprising residues 31-35 for CDR-H1, residues 50-65 for CDR-H2, and residues 95-102 for CDR-H3; and (b) a light chain variable region comprising residues 24-34 for CDR-L1, residues 50-56 for CDR-L2, and residues 89-97 for CDR-L3; wherein the CDR numbering is according to Kabat.
- the anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- antigen-binding fragment thereof comprises: (a) a heavy chain variable region comprising residues 26-32 for CDR-H1, residues 50-58 for CDR-H2, and residues 95-102 for CDR-H3; and (b) a light chain variable region comprising residues 24-34 for CDR-L1, residues 50-56 of SEQ ID NO: 62 for CDR-L2, and residues 89-97 of SEQ ID NO: 62 for CDR-L3; wherein the CDR numbering is according to Chothia.
- the anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- antigen-binding fragment thereof comprises: (a) a heavy chain variable region comprising residues 30-35 for CDR-H1, residues 47-58 for CDR-H2, and residues 93-101 for CDR-H3; and (b) a light chain variable region comprising residues 30-36 for CDR-L1, residues 46-55 for CDR-L2, and for CDR-L3; wherein the CDR numbering is according to MacCallum.
- the anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- antigen-binding fragment thereof comprises a heavy chain variable region having an amino acid sequence that is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to one of the heavy chain variable region sequences explicitly disclosed in SEQ ID NOs: 660-1320 and 2751-4180 and a light chain variable region having an amino acid sequence that is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to one of the light chain variable region sequences explicitly disclosed in SEQ ID NOs: 660-1320 and 2751-4180.
- members of the antibody library are specific to SARS-CoV-2.
- the antibodies are known to cross-react against SARS-CoV and SARS- CoV-2 spike proteins.
- the antibodies are specific to SARS-CoV spike protein.
- the anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- the antibody or antigen-binding fragment thereof is a neutralizing antibody.
- the antibody or antigen-binding fragment thereof is a depleting antibody.
- the antibody or antigen-binding fragment thereof comprises at least one amino acid substitution. In particular embodiments, the at least one amino acid substitution is a conservative substitution.
- the at least one amino acid substitution is a substitution of an amino acid for a non-genetically encoded amino acid or a synthetic amino acid.
- the antibody or antigen-binding fragment thereof is conjugated to an immunomodulator, a cytokine, a cytotoxic agent, a chemotherapeutic agent, a diagnostic agent, an antiviral agent, an antimicrobial agent, or a drug.
- the antibody or antigen-binding fragment thereof is formulated as a pharmaceutical composition.
- the pharmaceutical composition may comprise one or more pharmaceutically acceptable carriers, diluents, or excipients.
- the antibody or antigen-binding fragment thereof may be conjugated to an immunomodulator, a cytokine, a cytotoxic agent, a chemotherapeutic agent, a diagnostic agent, an antiviral agent, an antimicrobial agent, or a drug prior to formulation.
- the inventions disclosed herein also encompass isolated nucleic acids encoding part or all of the anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) and antigen-binding fragments thereof disclosed herein.
- the foregoing nucleic acids may be incorporated into a vector.
- the foregoing nucleic acids may be incorporated into a host cell or a vector then into a host cell.
- the inventions disclosed herein also encompass methods of identifying a SARS-CoV- 2-infected cell comprising contacting a cell with an anti-coronavirus antibody (e.g., anti-SARS- CoV-2 antibody) or antigen-binding fragment thereof conjugated to a detectable agent and detecting specific binding of the antibody or antigen-binding fragment thereof to the cell.
- an anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- antigen-binding fragment thereof as a test reagent for the development and production of a vaccine (e.g., an inactivated virus) against a SARS-CoV- 2 disease (such as COVID-19).
- the inventions disclosed herein also encompass methods of diagnosing a SARS-CoV- 2 infection in a patient comprising contacting a sample obtained from a patient with a SARS-CoV- 2 antibody or antigen-binding fragment thereof conjugated to a detectable agent and detecting specific binding of the antibody or antigen-binding fragment thereof to a SARS-CoV-2 antigen present in the sample.
- the inventions disclosed herein also encompass methods of treating a SARS-Co-V- linked disease (SARS) or SARS-Co-V-2-linked disease (such as COVID-19) comprising administering to a patient a therapeutically effective amount of a SARS-CoV-2 antibody or antigen-binding fragment thereof.
- the antibody or antigen-binding fragment thereof may be conjugated (for example, to an anti-viral agent) or formulated as a pharmaceutical composition.
- the inventions disclosed herein also encompass articles of manufacture useful for diagnosing or treating a SARS-Co-V-2-linked disease comprising a receptacle comprising a SARS-CoV-2 antibody or antigen-binding fragment thereof, or antibody conjugate, or pharmaceutical composition as well as instructional materials for using the same to treat or diagnose the SARS-Co-V-2-linked disease.
- the inventions disclosed herein also encompass processes for producing a SARS-CoV- 2 antibody comprising cultivating a host cell under conditions such that the antibody is expressed and recovering the expressed antibody.
- Figure 1 is a heat map generated from epitope binning experiments using CARTERRA® Epitope analysis software. Binding signals were normalized to the Ag-only signal average equivalent to one RU (relative unit). A threshold window (0.9 RU to 1.1 RU) was used to classify analytes into 3 categories, i.e. blockers (analytes with a binding signal under the lower limit threshold), sandwichers (analytes with a binding signal over the higher limit threshold) and ambiguous (analytes with a signal falling between the lower and higher limit thresholds). The software automatically clusters like-behaved mAbs into a heat map.
- FIG. 1 shows the binding kinetics curve of Fab 555 to SARS-CoV-2 spike protein.
- Figure 2B shows representative negative stain electron microscopy images of Fab 555 in complex with the trimeric SARS-CoV-2 spike protein.
- Figure 2C shows a three-dimensional reconstruction of the complex of Fab 555 and SARS-CoV-2 spike protein within the class-averaged image density; with the peptide regions corresponding to the epitope information derived from HDXMS experiments labeled dark grey.
- Figure 3A shows the binding kinetics curve of Fab 447 to SARS-CoV-2 spike protein.
- Figure 3B shows representative negative stain electron microscopy images of Fab 447 in complex with the trimeric SARS-CoV-2 spike protein.
- Figure 3C shows a three-dimensional reconstruction of the complex of Fab 447 and SARS-CoV-2 spike protein within the class-averaged image density.
- Figure 4A shows the binding kinetics curve of Fab 483 to SARS-CoV-2 spike protein.
- Figure 4B shows representative negative stain electron microscopy images of Fab 483 in complex with the trimeric SARS-CoV-2 spike protein.
- Figure 4C shows a three-dimensional reconstruction of the complex of Fab 483 and SARS-CoV-2 spike protein within the class-averaged image density.
- Figure 5A shows the binding kinetics curve of Fab 419 to SARS-CoV-2 spike protein.
- Figure 5B shows representative negative stain electron microscopy images of Fab 419 in complex with the trimeric SARS-CoV-2 spike protein.
- Figure 5C shows a three-dimensional reconstruction of the complex of Fab 419 and SARS-CoV-2 spike protein within the class-averaged image density.
- Figure 6A shows the binding kinetics curve of Fab 388 to SARS-CoV-2 spike protein.
- Figure 6B shows representative negative stain electron microscopy images of Fab 388 in complex with the trimeric SARS-CoV-2 spike protein.
- Figure 6C shows a three-dimensional reconstruction of the complex of Fab 388 and SARS-CoV-2 spike protein within the class-averaged image density.
- Figure 7 shows the relative binding site of Fabs 555, 447, 483, 419, 388 on SARS- CoV-2 spike protein.
- Figure 8A shows the binding kinetics curve of Fab 494 to SARS-CoV-2 spike protein.
- Figure 8B shows representative negative stain electron microscopy images of Fab 494 in complex with the trimeric SARS-CoV-2 spike protein.
- Figure 8C shows a three-dimensional reconstruction of the complex of Fab 494 and SARS-CoV-2 spike protein within the class-averaged image density.
- Figure 9A is a ribbon diagram of Fab 555/481/488: RBD domain complex structured as determined by X-ray crystallography.
- Figure 9B shows the crystal structure of the RBD-Fab555 complex superimposed with the ACE2 receptor from a structure of the RBD-ACE2 complex (PDB ID: 6M0J).
- Figure 9C is a zoomed-in view of key atomic interactions at the interface of the Fab 555 light chain and the RBD of SARS-CoV-2 spike protein.
- Figure 9D is a zoomed-in view of key atomic interactions at the interface of the Fab 555 heavy chain and the RBD of SARS-CoV-2 spike protein.
- Figure 9E shows the cryo-EM structure of the Fab 555-spike protein complex low- pass filtered to 8 ⁇ resolution and shown at low threshold in order to visualize all three Fabs.
- Figure 9F is a high-resolution cryo-EM map of the Fab555-spike protein complex.
- FIGs 10A-10H show the effect of mAb 555 (aka LY-CoV555) on the viral loads in rhesus macaques challenged with SARS-CoV-2. 24 hours prior to viral challenge, Rhesus macaques were administered varying amounts of LY-CoV555 as a single IV dose. Viral loads in the BAL (FIGs. 10A and 10B), throat swabs (FIGs. 10C and 10D), nasal swabs (FIGs.
- mAb 555 aka LY-CoV555
- FIGs.10G and 10H were assessed over the course of 6 days post-inoculation by measuring genomic RNA (FIGs.10A, 10C, 10E, 10G) or subgenomic mRNA (FIGs 10B, 10D, 10F, 10H) by qRT-PCR.
- FIGs 10A-10F Values represent the mean and standard error of the mean for 3 or 4 animals.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof that specifically binds to a SARS-CoV-2 antigen, SARS-CoV-2 viral particle, or SARS-CoV-2-infected cell, wherein the antibody or antigen-binding fragment thereof comprises: (a) three CDRs of a heavy chain variable region set forth as SEQ ID NO: 661 and three CDRs of a light chain variable region set forth as SEQ ID NO: 662; or (b) three CDRs of a heavy chain variable region set forth as SEQ ID NO: 663 and three CDRs of a light chain variable region set forth as SEQ ID NO: 664; or (c) three CDRs of a heavy chain variable region set forth as SEQ ID NO: 665 and three CDRs of a light chain variable region set forth as SEQ ID NO: 666; or (d) three CDRs of a heavy chain variable region set forth as SEQ ID NO:
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof, wherein the antibody or fragment thereof comprises: (a) CDR- H1 comprising residues 31-35 of the heavy chain variable region (VH), CDR-H2 comprising residues 50-65 of the VH , and CDR-H3 comprising residues 95-102 of the VH; and (b) CDR-L1 comprising residues 24-34 of the light chain variable region (VL), CDR-L2 comprising residues 50-56 of the VL, and CDR-L3 comprising residues 89-97 of the VL; and wherein the CDR numbering is according to Kabat.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof, wherein the antibody or fragment thereof comprises: (a) CDR- H1 comprising residues 26-32 of the VH, CDR-H2 comprising residues 50-58 of the VH, and CDR-H3 comprising residues 95-102 of the VH; and (b) CDR-L1 comprising residues 24-34 of the VL, CDR-L2 comprising residues 50-56 of the VL, and CDR-L3 comprising residues 89-97 of the VL; and wherein the CDR numbering is according to Chothia.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof, wherein the antibody or fragment thereof comprises: (a) CDR- H1 comprising residues 30-35 of the VH, CDR-H2 comprising residues 47-58 of the VH, and CDR-H3 comprising residues 93-101 of the VH; and (b) CDR-L1 comprising residues 30-36 of the VL, CDR-L2 comprising residues 46-55 of the VL, and CDR-L3 comprising the residues 89- 96 of the VL; and wherein the CDR numbering is according to MacCallum.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof, wherein the antibody or fragment thereof comprises a heavy chain variable region having an amino acid sequence that is at least 60% identical to a heavy chain variable region sequence comprising three CDRs of the heavy chain variable region set forth in odd-numbered SEQ ID NOs 661-1320, 2751-4180, and 4749-5316 and a light chain variable region having an amino acid sequence that is at least 60% identical to one of the light chain variable region sequences comprising three CDRs of a corresponding light chain variable region set forth in even-numbered SEQ ID NOs 661-1320, 2751-4180, and 4749-5316.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof, wherein the antibody or fragment thereof comprises (a) the VH set forth as SEQ ID NO: 1225 and the VL set forth as SEQ ID NO: 1226; or (b) the VH set forth as SEQ ID NO: 729 and the VL set forth as SEQ ID NO: 730; or (c) the VH set forth as SEQ ID NO: 763 and the VL set forth as SEQ ID NO: 764; or (d) the VH set forth as SEQ ID NO: 873 and the VL set forth as SEQ ID NO: 874; or (e) the VH set forth as SEQ ID NO: 891 and the VL set forth as SEQ ID NO: 892; or (f) the VH set forth as SEQ ID NO: 921 and the VL set forth as SEQ ID NO: 922; or (g) the VH set forth as SEQ ID NO: 961 and the VL set forth as SEQ ID NO:
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof, wherein the antibody or fragment thereof comprises: (a) a heavy chain comprising SEQ ID NO: 5319 and a light chain comprising SEQ ID NO: 5320; or (b) a heavy chain comprising SEQ ID NO: 5321 and a light chain comprising SEQ ID NO: 5322; or (c) a heavy chain comprising SEQ ID NO: 5323 and a light chain comprising SEQ ID NO: 5324; or (d) a heavy chain comprising SEQ ID NO: 5325 and a light chain comprising SEQ ID NO: 5326; or (e) a heavy chain comprising SEQ ID NO: 5327 and a light chain comprising SEQ ID NO: 5328; or (f) a heavy chain comprising SEQ ID NO: 5329 and a light chain comprising SEQ ID NO: 5330; or (g) a heavy chain comprising SEQ ID NO: 5331 and a light chain comprising SEQ ID NO:
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof, wherein the antibody or fragment thereof comprises a heavy chain variable region having an amino acid sequence that is identical to the heavy chain variable region set forth in odd-numbered SEQ ID NOs 661-1320, 2751-4180, and 4749-5316 and a light chain variable region having an amino acid sequence that is identical to the light chain variable region set forth in even-numbered SEQ ID NOs 661-1320, 2751-4180, and 4749-5316.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that specifically binds to a SARS-CoV spike protein.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that specifically binds to a SARS-CoV-2 spike protein.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that is cross-reactive with the SARS-CoV spike protein and SARS-CoV-2 spike protein.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that is a neutralizing antibody.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that is a depleting antibody.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that binds an epitope comprising one or more of the following residues of the SARS-COV-2 spike protein: Y351, Y449, N450, L452, L455, F456, T470, I472, N481, G482, V483, E484, G485, F486, Y489, F490, L492, Q493, S494, wherein the amino acid residue positions correspond to SEQ ID NO: 5317.
- the epitope comprises two or more of the listed residues, three or more of the listed residues, or five or more of the listed residues.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that binds an epitope comprising one or more of the following residues of the SARS-COV-2 spike protein: R403, D405, R408, Q409, T415, G416, K417, D420, Y421, Y453, L455, F456, R457, K458, S459, N460, Y473, Q474, A475, G476, F486, N487, Y489, Q493, S494, Y495, G496, Q498, T500, N501, G502, Y505, wherein the amino acid residue positions correspond to SEQ ID NO: 5317.
- the epitope comprises two or more of the listed residues, three or more of the listed residues, or five or more of the listed residues.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that binds the SARS-CoV-2 spike protein, wherein the antibody binds an epitope comprising one or more of the following residues of SARS-COV-2 spike protein: R403, T415, G416, K417, D420, Y421, L455, F456, R457, K458, S459, N460, Y473, Q474, A475, G476, S477, F486, N487, Y489, N501, G502, Y505, wherein the amino acid residue positions correspond to SEQ ID NO: 5317.
- the epitope comprises two or more of the listed residues, three or more of the listed residues, or five or more of the listed residues.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that has an IgG1 isotype.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that comprises an Fc region comprising N-glycoside-linked sugar chains bound to the Fc region, wherein the sugar chains do not contain fucose.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that comprises at least one amino acid substitution.
- the at least one amino acid substitution is a conservative substitution.
- the at least one amino acid substitution is a substitution of an amino acid for a non-genetically encoded amino acid or a synthetic amino acid.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that is conjugated to an immunomodulator, a cytokine, a cytotoxic agent, a chemotherapeutic agent, a diagnostic agent, an antiviral agent, an antimicrobial agent, or a drug.
- the inventions disclosed herein encompass an antibody conjugate comprising an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that is conjugated to an immunomodulator, a cytokine, a cytotoxic agent, a chemotherapeutic agent, a diagnostic agent, an antiviral agent, an antimicrobial agent, or a drug.
- the inventions disclosed herein encompass a pharmaceutical composition comprising an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section or an antibody conjugate comprising the same, and one or more pharmaceutically acceptable carriers, diluents, or excipients.
- the pharmaceutical composition comprises at least one additional antibody that binds the SARS-CoV-2 spike protein.
- the pharmaceutical composition comprises histidine, sodium chloride, sucrose, and polysorbate 80.
- the pharmaceutical composition has a pH of about 6.0.
- the pharmaceutical composition comprises 5 mM histidine, 50 mM NaCl, 6% sucrose, and 0.05% polysorbate 80 and has a pH of about 6.0.
- the concentration of the antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section that is in the pharmaceutical composition is about 35 mg/mL to about 125 mg/mL. In particular embodiments, the concentration of the antibody or antigen-binding fragment thereof in the pharmaceutical composition is about 35 mg/mL or about 125 mg/mL.
- the inventions disclosed herein encompass an isolated nucleic acid encoding a heavy chain variable region having an amino acid sequence that is identical to the heavy chain variable region set forth in odd-numbered SEQ ID NOs 661-1320, 2751-4180, and 4749-5316.
- the inventions disclosed herein encompass an isolated nucleic acid encoding a light chain variable region having an amino acid sequence that is identical to the light chain variable region set forth in even-numbered SEQ ID NOs 661-1320, 2751-4180, and 4749-5316.
- the inventions disclosed herein encompass an isolated nucleic acid encoding a heavy chain having an amino acid sequence that is identical to the heavy chain variable region set forth in odd-numbered SEQ ID NOs 531-5366.
- the inventions disclosed herein encompass an isolated nucleic acid encoding a light chain having an amino acid sequence that is identical to the light chain variable region set forth in even-numbered SEQ ID NOs 531-5366.
- the inventions disclosed herein encompass a vector comprising at least one of (a) an isolated nucleic acid encoding a heavy chain variable region having an amino acid sequence that is identical to the heavy chain variable region set forth in odd- numbered SEQ ID NOs 661-1320, 2751-4180, and 4749-5316; and (b) an isolated nucleic acid encoding a light chain variable region having an amino acid sequence that is identical to the light chain variable region set forth in even-numbered SEQ ID NOs 661-1320, 2751-4180, and 4749- 5316.
- the inventions disclosed herein encompass a vector comprising at least one of (a) an isolated nucleic acid encoding a heavy chain having an amino acid sequence that is identical to the heavy chain variable region set forth in odd-numbered SEQ ID NOs 5319- 5366; and (b) an isolated nucleic acid encoding a light chain having an amino acid sequence that is identical to the light chain variable region set forth in even-numbered SEQ ID NOs 5319-5366.
- the inventions disclosed herein encompass a host cell comprising at least one of (a) an isolated nucleic acid encoding a heavy chain variable region having an amino acid sequence that is identical to the heavy chain variable region set forth in odd- numbered SEQ ID NOs 661-1320, 2751-4180, and 4749-5316; and (b) an isolated nucleic acid encoding a light chain variable region having an amino acid sequence that is identical to the light chain variable region set forth in even-numbered SEQ ID NOs 661-1320, 2751-4180, and 4749- 5316.
- the inventions disclosed herein encompass a host cell comprising at least one of (a) an isolated nucleic acid encoding a heavy chain having an amino acid sequence that is identical to the heavy chain variable region set forth in odd-numbered SEQ ID NOs 5319- 5366; and (b) an isolated nucleic acid encoding a light chain having an amino acid sequence that is identical to the light chain variable region set forth in even-numbered SEQ ID NOs 5319-5366.
- the inventions disclosed herein encompass a host cell comprising a vector comprising at least one of (a) an isolated nucleic acid encoding a heavy chain variable region having an amino acid sequence that is identical to the heavy chain variable region set forth in odd-numbered SEQ ID NOs 661-1320, 2751-4180, and 4749-5316; and (b) an isolated nucleic acid encoding a light chain variable region having an amino acid sequence that is identical to the light chain variable region set forth in even-numbered SEQ ID NOs 661-1320, 2751-4180, and 4749-5316.
- the inventions disclosed herein encompass a host cell comprising a vector comprising at least one of (a) an isolated nucleic acid encoding a heavy chain having an amino acid sequence that is identical to the heavy chain variable region set forth in odd- numbered SEQ ID NOs 5319-5366; and (b) an isolated nucleic acid encoding a light chain having an amino acid sequence that is identical to the light chain variable region set forth in even- numbered SEQ ID NOs 5319-5366.
- the inventions disclosed herein encompass a process for producing an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section comprising (a) cultivating the host cell described in the preceding paragraphs under conditions such that the antibody or antigen-binding fragment thereof is expressed; and (b) recovering the expressed antibody or antigen-binding fragment thereof.
- the inventions disclosed herein encompass an article of manufacture useful for diagnosing or treating a SARS-Co-V or SARS-Co-V-2-linked disease comprising a receptacle comprising the antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section, or an antibody conjugate comprising the same, or a pharmaceutical composition comprising the same and instructional materials for using the same to treat or diagnose the SARS-Co-V or SARS-Co-V-2-linked disease.
- the inventions disclosed herein encompass a method of identifying a SARS-Co-V or SARS-CoV-2-infected cell comprising: (a) contacting a cell with the an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section, which is conjugated to a detectable agent; and (b) detecting specific binding of the antibody or antigen-binding fragment thereof to the cell.
- the inventions disclosed herein encompass a method of diagnosing a SARS-Co-V or SARS-CoV-2 infection in a patient comprising: (a) contacting a sample obtained from a patient with the antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section, which is conjugated to a detectable agent; and (b) detecting specific binding of the antibody or antigen-binding fragment thereof to a SARS-Co-V or SARS-CoV-2 antigen present in the sample.
- the inventions disclosed herein encompass a method of treating or preventing a SARS-Co-V or SARS-Co-V-2-linked disease comprising administering to a patient a therapeutically effective amount of the antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section, or an antibody conjugate comprising the same, or a pharmaceutical composition comprising the same.
- the inventions disclosed herein encompass a method of preventing or treating COVID-19 comprising: (a) contacting a sample obtained from a patient with an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section, which is conjugated to a detectable agent; (b) detecting specific binding of the antibody or antigen-binding fragment thereof to a SARS-CoV-2 antigen present in the sample; and (c) administering to the patient a therapeutically effective amount of the an antibody or antigen- binding fragment thereof described in the preceding paragraphs of this section or a pharmaceutical composition comprising the same.
- the inventions disclosed herein encompass methods of prophylaxis and therapy described in this section wherein the antibody or antigen-binding fragment thereof is administered or administrable to the patient intravenously or subcutaneously at about 700 mg to about 7000 mg.
- the antibody is administered to the patient intravenously or subcutaneously at about 700 mg.
- the antibody or antigen-binding fragment thereof is administered or administrable to the patient intravenously or subcutaneously at about 35 mg to about 700 mg.
- the inventions disclosed herein encompass methods of prophylaxis and therapy described in this section wherein the method further comprises administering to the patient another antibody or antigen-binding fragment thereof that binds the SARS-CoV-2 S protein.
- the inventions disclosed herein encompass methods of prophylaxis and therapy described in this section wherein the patient has mild to moderate COVID-19.
- the inventions disclosed herein encompass methods of prophylaxis and therapy described in this section wherein the patient is at risk for contracting COVID-19.
- the inventions disclosed herein encompass methods of prophylaxis and therapy described in this section wherein the patient is at high risk for progressing to severe COVID-19 or hospitalization.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section or a pharmaceutical composition comprising the same for use in the diagnosis, theragnosis, treatment and/or prophylaxis of a SARS-CoV or SARS-CoV-2-related disease or symptom.
- the inventions disclosed herein encompass an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section or a pharmaceutical composition comprising the same for use in the manufacture of a medicament for diagnosis, theragnosis, treatment and/or prophylaxis of a SARS-CoV or SARS-CoV-2-related disease or symptom.
- the inventions disclosed herein encompass a method of testing an anti-coronavirus vaccine, comprising (a) contacting a sample of an anti-coronavirus vaccine with an antibody or antigen-binding fragment thereof described in the preceding paragraphs of this section, conjugated to a detectable agent; and (b) detecting specific binding of the antibody or antigen-binding fragment thereof to the anti-coronavirus vaccine present in the sample; wherein the anti-coronavirus vaccine comprises a coronavirus subunit or fragment thereof.
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- the present disclosure is directed to anti-coronavirus antibodies (e.g., anti-SARS-CoV- 2 antibodies) and their use in the diagnosis, theragnosis, treatment and/or prophylaxis of SARS- CoV and SARS-CoV-2 infections and related symptoms (i.e., SARS and COVID-19 coronavirus disease).
- anti-coronavirus antibody(ies) describes antibodies that specifically recognize, bind to, or otherwise associate with one or more antigens present on the SARS-COV and/or SARS-CoV-2 spike protein (i.e., antibodies that are specific for one or the other protein or that are cross-reactive are encompassed).
- Anti-coronavirus antibodies e.g., anti- SARS-CoV-2 antibodies
- Anti-coronavirus antibodies may be used alone or in conjunction with a wide variety of other compounds or biological response modifiers.
- two or more discrete anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- compositions comprising two, three, or more discrete anti-coronavirus antibodies.
- the anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- the anti-coronavirus antibodies herein are recombinant in nature.
- antibodies or antigen-binding fragments thereof that specifically bind to a SARS-CoV-2 antigen, SARS-CoV-2 viral particle, or SARS-CoV-2-infected cell (“anti- SARS-CoV-2 antibodies or antigen binding fragments”).
- the anti-SARS- CoV-2 antibodies or antigen binding fragments specifically bind the spike (S) protein of SARS- CoV-2.
- bind and “binds” as used herein are intended to mean, unless indicated otherwise, the ability of a protein or molecule to form a chemical bond or attractive interaction with another protein or molecule, which results in proximity of the two proteins or molecules as determined by common methods known in the art.
- the cryo–electron microscopy structure of the SARS-CoV-2 S protein has been described recently, and shows the SARS-CoV-2 S protein is a trimeric class I fusion protein that exists in a metastable pre-fusion conformation and undergoes a substantial structural rearrangement to fuse the viral membrane with the host cell membrane (Wrapp et al., Science 367, 1260–1263, 2020).
- SARS-CoV-2 spike (S) protein has been described before, for example, GenBank Accession No: YP_009724390.1 provides such an exemplary sequence, as shown below: MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLF LPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLD SKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANN CTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGF SALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFL LKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNIT NLCPF
- the receptor-binding domain comprises amino acids 329 to 520 of the SARS- CoV-2 S protein, e.g., amino acids 329 to 520 of SEQ ID NO: 5317, or a variant comprising one or more mutations;
- the N-terminal domain comprises amino acids 16-328 of the SARS- CoV-2 S protein, e.g., amino acids 16-328 of SEQ ID NO: 5317, or a variant comprising one or more mutations;
- S2 domain comprises amino acids 686-1213 of the SARS-CoV-2 S protein, e.g., amino acids 686-1213 of SEQ ID NO: 5317, or a variant comprising one or more mutations (see Wrapp et al., Science 367, 1260–1263, 2020).
- anti-SARS-CoV-2 antibodies having internal designations 258 to 577 and 589 to 1587 as described herein.
- anti-SARS-CoV-2 antibodies or antigen binding fragments that comprise the VH and/or the VL of any one of antibodies 258 to 577 and 589 to 1587.
- anti-SARS-CoV-2 antibodies or antigen binding fragments that comprise a VH domain having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the VH domain of any one of antibodies 258 to 577 and 589 to 1587, or a VL domain having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the VH domain of any one of antibodies 258 to 577 and 589 to 1587.
- anti-SARS-CoV-2 antibodies or antigen binding fragments that comprise a VH domain having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the VH domain of any one of antibodies 258 to 577 and 589 to 1587, and a VL domain having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the VH domain of any one of antibodies 258 to 577 and 589 to 1587, preferably wherein these homologous VH and VL domains correspond to those of the same antibody.
- anti-SARS-CoV-2 antibodies or antigen binding fragments that comprise a VH domain comprising the same three CDRs as comprised in the VH domain of any one of antibodies 258 to 577 and 589 to 1587 and/or comprises a VL domain comprising the same three CDRs as the VL domain of any one of antibodies 258 to 577 and 589 to 1587, wherein the CDRs are defined by Kabat, Chothia or MacCallum numbering.
- the anti-SARS-CoV-2 antibodies or antigen binding fragments provided herein are neutralizing antibodies.
- neutralizing anti-SARS- CoV-2 antibodies or antigen binding fragments comprise: (1) three CDRs in the heavy chain variable region (VH) set forth as SEQ ID NO: 729 and three CDRs in the light chain variable region (VL) set forth as SEQ ID NO: 730; (2) three CDRs in the VH set forth as SEQ ID NO: 763 and three CDRs in the VL set forth as SEQ ID NO: 764; (3) three CDRs in the VH set forth as SEQ ID NO: 873 and three CDRs in the VL set forth as SEQ ID NO: 874; (4) three CDRs in the VH set forth as SEQ ID NO: 891 and three CDRs in the VL set forth as SEQ ID NO: 892; (5) three CDRs in the VH set forth as SEQ ID NO: 921 and three CDRs in the VL set forth as SEQ ID NO: 922; (6) three CDRs in the VH set forth as SEQ ID NO: 961 and three
- neutralizing anti-SARS-CoV-2 antibodies or antigen binding fragments comprise: (1) the VH set forth as SEQ ID NO: 729 and the VL set forth as SEQ ID NO: 730; (2) the VH set forth as SEQ ID NO: 763 and the VL set forth as SEQ ID NO: 764; (3) the VH set forth as SEQ ID NO: 873 and the VL set forth as SEQ ID NO: 874; (4) the VH set forth as SEQ ID NO: 891 and the VL set forth as SEQ ID NO: 892; (5) the VH set forth as SEQ ID NO: 921 and the VL set forth as SEQ ID NO: 922; (6) the VH set forth as SEQ ID NO: 961 and the VL set forth as SEQ ID NO: 962; (7) the VH set forth as SEQ ID NO: 973 and the VL set forth as SEQ ID NO: 974; (8) the VH set forth as SEQ ID NO: 979 and the VL set
- the anti-SARS-CoV-2 antibodies or antigen binding fragments provided herein are antibodies that block SARS-CoV-2 binding to ACE2, i.e., ACE2 blockers.
- ACE2-blocking anti-SARS-CoV-2 antibodies or antigen binding fragments comprise: (i) three CDRs in the heavy chain variable region (VH) set forth as SEQ ID NO: 729 and three CDRs in the light chain variable region (VL) set forth as SEQ ID NO: 730; (ii) three CDRs in the VH set forth as SEQ ID NO: 891 and three CDRs in the VL set forth as SEQ ID NO: 892; (ii) three CDRs in the VH set forth as SEQ ID NO: 961 and three CDRs in the VL set forth as SEQ ID NO: 962; (iv) three CDRs in the VH set forth as SEQ ID NO: 979 and three CDRs in the VL set forth as SEQ
- ACE2-blocking anti-SARS-CoV-2 antibodies or antigen binding fragments comprise: (i) the VH set forth as SEQ ID NO: 729 and the VL set forth as SEQ ID NO: 730; (ii) the VH set forth as SEQ ID NO: 891 and the VL set forth as SEQ ID NO: 892; (iii) the VH set forth as SEQ ID NO: 961 and the VL set forth as SEQ ID NO: 962; (iv) the VH set forth as SEQ ID NO: 979 and the VL set forth as SEQ ID NO: 980; (v) the VH set forth as SEQ ID NO: 1039 and the VL set forth as SEQ ID NO: 1040; (vi) the VH set forth as SEQ ID NO: 1103 and the VL set forth as SEQ ID NO: 1104; (vii) the VH set forth as SEQ ID NO: 1107 and the VL set forth as SEQ ID NO: 1108; (viii
- the anti-SARS-CoV-2 antibodies provided herein have IgG1m3 allotype.
- the foregoing antibody comprises a heavy chain comprising SEQ ID NO: 5335 and a light chain comprising SEQ ID NO: 5336. In some embodiments the foregoing antibody comprises a heavy chain comprising SEQ ID NO: 5347 and a light chain comprising SEQ ID NO: 5348. In some embodiments, the foregoing antibody comprises a heavy chain comprising SEQ ID NO: 5351 and a light chain comprising SEQ ID NO: 5352. In some embodiments, the foregoing antibody comprises a heavy chain comprising SEQ ID NO: 5325 and a light chain comprising SEQ ID NO: 5326.
- antibodies that bind SARS-CoV-2 spike protein wherein the antibodies bind an epitope comprising one or more residues within amino acids 434-444 and 459- 495 of the SARS-CoV-2 spike protein, wherein the amino acid residue positions correspond to SEQ ID NO: 5317.
- antibodies that bind SARS-CoV- 2 spike protein wherein the antibodies bind an epitope comprising two, three, four, five or more residues within amino acids 434-444 and 459-495 of the SARS-CoV-2 spike protein, wherein the amino acid residue positions correspond to SEQ ID NO: 5317.
- the epitope is determined by HDX-MS (hydrogen-deuterium exchange mass spectrometry).
- HDX-MS hydrogen-deuterium exchange mass spectrometry
- the antibodies bind an epitope comprising one or more of the following residues of SARS-COV-2 spike protein: Y351, Y449, N450, L452, L455, F456, T470, I472, N481, G482, V483, E484, G485, F486, Y489, F490, L492, Q493, S494, wherein the amino acid residue positions correspond to SEQ ID NO: 5317.
- the epitope comprises two or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19) of the listed residues. In some embodiments, the epitope comprises three or more of the listed residues. In some embodiments, the epitope comprises four or more of the listed residues. In some embodiments, the epitope comprises five or more of the listed residues. In some embodiments, the epitope is determined by X-ray crystallography.
- antibodies that bind SARS-CoV-2 spike protein wherein the antibodies bind an epitope comprising one or more of the following residues of SARS-COV-2 spike protein: R403, D405, R408, Q409, T415, G416, K417, D420, Y421, Y453, L455, F456, R457, K458, S459, N460, Y473, Q474, A475, G476, F486, N487, Y489, Q493, S494, Y495, G496, Q498, T500, N501, G502, Y505, wherein the amino acid residue positions correspond to SEQ ID NO: 5317.
- the epitope comprises two or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32) of the listed residues. In some embodiments, the epitope comprises three or more of the listed residues. In some embodiments, the epitope comprises four or more of the listed residues. In some embodiments, the epitope comprises five or more of the listed residues. In some embodiments, the epitope is determined by X-ray crystallography.
- antibodies that bind SARS-CoV-2 spike protein wherein the antibodies bind an epitope comprising one or more of the following residues of SARS-COV-2 spike protein: R403, T415, G416, K417, D420, Y421, L455, F456, R457, K458, S459, N460, Y473, Q474, A475, G476, S477, F486, N487, Y489, N501, G502, Y505, wherein the amino acid residue positions correspond to SEQ ID NO: 5317.
- the epitope comprises two or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23) of the listed residues. In some embodiments, the epitope comprises three or more of the listed residues. In some embodiments, the epitope comprises four or more of the listed residues. In some embodiments, the epitope comprises five or more of the listed residues. In some embodiments, the epitope is determined by X-ray crystallography. [00114] The term "epitope" refers to the amino acid residues, of an antigen, that are bound by an antibody. An epitope can be a linear epitope, a conformational epitope, or a hybrid epitope.
- An epitope can be determined according to different experimental techniques, also called “epitope mapping techniques.” It is understood that the determination of an epitope may vary based on the different epitope mapping techniques used and may also vary with the different experimental conditions used, e.g., due to the conformational changes or cleavages of the antigen induced by specific experimental conditions.
- Epitope mapping techniques are known in the art (e.g., Rockberg and Nilvebrant, Epitope Mapping Protocols: Methods in Molecular Biology, Humana Press, 3rd ed.2018), including, but not limited to, X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, electron microscopy, site-directed mutagenesis, species swap mutagenesis, alanine- scanning mutagenesis, hydrogen-deuterium exchange (HDX), and cross-blocking assays.
- NMR nuclear magnetic resonance
- HDX hydrogen-deuterium exchange
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof, wherein at least one antibody or antigen-binding fragment thereof is selected from an antibody or antigen-binding fragment described herein.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof described herein.
- compositions comprising two or three anti-SARS- CoV-2 antibodies selected from antibodies 258 to 577 and 589 to 1587.
- compositions comprising two or three anti-SARS-CoV-2 antibodies, wherein at least one of the antibodies neutralize SARS-CoV-2.
- compositions comprising two or three anti-SARS-CoV-2 antibodies selected from antibodies 292, 309, 364, 373, 388, 408, 414, 417, 419, 442, 445, 447, 462, 479, 481, 483, 488, 494, 506, 540, 549, 553, 555, and 562.
- compositions comprising two or three anti-SARS-CoV-2 antibodies, wherein at least one antibody or antigen-binding fragment thereof blocks SARS-CoV-2 binding to ACE2.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof, wherein at least one antibody or antigen-binding fragment thereof is selected from antibodies 292, 373, 408, 417, 447, 479, 481, 483, 488, 494, 506, 549, 553, and 555.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof, wherein at least one antibody or antigen-binding fragment thereof binds the RBD of the SARS-CoV-2 S protein.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen- binding fragments thereof, wherein at least one antibody or antigen-binding fragment thereof is an antibody selected from 292, 447, 481, 488, 494, 506, 549, 553, and 555.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof, wherein at least one of the anti-SARS-CoV-2 antibody is 555.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen- binding fragments thereof, wherein at least one of the anti-SARS-CoV-2 antibody comprises a heavy chain comprising SEQ ID NO: 5363 and a light chain comprising SEQ ID NO: 5364.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof, wherein at least one antibody or antigen-binding fragment thereof binds the N-terminal domain (NTD) of the SARS-CoV-2 S protein.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof, wherein at least one antibody or antigen-binding fragment thereof is an antibody selected from antibodies 417, 419, and 479.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof, wherein at least one antibody or antigen-binding fragment thereof binds the S2 domain/subunit of the SARS-CoV-2 S protein.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof, wherein at least one antibody or antigen-binding fragment thereof is an antibody selected from antibodies 309, 364, 373, 388, 442, 462, 540, and 562.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof that bind different epitopes of the SARS-CoV-2 S protein.
- compositions comprising a first anti-SARS-CoV-2 antibody or antigen-binding fragment thereof that binds a first epitope in the receptor-binding domain (RBD) of the SARS-CoV-2 S protein, and a second anti-SARS-CoV-2 antibody or antigen-binding fragment thereof that binds a second epitope of the SARS-CoV-2 S protein, wherein the second epitope is different from the first epitope.
- RBD receptor-binding domain
- suitable anti-SARS-CoV-2 antibodies that can be used in the composition include the antibodies described in Shi, R., et al., A human neutralizing antibody targets the receptor binding site of SARS-CoV-2.
- CA1 and CB6 antibodies have been deposited in GenBank with the accession codes MT470194-MT470197, with MT470194 and MT470195 encoding the light and heavy chain of CA1; and MT470196 and MT470197 encoding the light and heavy chain of CB6.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof, wherein at least one of the anti-SARS-CoV-2 antibody is an anti-SARS-CoV-2 antibody described herein, and the other antibody is CA1 or CB6.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof, wherein at least one of the anti-SARS-CoV-2 antibody is 555, and the other antibody is CB6.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof, wherein at least one antibody or antigen-binding fragment thereof binds the RBD of the SARS-CoV-2 S protein, and at least one antibody or antigen-binding fragment thereof binds the NTD or S2 domain of the SARS-CoV-2 S protein.
- compositions comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof that are both ACE2-blocking and bind to an epitope in the receptor-binding domain (RBD) or the N-terminal domain (NTD) of the SARS-CoV-2 S protein.
- RBD receptor-binding domain
- NTD N-terminal domain
- At least one antibody or antigen-binding fragment thereof comprises: (i) three CDRs in the VH set forth as SEQ ID NO: 729 and three CDRs in the VL set forth as SEQ ID NO: 730; (ii) three CDRs in the VH set forth as SEQ ID NO: 779 and three CDRs in the VL set forth as SEQ ID NO: 780; (iii) three CDRs in the VH set forth as SEQ ID NO: 1039 and three CDRs in the VL set forth as SEQ ID NO: 1040; (iv) three CDRs in the VH set forth as SEQ ID NO: 1107 and three CDRs in the VL set forth as SEQ ID NO: 1108; (v) three CDRs in the VH set forth as SEQ ID NO: 1121 and three CDRs in the VL set forth as SEQ ID NO: 1122; (vi) three CDRs in the VH set forth as SEQ ID NO: 1133 and three CDRs in
- At least one antibody or antigen-binding fragment thereof that is both ACE2-blocking and binds to an epitope in the receptor-binding domain (RBD) or the N- terminal domain (NTD) of the SARS-CoV-2 S protein comprises: (i) the VH set forth as SEQ ID NO: 729 and the VL set forth as SEQ ID NO: 730; (ii) the VH set forth as SEQ ID NO: 779 and the VL set forth as SEQ ID NO: 780; (iii) the VH set forth as SEQ ID NO: 1039 and the VL set forth as SEQ ID NO: 1040; (iv) the VH set forth as SEQ ID NO: 1107 and the VL set forth as SEQ ID NO: 1108; (v) the VH set forth as SEQ ID NO: 1121 and the VL set forth as SEQ ID NO: 1122; (vi) the VH set forth as SEQ ID NO: 1133 and the VL set forth as SEQ
- anti-coronavirus antibodies are neutralizing antibodies.
- the anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- the anti-coronavirus antibodies may be conjugated, linked, or otherwise associated with selected cytotoxic agents, polymers, biological response modifiers or the like to provide passive immunotherapy with various (and optionally multiple) mechanisms of action.
- Donors who have been infected with (and have recovered from) SARS-CoV-2 are an ideal source of immune cells to discover, test, develop and manufacture antibodies as therapeutic treatments, prophylactic countermeasures, and diagnostic reagents to rapidly address emerging and recurring viral threats.
- Such antibodies can be discovered from a blood sample drawn from a donor that has been infected with SARS-CoV-2, a minimum of 2 weeks, e.g., a minimum of 7-8 weeks, prior to the blood draw.
- the earliest confirmed patients, and even index patients can be a source of therapeutic, prophylactic, and diagnostic antibodies, using a minimally-invasive blood draw.
- anti-coronavirus antibodies e.g., anti- SARS-CoV-2 antibodies
- anti-coronavirus antibody may be used in conjugated or unconjugated form. That is, the anti- coronavirus antibody (e.g., anti-SARS-CoV-2 antibody) may be associated with or conjugated to (e.g.
- conjugates may comprise peptides, polypeptides, proteins, fusion proteins, nucleic acid molecules, small molecules, mimetic agents, synthetic drugs, inorganic molecules, organic molecules, and radioisotopes.
- a conjugate may be covalently or non-covalently linked to the anti-coronavirus antibody (e.g., anti-SARS-CoV-2 antibody) in various molar ratios depending, at least in part, on the method used to effect the conjugation.
- anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- antibody or “immunoglobulin” are used interchangeably and in the broadest sense and cover both intact molecules and immunologically-reactive fragments thereof. These terms cover, for example, synthetic antibodies, monoclonal antibodies, oligoclonal or polyclonal antibodies, multiclonal antibodies, recombinantly produced antibodies, intrabodies, multispecific antibodies, bispecific antibodies, monovalent antibodies, multivalent antibodies, human antibodies, humanized antibodies, chimeric antibodies, CDR-grafted antibodies, primatized antibodies, Fab fragments, F(ab') fragments, F(ab') 2 fragments, F(ab)c fragments, single-chain FvFcs (scFvFc), single-chain Fvs (scFv), Dabs, nanobodies, anti-idiotypic (anti-Id) antibodies, and any other immunologically-reactive/antigen-binding fragments thereof.
- Antibodies are grouped into five distinct classes that can be distinguished biochemically, and, depending on the amino acid sequence of the constant domain of their heavy chains, can readily be assigned to the appropriate class.
- the major classes of intact antibodies are termed IgA, IgD, IgE, IgG, and IgM.
- the IgG and IgA classes may be further divided into recognized subclasses (isotypes), i.e., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2 depending on structure and certain biochemical properties. It will be appreciated that the IgG isotypes in humans are named in order of their abundance in serum with IgG1 being the most abundant.
- human IgG immunoglobulins comprise two identical light polypeptide chains of molecular weight approximately 23,000 Daltons, and two identical heavy chains of molecular weight 53,000-70,000 depending on the isotype.
- Heavy-chain constant domains that correspond to the different classes of antibodies are denoted by the corresponding lower case Greek letter ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
- the light chains of the antibodies from any vertebrate species can be assigned to one of two clearly distinct types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains.
- the four chains are joined by disulfide bonds in a "Y" configuration wherein the light chains bracket the heavy chains starting at the mouth of the "Y” and continuing through the variable region to the dual ends of the "Y".
- Each light chain is linked to a heavy chain by one covalent disulfide bond while two disulfide linkages in the hinge region join the heavy chains.
- the respective heavy and light chains also have regularly spaced intrachain disulfide bridges the number of which may vary based on the isotype of IgG.
- Each heavy chain has at one end a variable region (VH) followed by a number of constant regions.
- Each light chain has a variable region at one end (VL) and a constant region at its other end; the constant region of the light chain is aligned with the first constant region of the heavy chain, and the light chain variable region is aligned with the variable region of the heavy chain.
- the variable regions of both the light (VL) and heavy (VH) chain portions determine antigen recognition and specificity.
- the constant regions of the light chain (CL) and the heavy chain (C H 1, C H 2 or C H 3) confer and regulate important biological properties such as secretion, transplacental mobility, circulation half-life, complement binding, and the like.
- the numbering of the constant region regions increases as they become more distal from the antigen binding site or amino-terminus of the antibody.
- the amino or N-terminus of the antibody comprises the variable region and the carboxy or C-terminus comprises the constant region.
- CH3 and CL regions actually comprise the carboxy-terminus of the heavy and light chain, respectively.
- CDRs present on each arm of the antibody are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen-binding site as the antibody assumes its three-dimensional configuration in vivo or in vitro.
- CDRs encompass amino acid residues identified using any sequence or structure-based method or nomenclature system known in the art and as described below. [00136] By way of example, CDRs may be defined using the nomenclature described by Kabat et al.
- CDRs may also be defined using the nomenclature described by Chothia et al. (J. Mol. Biol. 196:901-917 (1987); Nature 342, pp.
- CDRs may also be defined using the nomenclature described by MacCallum et al. (J. Mol. Biol.
- CDRs vary considerably from antibody to antibody (and by definition will not exhibit homology with the Kabat consensus sequences). Maximal alignment of framework residues frequently requires the insertion of spacer residues in the numbering system, to be used for the Fv region. In addition, the identity of certain individual residues at any given Kabat site number may vary from antibody chain to antibody chain due to interspecies or allelic divergence.
- the framework regions comprise the remainder of the heavy and light chain variable regions and are thus comprised of a non-contiguous sequence between about 100-120 amino acids in length.
- framework region 4 corresponds to the region of the variable region from amino acids 103 to the end of the variable region.
- the framework region boundaries are separated by the respective CDR termini as described above.
- the framework regions show less inter-molecular variability in amino acid sequence and largely adopt a ⁇ -sheet conformation and the CDRs form loops which connect, and in some cases form part of, the ⁇ -sheet structure. Thus, these framework regions act to form a scaffold that provides for positioning the six CDRs in correct orientation by inter-chain, non-covalent interactions.
- the antigen-binding site formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non-covalent binding of the antibody to the immunoreactive antigen epitope.
- All or part of the heavy and light chain variable regions may be recombined or engineered using standard recombinant and expression techniques to provide improve one or more properties of the resultant antibody. That is, the heavy or light chain variable region from a first antibody (or any portion thereof) may be mixed and matched with any selected portion of the heavy or light chain variable region from a second antibody.
- the entire light chain variable region comprising the three light chain CDRs of a first antibody may be paired with the entire heavy chain variable region comprising the three heavy chain CDRs of a second antibody.
- individual heavy and light chain CDRs derived from various antibodies may be mixed and matched to provide the desired antibody having optimized characteristics.
- an exemplary antibody may comprise three light chain CDRs from a first antibody, two heavy chain CDRs derived from a second antibody and a third heavy chain CDR from a third antibody.
- compatible antibodies may comprise any immunoreactive antibody (as the term is defined herein) that provides the desired physiological response in a subject. While any of the disclosed antibodies may be used in conjunction with the present teachings, certain embodiments of the invention will comprise chimeric, humanized, or human monoclonal antibodies or immunoreactive fragments thereof. Yet other embodiments may, for example, comprise homogeneous or heterogeneous multimeric constructs, Fc variants and conjugated or glycosylationally-altered antibodies. Moreover, it will be understood that such configurations are not mutually exclusive and that compatible individual antibodies may comprise one or more of the functional aspects disclosed herein.
- a compatible antibody may comprise a single chain diabody with humanized variable regions or a fully human full length IgG3 antibody with Fc modifications that alter the glycosylation pattern to modulate serum half-life.
- Other exemplary embodiments are readily apparent to those skilled in the art and may easily be discernable as being within the scope of the invention.
- Antibodies produced by naive libraries can be of moderate affinity (K a of about 10 6 to 10 7 M -1 ), but affinity maturation can also be mimicked in vitro by constructing and reselecting from secondary libraries as described in the art. For example, mutations can be introduced at random in vitro by using error-prone polymerase.
- affinity maturation can be performed by randomly mutating one or more CDRs, e.g. using PCR with primers carrying random sequence spanning the CDR of interest, in selected individual Fv clones and screening for higher affinity clones.
- Another approach is to recombine the VH or VL regions selected by phage display with repertoires of naturally occurring variable region variants obtained from unimmunized donors and screen for higher affinity in several rounds of chain reshuffling. This technique allows the production of antibodies and antibody fragments with a dissociation constant Kd (koff/kon) of about 10 -9 M or less.
- Kd dissociation constant
- an antibody fragment comprises at least a portion of an intact antibody (e.g. a naturally occurring immunoglobulin). More particularly the term “fragment” refers to a part or portion of an antibody or antibody chain comprising fewer amino acid residues than an intact or complete antibody or antibody chain.
- antigen-binding fragment refers to a polypeptide fragment of an immunoglobulin or antibody that binds antigen or competes with intact antibody (i.e., with the intact antibody from which they were derived) for antigen binding (i.e., specific binding).
- antigen-binding fragments included an antibody light chain (V L ), an antibody heavy chain (V H ), a single chain antibody (scFv), a F(ab')2 fragment, a Fab fragment, an Fd fragment, an Fv fragment, single region antibody fragments, diabodies, linear antibodies, single-chain antibody molecules and multispecific antibodies formed from antibody fragments.
- V L antibody light chain
- V H antibody heavy chain
- scFv single chain antibody
- F(ab')2 fragment a single chain antibody
- Fab fragment an Fd fragment
- Fv fragment single region antibody fragments
- diabodies linear antibodies, single-chain antibody molecules and multispecific antibodies formed from antibody fragments.
- antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such fragments may be synthesized de novo either chemically or by using recombinant DNA methodology.
- papain digestion of antibodies produces two identical antigen- binding fragments, called Fab fragments, each with a single antigen-binding site, and a residual Fc fragment, whose name reflects its ability to crystallize readily.
- Pepsin treatment yields an F(ab')2 fragment that has two antigen-binding sites and is still capable of cross-linking antigen.
- the Fab fragment also contains the constant region of the light chain and the first constant region (C H 1) of the heavy chain.
- Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy-chain CH 1 region including one or more cysteines from the antibody hinge region.
- Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant regions bear at least one free thiol group.
- F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments that have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- an Fv fragment is an antibody fragment that contains a complete antigen recognition and binding site.
- This region is made up of a dimer of one heavy and one light chain variable region in tight association, which can be covalent in nature, for example in scFv. It is in this configuration that the three CDRs of each variable region interact to define an antigen binding site on the surface of the VH-VL dimer. Collectively, the six CDRs or a subset thereof confer antigen binding specificity to the antibody. However, even a single variable region (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although usually at a lower affinity than the entire binding site.
- an anti-coronavirus antibody fragment (e.g., anti-SARS-CoV-2 antibody fragment), for example, is one that comprises the Fc region, retains at least one of the biological functions normally associated with the Fc region when present in an intact antibody, such as FcRn binding, antibody half-life modulation, ADCC function and complement binding.
- an antibody fragment is a monovalent antibody that has an in vivo half-life substantially similar to an intact antibody.
- such an antibody fragment may comprise on antigen binding arm linked to an Fc sequence capable of conferring in vivo stability to the fragment.
- anti-coronavirus antibodies e.g., anti- SARS-CoV-2 antibodies
- valency refers to the number of potential binding sites associated with an antibody.
- Each target binding site specifically binds one target molecule or specific position or locus on a target molecule.
- an antibody of the instant invention comprises more than one target binding site (multivalent)
- each target binding site may specifically bind the same or different molecules (e.g., may bind to different ligands or different antigens, or different epitopes or positions on the same antigen).
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- each binding site of the molecule will specifically bind to a single position or epitope.
- the anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- the anti-coronavirus antibodies will be multivalent in that they comprise more than one binding site and the different binding sites specifically associate with more than a single position or epitope.
- the multiple epitopes may be present on a virion or infected cell displaying viral antigen or a single epitope may be present on one molecule while a second, different epitope may be present on another molecule or surface.
- multivalent antibodies may immunospecifically bind to different epitopes of the desired target molecule or may immunospecifically bind to both the target molecule as well as a heterologous epitope, such as a heterologous polypeptide or solid support material. While some anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) disclosed herein only bind two antigens (i.e. are bispecific antibodies), antibodies with additional specificities such as tri-specific antibodies are also encompassed. Examples of bispecific antibodies include, without limitation, those with one arm directed against a SARS-CoV or SARS-CoV-2 spike protein and the other arm directed against any other antigen. Methods for making bispecific antibodies are known in the art.
- antibody variable regions with the desired binding specificities are fused to immunoglobulin constant region sequences.
- the fusion preferably is with an immunoglobulin heavy chain constant region, comprising at least part of the hinge, CH2, and/or CH3 regions.
- the first heavy- chain constant region (CH1) containing the site necessary for light chain binding is present in at least one of the fusions.
- DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are co- transfected into a suitable host organism. This provides for great flexibility in adjusting the mutual proportions of the three polypeptide fragments in embodiments when unequal ratios of the three polypeptide chains used in the construction provide the optimum yields. It is, however, possible to insert the coding sequences for two or all three polypeptide chains in one expression vector when, the expression of at least two polypeptide chains in equal ratios results in high yields or when the ratios are of no particular significance.
- bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm and a hybrid immunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm. It was found that this asymmetric structure facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations, as the presence of an immunoglobulin light chain in only one half of the bispecific molecule provides for a facile way of separation.
- a pair of antibody molecules can be engineered to maximize the percentage of heterodimers that are recovered from recombinant cell culture.
- the preferred interface comprises at least a part of the C H 3 region of an antibody constant region.
- Bispecific antibodies also include cross-linked or heteroconjugate antibodies.
- Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents and techniques are well known in the art.
- variable or binding regions of anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- selected embodiments may also comprise substitutions or modifications of the constant region (i.e. the Fc region).
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- anti-coronavirus antibodies may contain one or more additional amino acid residue substitutions, mutations and/or modifications, which result in a compound with preferred characteristics including, but not limited to: altered pharmacokinetics, increased serum half-life, increase binding affinity, reduced immunogenicity, increased production, altered Fc ligand binding, enhanced or reduced ADCC or CDC activity, altered glycosylation and/or disulfide bonds and modified binding specificity.
- Fc region defines a C-terminal region of an immunoglobulin heavy chain, including native sequence Fc regions and variant Fc regions.
- the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
- the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
- a functional Fc region possesses an effector function of a native sequence Fc region.
- exemplary effector functions include C1 q binding; CDC; Fc receptor binding; ADCC; phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor; BCR), etc.
- Such effector functions generally require the Fc region to be combined with a binding region (e.g., an antibody variable region) and can be assessed using various assays as disclosed, for example, in definitions herein.
- a binding region e.g., an antibody variable region
- the term "Fc receptor" or FcR describes a receptor that binds to the Fc region of an antibody.
- an FcR is a native human FcR.
- an FcR is one that binds an IgG antibody (a gamma receptor) and includes receptors of the Fc ⁇ RI, Fc.RII, and Fc ⁇ RIII subclasses, including allelic variants and alternatively spliced forms of those receptors.
- Fc ⁇ ll receptors include Fc ⁇ RIIA (an activating receptor) and Fc ⁇ RIIB (an inhibiting receptor), which have similar amino acid sequences that differ primarily in the cytoplasmic regions thereof.
- Activating receptor Fey RIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic region.
- ITAM immunoreceptor tyrosine-based activation motif
- Inhibiting receptor FyRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic region.
- ITIM immunoreceptor tyrosine-based inhibition motif
- antibody-dependent cell-mediated cytotoxicity or ADCC refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g., Natural Killer (NK) cells, neutrophils, and macrophages) enables these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell with cytotoxins.
- FcRs Fc receptors
- NK Natural Killer
- cytotoxic cells e.g., neutrophils, and macrophages
- Variant anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- FcR binding affinity or ADCC activity are those that have either enhanced or diminished FcR binding activity and/or ADCC activity compared to a parent or unmodified antibody or to a modulator comprising a native sequence Fc region.
- a variant antibody that displays increased binding to an FcR binds at least one FcR with better affinity than the parent or unmodified antibody or to a modulator comprising a native sequence Fc region.
- a variant antibody that displays decreased binding to an FcR binds at least one FcR with worse affinity than the parent or unmodified antibody or to a modulator comprising a native sequence Fc region.
- Such variants which display decreased binding to an FcR may possess little or no appreciable binding to an FcR, e.g., 0-20% binding to the FcR compared to a native sequence IgG Fc region, e.g. as determined by techniques well known in the art.
- the anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- Fc variants with modifications to the constant region that provide half- lives e.g., serum half-lives
- a mammal preferably a human
- half- lives e.g., serum half-lives
- a mammal preferably a human
- the increased half-lives of the antibodies (or Fc containing molecules) of the present invention in a mammal, preferably a human, results in a higher serum titer of antibodies or antibody fragments in the mammal, and thus, reduces the frequency of the administration of antibodies or antibody fragments and/or reduces the concentration of antibodies or antibody fragments to be administered.
- Antibodies having increased in vivo half-lives can be generated by techniques known to those of skill in the art. For example, antibodies with increased in vivo half-lives can be generated by modifying (e.g., substituting, deleting, or adding) amino acid residues identified as involved in the interaction between the Fc region and the FcRn receptor.
- binding to human FcRn in vivo and serum half-life of human FcRn high affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates to which the polypeptides with a variant Fc region are administered.
- the anti-SARS-CoV-2 antibodies disclosed herein can encompass an Fc region with modifications that improve their half-lives (e.g., serum half-lives) in a human.
- N434A/Y436T/Q438R/S440E ACT1
- N434A/Y436V/Q438R/S440E ACT2
- M428L/N434A/Y436T/Q438R/S440E ACT3
- M428L/N434A/Y436V/Q438R/S440E ACT4
- M428L/N434A/Q438R/S440E e.g., N434A/Y436T/Q438R/S440E (ACT1)
- N434A/Y436V/Q438R/S440E ACT2
- M428L/N434A/Y436T/Q438R/S440E ACT3
- M428L/N434A/Y436V/Q438R/S440E ACT4
- M428L/N434A/Q438R/S440E ACT5
- the anti-SARS-CoV-2 antibodies disclosed herein comprise an Fc region comprising any set of mutations selected from ACT1, ACT2, ACT3, ACT4, or ACT5.
- the anti-SARS-CoV-2 antibodies disclosed herein comprise an Fc region comprising the ACT5 mutations: M428L/N434A/Q438R/S440E (positions numbered according to EU Index numbering).
- the anti-SARS-CoV-2 antibodies disclosed herein can comprise an Fc region comprising SEQ ID NO: 5367.
- glycosylation patterns or compositions of the anti- coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) disclosed herein are modified.
- preferred embodiments may comprise one or more engineered glycoforms, i.e., an altered glycosylation pattern or altered carbohydrate composition that is covalently attached to a molecule comprising an Fc region.
- Engineered glycoforms may be useful for a variety of purposes, including but not limited to enhancing or reducing effector function, increasing the affinity of the antibody for a target antigen or facilitating production of the antibody.
- the antibody may be engineered to express in an aglycosylated form.
- Such carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence.
- one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
- enhanced effector functions or improved binding may be imparted to the Fc containing molecule by engineering in one or more additional glycosylation sites.
- an Fc variant can be made that has an altered glycosylation composition, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNAc structures.
- Engineered glycoforms may be generated by any method known to one skilled in the art, for example by using engineered or variant expression strains, by co-expression with one or more enzymes (for example N-acetylglucosaminyltransferase III (GnTI11)), by expressing a molecule comprising an Fc region in various organisms or cell lines from various organisms or by modifying carbohydrate(s) after the molecule comprising Fc region has been expressed.
- the anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- the anti- coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- the anti-coronavirus antibodies comprise an Fc region comprising N-glycoside-linked sugar chains bound to the Fc region, wherein the sugar chains do not contain fucose.
- the anti-coronavirus antibodies e.g., anti- SARS-CoV-2 antibodies
- have increased ADCC activities compared to the same antibodies comprising N-glycoside-linked sugar chains that comprise fucose.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- anti-coronavirus antibody-producing cells e.g., human B cells, hybridomas or yeast colonies
- desirable characteristics including, for example, robust growth, high antibody production and, as discussed in more detail below, desirable antibody characteristics.
- Hybridomas can be expanded in vivo in syngeneic animals, in animals that lack an immune system, e.g., nude mice, or in cell culture in vitro. Methods of selecting, cloning and expanding hybridomas and/or colonies, each of which produces a discrete antibody species, are well known to those of ordinary skill in the art.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- anti-coronavirus antibodies may be characterized by their ability to neutralize virions via the recognition of viral surface antigens essential for receptor binding and/or entry into host cells.
- Anti-coronavirus antibodies may also be characterized by their ability to eliminate infected cells displaying viral antigens at their surface though complement-dependent cytotoxicity (CDC), antibody-dependent cellular phagocytosis (ADCP), or antibody-dependent cell-mediated cytotoxicity (ADCC).
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- ADCVI antibody-dependent, cell- mediated virus inhibition
- Anti-coronavirus antibodies may also be characterized by their epitope specificity or a number of different physical characteristics including, e.g., binding affinities, melting temperature (Tm), and isoelectric points.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- Tm melting temperature
- isoelectric points e.g., binding affinities, melting temperature (Tm)
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- neutralizing antibodies e.g., anti-SARS-CoV-2 antibodies
- neutralizing antibody refers to an antibody that binds to or interacts with a virion and prevents binding or association of the virion with a host cell and/or entry into a host cell or acts as an egress inhibitor insofar as the antibody may not appear to be a neutralizing antibody in a conventional in vitro neutralization assay, but the antibody still inhibits propagation of the viral infection.
- Examples of neutralization assays include conventional neutralization assays based on the inhibition of a virus cytopathic effect (CPE) on cells in culture. For example, neutralization may be tested by reducing or blocking formation of CPE in cells infected with SARS-CoV or SARS-CoV-2.
- CPE virus cytopathic effect
- Virus and antibody may be premixed before addition to cells, followed by measuring blocking of virus entry.
- Hemagglutinin inhibition (HI) may be tested in vitro and can detect the blocking of a virus' ability to bind to red blood cells.
- Antibodies that block the sialic acid receptor binding site will neutralize virus binding to cells, thereby blocking infection.
- Neutralization assays can also detect blocking of virus egress, as in the case of neuraminidase inhibitors like TAMIFLU®.
- the neutralization assay can be a pseudoneutralization assay, for example, as described in the Examples below.
- the neutralization assay can be a live virus neutralization assay, for example, as described in the Examples below.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- depleting antibody refers to an antibody binds to or associates a SARS-CoV-2 antigen on or near the surface of an infected cell and induces, promotes or causes the death, incapacitation or elimination of the cell (e.g., by complement-dependent cytotoxicity (CDC), antibody-dependent cellular cytotoxicity (ADCC), or antibody-dependent cellular phagocytosis (ADCP)).
- CDC complement-dependent cytotoxicity
- ADCC antibody-dependent cellular cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- a depleting antibody will be able to remove, incapacitate, eliminate, or kill at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 97%, or 99% of infected cells in a defined cell population.
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- Anti-coronavirus antibodies e.g., anti-SARS- CoV-2 antibodies
- Anti-coronavirus antibodies e.g., anti-SARS- CoV-2 antibodies
- epitope refers to that portion of the target antigen capable of being recognized and specifically bound by a particular antibody.
- Epitopes can be formed both from contiguous amino acids and noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained upon protein denaturing, whereas epitopes formed by tertiary folding are typically lost upon protein denaturing.
- An epitope typically includes at least 3, and more usually, at least 5 to 10 amino acids in a unique spatial conformation. More specifically, the skilled artisan will appreciate the term epitope includes any protein determinant capable of specific binding to an immunoglobulin or T-cell receptor or otherwise interacting with a molecule.
- Epitopic determinants generally consist of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and generally have specific three-dimensional structural characteristics, as well as specific charge characteristics. Additionally, an epitope may be linear or conformational. In a linear epitope, all of the points of interaction between the protein and the interacting molecule (such as an antibody) occur linearly along the primary amino acid sequence of the protein. In a conformational epitope, the points of interaction occur across amino acid residues on the protein that are linearly separated from one another.
- a desired epitope on an antigen it is possible to generate antibodies to that epitope, e.g., by immunizing with a peptide comprising the epitope using techniques known in the art.
- the generation and characterization of antibodies may elucidate information about desirable epitopes. From this information, it is then possible to competitively screen antibodies for binding to the same epitope.
- An approach to achieve this is to conduct competition studies to find antibodies that competitively bind with one another, i.e. the antibodies compete for binding to the antigen.
- a high throughput process for binning antibodies based upon their cross-competition is known in the art.
- the term "binning" refers to a method to group antibodies based on their antigen binding characteristics. The grouping is somewhat arbitrary, depending on how different the observed binding patterns of the antibodies tested. Thus, while the technique is a useful tool for categorizing antibodies, the bins do not always directly correlate with epitopes and such initial determinations of epitope binding should be further confirmed by other art recognized methodology. [00178] With this caveat one can determine whether a selected primary antibody (or fragment thereof) binds to the same epitope or cross competes for binding with a second antibody by using methods known in the art.
- one exposes virions or one or more infected cell(s) to a first antibody under saturating conditions and then measures the ability of a second antibody to bind to the same population of virions or cell(s). If the second antibody is able to bind, then the second antibody binds to a different epitope than the first antibody. However, if the second antibody is not able to bind, then the second antibody binds to the same epitope, an overlapping epitope, or an epitope that is in close proximity to the epitope bound by the first antibody.
- the desired data can be obtained using solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay, surface plasmon resonance, bio-layer interferometry, or flow cytometric methodology.
- RIA solid phase direct or indirect radioimmunoassay
- EIA solid phase direct or indirect enzyme immunoassay
- sandwich competition assay surface plasmon resonance, bio-layer interferometry, or flow cytometric methodology.
- the term "compete” means competition between antibodies as determined by an assay in which the antibody or immunologically-reactive fragment under test prevents or inhibits specific binding of a reference antibody to a common antigen.
- such an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabeled test immunoglobulin and a labeled reference immunoglobulin.
- Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test immunoglobulin. Usually the test immunoglobulin is present in excess.
- Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibody and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur. Additional details regarding methods for determining competitive binding are provided in the Examples herein. Usually, when a competing antibody is present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 40%, 45%, 50%, 55%, 60%, 65%, 70% or 75%.
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- Anti-coronavirus antibodies may also be characterized by their binding affinity.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- Kd dissociation constant
- the antibody specifically binds it antigen with high affinity when the Kd is ⁇ 5x 10 -9 M, and with very high affinity when the Kd is ⁇ 5x10 -10 M.
- the antibody has a K d of ⁇ 10 -9 M and an off-rate of about 1 x 10 -4 /sec. In other embodiments, the off-rate is ⁇ 1 x 10 -5 /sec. In other embodiments, the antibodies will bind with a Kd of between about 10 -8 M and 10 -10 M, and in yet other embodiments, antibodies bind with a K d ⁇ 2x 10 -10 M.
- Still other selected embodiments comprise antibodies that have a disassociation constant or K d (k off /k on ) of less than 10 -2 M, less than 5x10 -2 M, less than 10 -3 M, less than 5x10 -3 M, less than 10 -4 M, less than 5x10 -4 M, less than 10 -5 M, less than 5x10 -5 M, less than 10 -6 M, less than 5x10 -6 M, less than 10 -7 M, less than 5x10 -7 M, less than 10 -8 M, less than 5x10 -8 M, less than 10 -9 M, less than 5x10 -9 M, less than 10 -10 M, less than 5x10 -10 M, less than 10 -11 M, less than 5x10 -11 M, less than 10 -12 M, less than 5x10 -12 M, less than 10 -13 M, less than 5x10 -13 M, less than 10 -14 M, less than 5x10 -14 M, less than 10 -15 M, or less than 5x10 -15 M.
- an anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- its antigen e.g., on a virion or infected cell displaying a viral antigen
- an association rate constant or kon rate ((Ab) + antigen (Ag) k on ⁇ Ab-Ag) of at least 10 5 M -1 s -1 , at least 2x10 5 M -1 s -1 , at least 5x10 5 M -1 s -1 , at least 10 6 M -1 s -1 , at least 5x10 6 M -1 s -1 , at least 10 7 M -1 s -1 , at least 5x10 7 M -1 s -1 , or at least 10 8 M -1 s -1 .
- an anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- its antigen e.g., on a virion or infected cell displaying a viral antigen
- an anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- its antigen e.g., on a virion or infected cell displaying a viral antigen
- K a K on /k off
- at least 10 2 M -1 at least 5x 10 2 M -1 , at least 10 3 M -1 , at least 5x10 3 M -1 , at least 10 4 M -1 , at least 5xl0 4 M -1 , at least 10 5 M -1 , at least 5xl0 5 M -1 , at least 10 6 M -1 , at least 5x10 6 M -1 , at least 10 7 M -1 , at least 5xl 0 7 M -1 , at least 10 8 M -1 , at least 5x10 8 M- 1 , at least 10 9 M -1 , at least 5x10 9 M -1 , at least 10 10 M -1
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- Tm melting point
- the Tm of the Fab region of an antibody can be a good indicator of the thermal stability of an antibody and may further provide an indication of the shelf life. Tm is merely the temperature of 50% unfolding for a given region or sequence. A lower Tm indicates more aggregation/less stability, whereas a higher Tm indicates less aggregation/more stability. Thus, antibodies or fragments or derivatives having higher Tm are preferable.
- using art-recognized techniques it is possible to alter the composition of antibodies or regions thereof to increase or optimize molecular stability.
- Thermal melting temperatures (Tm) of a protein region can be measured using any standard method known in the art, e.g., by differential scanning calorimetry.
- the Fab region of an anti-coronavirus antibody (e.g., anti-SARS- CoV-2 antibody) disclosed herein has a Tm value higher than at least 50°C, 55°C, 60°C, 65°C, 70°C, 75°C, 80°C, 85°C, 90°C, 95°C, 100°C, 105°C, 110°C, 115°C or 120°C.
- the Fab region of an anti-coronavirus antibody disclosed herein has a Tm value higher than at least about 50°C, about 55°C, about 60°C, about 65°C, about 70°C, about 75°C, about 80°C, about 85°C, about 90°C, about 95°C, about 100°C, about 105°C, about 110°C, about 115°C or about 120°C.
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- pI isoelectric point
- solubility is typically lowest when the pH of the solution is equal to the isoelectric point (pi) of the protein. Therefore, it is possible to optimize solubility by altering the number and location of ionizable residues in the antibody to adjust the pI.
- the pI of a polypeptide can be manipulated by making the appropriate amino acid substitutions (e.g., by substituting a charged amino acid such as a lysine, for an uncharged residue such as alanine).
- amino acid substitutions of an antibody that result in changes of the pI of said antibody may improve solubility and/or the stability of the antibody.
- the pI of a protein may be determined by a variety of methods including but not limited to, isoelectric focusing and various computer algorithms.
- the pI of an anti-coronavirus antibody e.g., anti-SARS-CoV- 2 antibody
- the pI of an anti-coronavirus antibody (e.g., anti-SARS-CoV-2 antibody) disclosed herein is higher than about 6.5, 7.0, 7.5, 8.0, 8.5, or 9.0.
- substitutions resulting in alterations in the pI of an anti-coronavirus antibody e.g., anti-SARS- CoV-2 antibody
- substitution(s) of the Fc region that result in altered binding to Fc ⁇ R may also result in a change in the pI.
- substitution(s) of the Fc region are specifically chosen to effect both the desired alteration in Fc ⁇ R binding and any desired change in pI.
- the pI value is defined as the pI of the predominant charge form.
- nucleic Acids and Anti-Coronavirus Antibody Expression are also nucleic acids encoding a heavy chain or light chain, or a VH or VL, of the novel anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) disclosed herein, and vectors comprising one or more such nucleic acids.
- nucleic acid or “polynucleotide”, as used interchangeably herein, refer to polymers of nucleotides, including single-stranded and/or double-stranded nucleotide-containing molecules, such as DNA, cDNA and RNA molecules, incorporating native, modified, and/or analogs of, nucleotides.
- Polynucleotides of the present disclosure may also include substrates incorporated therein, for example, by DNA or RNA polymerase or a synthetic reaction.
- nucleic acids encoding a heavy chain or light chain of the anti-SARS-CoV-2 antibodies described herein e.g., any one of Abs 258-1329.
- nucleic acids encoding a VH or VL of the anti-SARS-CoV-2 antibodies described herein e.g., any one of Abs 258-1329.
- nucleic acids encoding a VH or VL comprising any one of SEQ ID NOs: 661-1320, 2751-4180, and 4749-5316. In some embodiments, provided herein are nucleic acids comprising a sequence from any one of SEQ ID NOs: 1-660, 1321-2750, and 4181-4748. [00190] In some embodiments, provided herein are nucleic acids encoding a heavy chain or light chain of the anti-SARS-CoV-2 antibodies described herein.
- nucleic acids encoding a heavy chain comprising SEQ ID NO: 5325, a light chain comprising SEQ ID NO: 5326, or both a heavy chain comprising SEQ ID NO: 5325 and a light chain comprising SEQ ID NO: 5326.
- DNA encoding the anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- DNA encoding the anti-coronavirus antibodies may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding antibody heavy and light chains). Isolated and subcloned hybridoma cells (or phage or yeast derived colonies) may serve as a preferred source of such DNA.
- the isolated DNA (which may be modified) can be used to clone constant and variable region sequences for the manufacture of antibodies.
- One exemplary method entails extraction of RNA from the selected cells, conversion to cDNA, and amplification by PCR using antibody specific primers. Suitable primers are well known in the art, and as exemplified herein, are readily available from numerous commercial sources. It will be appreciated that, to express a recombinant human or non-human antibody isolated by screening of a combinatorial library, the DNA encoding the antibody is cloned into a recombinant expression vector and introduced into host cells including mammalian cells, insect cells, plant cells, yeast, and bacteria.
- the modulators are introduced into and expressed by simian COS cells, NS0 cells, Chinese Hamster Ovary (CHO) cells or myeloma cells that do not otherwise produce the desired construct.
- simian COS cells NS0 cells
- Chinese Hamster Ovary (CHO) cells or myeloma cells that do not otherwise produce the desired construct.
- transformed cells expressing the desired modulator may be grown up in relatively large quantities to provide clinical and commercial supplies of the fusion construct or immunoglobulin.
- nucleic acid encoding an anti-coronavirus antibody e.g., anti-SARS-CoV- 2 antibody
- an anti-coronavirus antibody e.g., anti-SARS-CoV- 2 antibody
- yeast libraries e.g., yeast libraries
- hybridoma based technology e.g., synthetically, or from commercial sources
- the inventions disclosed herein encompass nucleic acid molecules and sequences encoding anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies), fusion proteins, or antigen- binding fragments or derivatives thereof.
- nucleic acids or nucleic acid molecules that hybridize under high stringency, or alternatively, under intermediate or lower stringency hybridization conditions (e.g., as defined below), to polynucleotides complementary to nucleic acids having a polynucleotide sequence that encodes a modulator of the invention or a fragment or variant thereof.
- nucleic acid molecule or isolated nucleic acid molecule as used herein, is intended to include at least DNA molecules and RNA molecules.
- a nucleic acid molecule may be single-stranded or double-stranded, but preferably is double-stranded DNA.
- the present invention comprises any vehicle or construct, incorporating such modulator encoding polynucleotide including, without limitation, vectors, plasmids, host cells, cosmids or viral constructs.
- isolated nucleic acid refers to a nucleic acid that was (i) amplified in vitro, for example by polymerase chain reaction (PCR), (ii) recombinantly produced by cloning, (iii) purified, for example by cleavage and gel-electrophoretic fractionation, or (iv) synthesized, for example by chemical synthesis.
- An isolated nucleic acid is a nucleic acid that is available for manipulation by recombinant DNA techniques.
- nucleic acids that encode anti-coronavirus antibodies e.g., anti- SARS-CoV-2 antibodies
- polynucleotides sufficient for use as hybridization probes PCR primers or sequencing primers for identifying, analyzing, mutating or amplifying a polynucleotide encoding a polypeptide
- anti-sense nucleic acids for inhibiting expression of a polynucleotide and complementary sequences of the foregoing are also encompassed herein.
- Such nucleic acids can be any length.
- nucleic acids can be, for example, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 750, 1,000, 1,500, 3,000, 5,000 or more nucleotides in length, and/or can comprise one or more additional sequences, for example, regulatory sequences, and/or be part of a larger nucleic acid, for example, a vector.
- These nucleic acids can be single-stranded or double-stranded and can comprise RNA and/or DNA nucleotides, and artificial variants thereof (e.g., peptide nucleic acids).
- the invention further provides nucleic acids that hybridize to other nucleic acids under particular hybridization conditions.
- a moderately stringent hybridization condition uses a prewashing solution containing 5x sodium chloride/sodium citrate (SSC), 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization buffer of about 50% formamide, 6xSSC, and a hybridization temperature of 55°C (or other similar hybridization solutions, such as one containing about 50% formamide, with a hybridization temperature of 42°C), and washing conditions of 60°C, in 0.5xSSC, 0.1 % SDS.
- a stringent hybridization condition hybridizes in 6xSSC at 45°C, followed by one or more washes in 0.1xSSC, 0.2% SDS at 68°C.
- nucleic acids comprising nucleotide sequences that are at least 65, 70, 75, 80, 85, 90, 95, 98 or 99% identical to each other typically remain hybridized to each other.
- substantially identical with regard to a nucleic acid sequence refers to a sequence of nucleotides exhibiting at least about 85%, or 90%, or 95%, or 97% sequence identity to the reference nucleic acid sequence.
- nucleic acids may be present alone or in combination with other nucleic acids, which may be homologous or heterologous.
- a nucleic acid is functionally linked to expression control sequences that may be homologous or heterologous with respect to that nucleic acid.
- nucleic acid such as a nucleic acid expressing RNA and/or protein or peptide, and an expression control sequence are functionally linked to one another, if they are covalently linked to one another in such a way that expression or transcription of the nucleic acid is under the control or under the influence of said expression control sequence.
- the expression control sequence includes promoters, ribosome binding sites, enhancers and other control elements that regulate transcription of a gene or translation of mRNA.
- the expression control sequences can be regulated.
- expression control sequences may vary as a function of the species or cell type, but generally comprises 5'-untranscribed and 5'- and 3'- untranslated sequences which are involved in initiation of transcription and translation, respectively, such as TATA box, capping sequence, CAAT sequence, and the like. More specifically, 5'-untranscribed expression control sequences comprise a promoter region that includes a promoter sequence for transcriptional control of the functionally linked nucleic acid. Expression control sequences may also comprise enhancer sequences or upstream activator sequences.
- promoter or “promoter region” relates to a nucleic acid sequence which is located upstream (5') to the nucleic acid sequence being expressed and controls expression of the sequence by providing a recognition and binding site for RNA-polymerase.
- the promoter region may include further recognition and binding sites for further factors that are involved in the regulation of transcription of a gene.
- a promoter may control the transcription of a prokaryotic or eukaryotic gene.
- a promoter may be inducible and may initiate transcription in response to an inducing agent or may be constitutive if transcription is not controlled by an inducing agent.
- Promoters for use in the production of anti-coronavirus antibodies include promoters for SP6, T3 and T7 polymerase, human U6 RNA promoter, CMV promoter, and artificial hybrid promoters thereof (e.g. CMV) where a part or parts are fused to a part or parts of promoters of genes of other cellular proteins such as e.g.
- human GAPDH glycosylcholine dehydrogenase
- expression is used in its most general meaning and comprises the production of RNA or of RNA and protein/peptide. It also comprises partial expression of nucleic acids. Furthermore, expression may be carried out transiently or stably.
- a nucleic acid molecule present in a vector, where appropriate with a promoter, which controls expression of the nucleic acid.
- the term "vector” is used here in its most general meaning and comprises any intermediary vehicle for a nucleic acid that enables the nucleic acid, for example, to be introduced into prokaryotic and/or eukaryotic cells and, where appropriate, to be integrated into a genome.
- Vectors of this kind are preferably replicated and/or expressed in the cells.
- Vectors may comprise plasmids, phagemids, bacteriophages or viral genomes.
- the term "plasmid” generally relates to a construct of extrachromosomal genetic material, usually a circular DNA duplex, which can replicate independently of chromosomal DNA.
- the expression vector is a glutamine synthetase (GS) expression vector.
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- the inventions disclosed herein also encompass progeny cells of such host cells, and anti-coronavirus antibodies (e.g., anti- SARS-CoV-2 antibodies) produced by the same.
- the host cell is a Chinese Hamster Ovary (CHO) cell.
- the term "recombinant host cell” or "host cell” means a cell into which a recombinant expression vector has been introduced.
- recombinant host cell and host cell mean not only the particular subject cell but also the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term host cell as used herein.
- Such cells may comprise a vector as described above.
- the inventions disclosed herein also encompass methods for making anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) disclosed herein. According to one embodiment, such a method comprises culturing a cell transfected or transformed with a vector as described above, and isolating the antibody.
- expression of an antibody preferably comprises expression vector(s) containing a polynucleotide that encodes the anti-coronavirus antibody.
- Methods that are well known to those skilled in the art can be used to construct expression vectors comprising antibody coding sequences and appropriate transcriptional and translational control signals. These methods include, for example, in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination.
- Particular embodiments provide replicable vectors comprising a nucleotide sequence encoding an anti-coronavirus antibody disclosed herein operably linked to a promoter.
- such vectors may include a nucleotide sequence encoding the heavy chain of an antibody molecule (or fragment thereof), a nucleotide sequence encoding the light chain of an antibody (or fragment thereof), or both the heavy and light chain.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- nucleic acid molecules encoding such antibodies may be integrated into well-known and commercially available protein production systems comprising various types of host cells to provide preclinical, clinical, or commercial quantities of the desired pharmaceutical product.
- nucleic acid molecules encoding the antibodies are engineered into vectors or expression vectors that provide for efficient integration into the selected host cell and subsequent high expression levels of the antibody.
- nucleic acid molecules encoding anti-coronavirus antibodies e.g., anti- SARS-CoV-2 antibodies
- vectors comprising these nucleic acid molecules can be used for transfection of a suitable mammalian, plant, bacterial or yeast host cell though it will be appreciated that prokaryotic systems may also be used. Transfection can be by any known method for introducing polynucleotides into a host cell.
- Methods for the introduction of heterologous polynucleotides into mammalian cells include dextran- mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei.
- nucleic acid molecules may be introduced into mammalian cells by viral vectors.
- Methods of transforming mammalian cells are well known in the art.
- Methods of transforming plant cells are also well known in the art, including, e.g., agrobacterium-mediated transformation, biolistic transformation, direct injection, electroporation, and viral transformation.
- the host cell may be co-transfected with two expression vectors of the invention, for example, the first vector encoding a heavy chain polypeptide and the second vector encoding a light chain polypeptide.
- the two vectors may contain identical selectable markers that enable substantially equal expression of heavy and light chain polypeptides.
- a single vector may be used which encodes, and is capable of expressing, both heavy and light chain polypeptides.
- the light chain is preferably placed before the heavy chain to avoid an excess of toxic free heavy chain.
- the coding sequences for the heavy and light chains may comprise cDNA or genomic DNA.
- host-expression vector systems may be used to express anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) disclosed herein.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- Such host-expression systems represent vehicles by which the coding sequences of interest may be expressed and subsequently purified, but also represent cells which may, when transformed or transfected with the appropriate nucleotide coding sequences, express a molecule of the invention in situ.
- Such systems include, but are not limited to, microorganisms such as bacteria (e.g., E. coli, B.
- subtilis, streptomyces transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing modulator coding sequences; yeast (e.g., Saccharomyces, Pichia) transfected with recombinant yeast expression vectors containing modulator coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing modulator coding sequences; plant cell systems (e.g., Nicotiana, Arabidopsis, duckweed, corn, wheat, potato, etc.) infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transfected with recombinant plasmid expression vectors (e.g., Ti plasmid) containing modulator coding sequences; or mammalian cell systems (e.g., COS, CHO, BHK, 293, 3T3 cells) harboring
- a number of expression vectors may be advantageously selected depending upon the use intended for the molecule being expressed. For example, when a large quantity of such a protein is to be produced, for the generation of pharmaceutical compositions, vectors which direct the expression of high levels of fusion protein products that are readily purified may be desirable.
- AcNPV Autographa californica nuclear polyhedrosis virus
- the virus grows in Spodoptera frugiperda cells.
- the coding sequences may be cloned individually into non-essential regions (for example, the polyhedrin gene) of the virus and placed under control of an AcNPV promoter (for example, the polyhedrin promoter).
- an AcNPV promoter for example, the polyhedrin promoter.
- a number of viral-based expression systems may be used to introduce the desired nucleotide sequence.
- the coding sequence of interest may be ligated to an adenovirus transcription/translation control complex, e.g., the late promoter and tripartite leader sequence. This chimeric gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination.
- Insertion in a non- essential region of the viral genome will result in a recombinant virus that is viable and capable of expressing the molecule in infected hosts.
- Specific initiation signals may also be required for efficient translation of inserted coding sequences. These signals include the ATG initiation codon and adjacent sequences. Furthermore, the initiation codon must be in phase with the reading frame of the desired coding sequence to ensure translation of the entire insert.
- These exogenous translational control signals and initiation codons can be of a variety of origins, both natural and synthetic. The efficiency of expression may be enhanced by the inclusion of appropriate transcription enhancer elements, transcription terminators, and the like.
- compatible mammalian cell lines available as hosts for expression are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC). These include, inter alia, Chinese hamster ovary (CHO) cells, NS0 cells, SP2 cells, HEK- 293T cells, 293 Freestyle cells (Life Technologies), NIH-3T3 cells, HeLa cells, baby hamster kidney (BHK) cells, African green monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, and a number of other cell lines.
- ATCC American Type Culture Collection
- cell lines that stably express the selected modulator may be engineered using standard art recognized techniques. Rather than using expression vectors that contain viral origins of replication, host cells can be transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker. Following the introduction of the foreign DNA, engineered cells may be allowed to grow for 1 to 2 days in an enriched media, and then are switched to a selective media.
- the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines.
- This method may advantageously be used to engineer cell lines which express the molecule.
- Such engineered cell lines may be particularly useful in screening and evaluation of compositions that interact directly or indirectly with the molecule.
- a number of selection systems are well known in the art and may be used including, but not limited to, the herpes simplex virus thymidine kinase, hypoxanthineguanine phosphoribosyltransferase, and adenine phosphoribosyltransferase genes can be employed in tk-, hgprt- or aprt- cells, respectively.
- antimetabolite resistance can be used as the basis of selection for the following genes: dhfr, which confers resistance to methotrexate; gpt, which confers resistance to mycophenolic acid; neo, which confers resistance to the aminoglycoside G- 418; and hygro, which confers resistance to hygromycin.
- Methods commonly known in the art of recombinant DNA technology may be routinely applied to select the desired recombinant clone. It will be appreciated by those of skill in the art that one particularly preferred method of establishing a stable, high yield cell line comprises the glutamine synthetase gene expression system (the GS system) which provides an efficient approach for enhancing expression under certain conditions.
- a host cell strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Such modifications (e.g., glycosylation) and processing (e.g., cleavage) of protein products may be important for the function and/or purification of the protein.
- Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products.
- appropriate cell lines or host systems can be chosen to ensure the desired modification and processing of the expressed polypeptide.
- eukaryotic host cells that possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product are particularly effective.
- some preferred mammalian host lines include, but are not limited to, CHO, VERY, BHK, HeLa, COS, NS0, MDCK, 293, 3T3, and W138.
- anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- those of skill in the art may easily select and optimize appropriate host cells for efficient expression of the antibody.
- anti-coronavirus antibodies e.g., anti- SARS-CoV-2 antibodies
- disclosed herein may be chemically synthesized using techniques known in the art.
- a peptide corresponding to a polypeptide fragment of the invention can be synthesized by use of a peptide synthesizer.
- non-genetically encoded amino acids or synthetic amino acids can be substituted or added into a polypeptide sequence.
- Non-genetically encoded amino acids include but are not limited to 2- aminoadipic acid; 3-aminoadipic acid; ⁇ -aminopropionic acid; 2-aminobutyric acid; 4- aminobutyric acid (piperidinic acid); 6-aminocaproic acid; 2-aminoheptanoic acid; 2- aminoisobutyric acid; 3-aminoisobutyric acid; 2-aminopimelic acid; 2,4-diaminobutyric acid; desmosine; 2,2'-diaminopimelic acid; 2,3-diaminopropionic acid; N-ethylglycine; N- ethylasparagine; hydroxylysine; allo-hydroxylysine; 3-hydroxyproline; 4-hydroxyproline; isodesmosine; allo-isoleucine; N-methylglycine (sarcosine); N-methylisoleucine; N-methylvaline; norvaline; norleucine;
- Representative synthetic amino acids include, for example, those molecules in which free amino groups have been derivatized to form amine hydrochlorides, p-toluene sulfonyl groups, carbobenzoxy groups, t-butyloxycarbonyl groups, chloroacetyl groups or formyl groups.
- Free carboxyl groups may be derivatized to form salts, methyl and ethyl esters or other types of esters or hydrazides.
- Free hydroxyl groups may be derivatized to form O-acyl or O-alkyl derivatives.
- the imidazole nitrogen of histidine may be derivatized to form N-im-benzylhistidine.
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- Anti-coronavirus antibodies can be produced transgenically through the generation of a mammal or plant that is transgenic for the immunoglobulin heavy and light chain sequences (or fragments or derivatives or variants thereof) of interest and production of the desired compounds in a recoverable form.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- non- human transgenic animals that comprise human immunoglobulin loci are immunized with SARS- CoV-2 virions or an immunogenic portion thereof, as described above.
- Non-human transgenic animals or plants may be produced by introducing one or more nucleic acid molecules encoding an anti-coronavirus antibody into the animal or plant by standard transgenic techniques.
- the transgenic cells used for making the transgenic animal can be embryonic stem cells or somatic cells or a fertilized egg.
- the transgenic non-human organisms can be chimeric, nonchimeric heterozygotes, and nonchimeric homozygotes.
- the transgenic non-human animals have a targeted disruption and replacement by a targeting construct that encodes, for example, a heavy chain and/or a light chain of interest.
- anti- coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- transgenic animal particularly preferred embodiments include mice, rats, sheep, pigs, goats, cattle, and horses.
- the non-human transgenic animal expresses the desired pharmaceutical product in blood, milk, urine, saliva, tears, mucus, and other bodily fluids from which it is readily obtainable using art recognized purification techniques.
- modulators, including antibodies, expressed by different cell lines or in transgenic animals will have different glycosylation patterns from each other.
- the instant inventions encompass anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) encoded by the nucleic acid molecules provided herein, or comprising the amino acid sequences provided herein, regardless of the glycosylation state of the molecule, and more generally, regardless of the presence or absence of post-translational modification(s).
- the instant inventions also encompass anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) that are differentially modified during or after translation, e.g., by glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc.
- Various post-translational modifications are also encompassed by the invention include, for example, e.g., N-linked or O- linked carbohydrate chains, processing of N-terminal or C-terminal ends), attachment of chemical moieties to the amino acid backbone, chemical modifications of N-linked or O-linked carbohydrate chains, and addition or deletion of an N-terminal methionine residue as a result of prokaryotic host cell expression.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- a detectable label such as an enzymatic, fluorescent, radioisotopic or affinity label to allow for their detection and isolation.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- they may be purified by any method known in the art for purification of immunoglobulins, or more generally by any other standard technique for the purification of proteins.
- the anti- coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- an "isolated anti-coronavirus antibody” is one that has been identified and separated and/or recovered from a component of its natural environment.
- Isolated anti- coronavirus antibodies include antibodies in situ within recombinant cells because at least one component of the antibody's natural environment will not be present.
- anti-coronavirus antibodies e.g., anti-SARS- CoV-2 antibodies
- the particulate debris either host cells or lysed fragments
- the particulate debris may be removed, for example, by centrifugation or ultrafiltration.
- supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter.
- a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
- compositions comprising anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) disclosed herein prepared from cells can be purified using, for example, hydroxyapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography.
- protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc region that is present in the selected construct.
- Protein A can be used to purify antibodies that are based on human IgG1, IgG2 or IgG4 heavy chains.
- Protein G is recommended for all mouse isotypes and for human IgG3.
- the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available.
- Mechanically-stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose.
- the BAKERBOND ABXTM resin is useful for purification.
- Other techniques for protein purification such as fractionation on an ion-exchange column, ethanol precipitation, reverse phase HPLC, chromatography on silica, chromatography on heparin, SEPHAROSE® chromatography on an anion or cation exchange resin (such as a polyaspartic acid column), chromatofocusing, SDS- PAGE and ammonium sulfate precipitation are also available depending on the antibody to be recovered.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- cDNA sequences encoding an anti-coronavirus antibody (e.g., anti-SARS-CoV-2 antibody) heavy chain and light chain may be cloned and engineered into a glutamine synthetase (GS) expression vector.
- the engineered immunoglobulin expression vector may then be stably transfected into CHO cells.
- Stable clones may be verified for expression of an antibody specifically binding to SARS-CoV spike protein or SARS-CoV-2 spike protein.
- Positive clones may be expanded into serum-free culture medium for antibody production in bioreactors.
- Medium, into which an antibody has been secreted may be purified by conventional techniques. For example, the medium may be conveniently applied to a Protein A or G SEPHAROSE® FF column that has been equilibrated with a compatible buffer, such as phosphate buffered saline. The column is washed to remove nonspecific binding components.
- the bound antibody is eluted, for example, by pH gradient and antibody fractions are detected, such as by SDS-PAGE, and then pooled.
- the antibody may be concentrated and/or sterile filtered using common techniques. Soluble aggregate and multimers may be effectively removed by common techniques, including size exclusion, hydrophobic interaction, ion exchange, or hydroxyapatite chromatography.
- the product may be immediately frozen, for example, at -70°C, or may be lyophilized.
- Anti-Coronavirus Antibody Conjugates [00230] Once anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) disclosed herein have been purified, they may be linked with, fused to, conjugated to (e.g., covalently or non- covalently) or otherwise associated with diagnostic moieties or biocompatible modifiers. As used herein the term "conjugate” means any molecule associated with an anti-coronavirus antibody (e.g., anti-SARS-CoV-2 antibody) disclosed herein regardless of the method of association.
- conjugates may comprise peptides, polypeptides, proteins, polymers, nucleic acid molecules, small molecules, mimetic agents, synthetic drugs, inorganic molecules, organic molecules and radioisotopes.
- the selected conjugate may be covalently or non-covalently linked to the antibody and exhibit various molar ratios depending, at least in part, on the method used to effect the conjugation.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- disclosed herein may be conjugated or associated with proteins, polypeptides or peptides that impart selected characteristics (e.g., biotoxins, biomarkers, purification tags, etc.).
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- a heterologous protein or polypeptide wherein the polypeptide comprises at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 amino acids.
- the construct does not necessarily need to be directly linked, but may occur through linker sequences.
- anti-coronavirus antibodies e.g., anti-SARS-CoV- 2 antibodies
- anti-coronavirus antibodies may be used to target heterologous polypeptides to virions or infected cells, either in vitro or in vivo, by fusing or conjugating the antibodies to other antibodies specific for other antigens.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- that are fused or conjugated to heterologous polypeptides may also be used in in vitro immunoassays and may be compatible with purification methodology known in the art.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- biocompatible modifiers that may be used to adjust, alter, improve, or moderate antibody properties.
- antibodies or fusion constructs with increased in vivo half-lives can be generated by attaching relatively high molecular weight polymer molecules such as commercially available polyethylene glycol (PEG) or similar biocompatible polymers.
- PEG polyethylene glycol
- Those skilled in the art will appreciate that PEG may be obtained in many different molecular weight and molecular configurations that can be selected to impart specific properties to the antibody (e.g. the half-life may be tailored).
- PEG can be attached to modulators or antibody fragments or derivatives with or without a multifunctional linker either through site-specific conjugation of the PEG to the N- or C-terminus of antibodies or via epsilon- amino groups present on lysine residues.
- Linear or branched polymer derivatization that results in minimal loss of biological activity may be used.
- the degree of conjugation can be closely monitored by SDS-PAGE and mass spectrometry to ensure optimal conjugation of PEG molecules to antibody molecules.
- Unreacted PEG can be separated from antibody-PEG conjugates by, e.g., size exclusion or ion-exchange chromatography.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- a diagnostic or detectable agent, marker or reporter which may be a biological molecule (e.g., a peptide or nucleotide), a small molecule, fluorophore, or radioisotope.
- Labeled modulators can be useful for monitoring the development or progression of SARS-CoV-2 infection or as part of a clinical testing procedure to determine the efficacy of a particular therapy including anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) disclosed herein (i.e. theragnostics), or to determine a future course of treatment.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- markers or reporters may also be useful in purifying anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) disclosed herein.
- Diagnosis and detection can be accomplished by coupling the modulator to detectable substances including, but not limited to, various enzymes comprising for example horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, such as but not limited to streptavidin/biotin and avidin/biotin; fluorescent materials, such as but not limited to, umbelliferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; luminescent materials, such as but not limited to, luminol; bioluminescent materials, such as but not limited to, luciferase, luciferin, and aequorin; radioactive materials, such as but not limited to iodine ( 131 I, 125 I, 123 I, 121 I,),
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- marker sequences such as a peptide or fluorophore to facilitate purification or diagnostic procedures such as immunohistochemistry or FACs.
- the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector, among others, many of which are commercially available.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- cytokine cytotoxic agent
- chemotherapeutic agent chemotherapeutic agent
- antiviral agent antimicrobial agent
- the inventions disclosed herein also encompass in vitro or in vivo methods for detecting, diagnosing or monitoring coronavirus infections and methods of screening cells from a patient to identify coronavirus infected cells, including cells from a patient who is currently infected with SARS-CoV-2, or cells from a patient who is recovered from a past SARS-CoV-2 infection.
- Such methods include identifying an individual infected with coronavirus for treatment, monitoring progression of a coronavirus infection comprising contacting the patient or a sample obtained from a patient with one or more anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) disclosed herein, and detecting the presence or absence, or level of association of the antibody to a coronavirus antigen in the sample.
- one or more anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- one or more anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- a patient sample e.g., plasma or blood.
- association with a coronavirus antigen in the sample likely denotes that the individual may be effectively treated with one or more anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) disclosed herein.
- the methods may further comprise a step of comparing the level of binding to a control.
- Other diagnostic or theragnostic methods compatible with the teachings herein are well known in the art and can be practiced using commercial materials such as dedicated reporting systems.
- Exemplary compatible assay methods include radioimmunoassays, enzyme immunoassays, competitive-binding assays, fluorescent immunoassay, immunoblot assays, Western Blot analysis, flow cytometry assays, and ELISA assays.
- More generally detection of coronavirus in a biological sample may be accomplished using any art-known assay.
- Compatible in vivo theragnostics or diagnostics may comprise art recognized imaging or monitoring techniques such as magnetic resonance imaging (MRI), computerized tomography (e.g. CAT scan), positron tomography (e.g., PET scan) radiography, ultrasound, etc.
- MRI magnetic resonance imaging
- CAT scan computerized tomography
- positron tomography e.g., PET scan
- ultrasound etc.
- the invention provides a method of analyzing coronavirus infection progression and/or pathogenesis in vivo.
- kits for detecting, monitoring, or diagnosing a coronavirus infection, identifying an individual having a coronavirus infection for possible treatment or monitoring progression (or regression) of the infection in a patient wherein the kit comprises an anti-coronavirus antibody as described herein, and reagents for detecting the effect of the anti-coronavirus antibody (e.g., anti- SARS-CoV-2 antibody) on a sample from the patient.
- the anti-coronavirus antibody e.g., anti- SARS-CoV-2 antibody
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- cells, cultures, populations and compositions comprising the same, including progeny thereof can also be used to screen for or identify compounds or agents (e.g., drugs) that affect a function or activity of coronavirus virions or coronavirus infected cells or progeny thereof by binding to an antigen present on the surface of the virion or infected cell.
- the inventions disclosed herein therefore encompass systems and methods for evaluation or identification of a compound or agent that can affect a function or activity of the coronavirus virus.
- Such compounds and agents can be drug candidates that are screened for the treatment of coronavirus infection, for example.
- a system or method comprises coronavirus virions and/or coronavirus infected cells and a compound or agent (e.g., drug), wherein the virions/cells and compound or agent (e.g., drug) are in contact with each other.
- a compound or agent e.g., drug
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- a vaccine such as an inactivated virus, live-attenuated vaccine, or recombinant subunit vaccine.
- such anti-SARS-CoV-2 antibodies or antigen binding fragments comprise: (i) three CDRs in the heavy chain variable region (VH) set forth as SEQ ID NO: 661 and three CDRs in the light chain variable region (VL) set forth as SEQ ID NO: 662; (ii) three CDRs in the VH set forth as SEQ ID NO: 727 and three CDRs in the VL set forth as SEQ ID NO: 728; (iii) three CDRs in the VH set forth as SEQ ID NO: 761 and three CDRs in the VL set forth as SEQ ID NO: 762; (iv) three CDRs in the VH set forth as SEQ ID NO: 867 and three CDRs in the VL set forth as SEQ ID NO: 868; (v) three CDRs in the VH set forth as SEQ ID NO: 1123 and three CDRs in the VL set forth as SEQ ID NO: 1124; (vi) three CDRs in the VH
- such anti-SARS-CoV-2 antibodies or antigen binding fragments comprise (i) a heavy chain variable region (VH) set forth as SEQ ID NO: 661 and a light chain variable region (VL) set forth as SEQ ID NO: 662; (ii) a VH set forth as SEQ ID NO: 727 and a VL set forth as SEQ ID NO: 728; (iii) a VH set forth as SEQ ID NO: 761 and a VL set forth as SEQ ID NO: 762; (iv) a VH set forth as SEQ ID NO: 867 and a VL set forth as SEQ ID NO: 868; (v) a VH set forth as SEQ ID NO: 1123 and a VL set forth as SEQ ID NO: 1124; (vi) a VH set forth as SEQ ID NO: 1167 and a VL set forth as SEQ ID NO: 1168; (vii) a VH set forth as SEQ ID NO: 1267 and
- amino acid sequences of the antibodies described in the foregoing paragraphs are provided below: 258-VH (SEQ ID NO:661) QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPAGKGLEWIGRIYTSGSTNYNPSLKSRVTMSVD TSKNQFSLKLSSVTAADTAVYYCAAGYGSIDYWGQGTLVTVSS 258-VL (SEQ ID NO:662) DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSG TDFTLKISRVEAEDVGVYYCMQALQTPRTFGQGTKLEIK 291-VH (SEQ ID NO:727) QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFT ISRDNSKNTLYLQMNSLRAEDT
- Methods of screening and identifying agents and compounds include those suitable for high-throughput screening, which include arrays of cells (e.g., microarrays) positioned or placed, optionally at pre-determined locations or addresses.
- High-throughput robotic or manual handling methods can probe chemical interactions and determine levels of expression of many genes in a short period of time. Techniques have been developed that utilize molecular signals (e.g., fluorophores) and automated analyses that process information at a very rapid rate.
- Such screening methods e.g., high-throughput
- Such screening methods can identify active agents and compounds rapidly and efficiently.
- cells can be positioned or placed (pre-seeded) on a culture dish, tube, flask, roller bottle or plate (e.g., a single multi-well plate or dish such as an 8, 16, 32, 64, 96, 384 and 1536 multi-well plate or dish), optionally at defined locations, for identification of potentially therapeutic molecules.
- Libraries that can be screened include, for example, small molecule libraries, phage display libraries, fully human antibody yeast display libraries, siRNA libraries, and adenoviral transfection vectors.
- compositions and Therapeutic Uses Provided herein are methods of treating or preventing a SARS-Co-V or SARS-Co-V- 2-linked disease (e.g., COVID-19) by administering to a patient a therapeutically effective amount of one or more anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) described herein, or a pharmaceutical composition comprising one or more (e.g., two or three) anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) described herein.
- a SARS-Co-V or SARS-Co-V- 2-linked disease e.g., COVID-19
- a pharmaceutical composition comprising one or more (e.g., two or three) anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) described herein.
- treatment or “treating” or “treat” refers to all processes wherein there may be a slowing, interrupting, arresting, controlling, stopping, alleviating or ameliorating symptoms or complications, or reversing of the progression of the disorders or disease disclosed herein, e.g., SARS-CoV-2 viral infection or COVID-19 disease, but does not necessarily indicate a total elimination of all disease or disorder symptoms.
- prevention refers to the prophylactic treatment of a disease or disorder, or delaying the onset or progression of the disease or disorder, e.g., SARS-CoV-2 viral infection or COVID- 19 disease.
- methods of treating or preventing a SARS-Co-V or SARS-Co- V-2-linked disease comprise administering to a patient a pharmaceutical composition comprising one or more (e.g., two or three) anti-SARS-CoV-2 antibodies described herein.
- such methods comprise administering to a patient a pharmaceutical composition comprising two or three anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof that bind different epitopes of the SARS-CoV-2 S protein. In some embodiments, such methods comprise administering to a patient a pharmaceutical composition comprising two or three anti-SARS-CoV-2 antibodies, wherein at least one of the antibodies is selected from antibodies 258 to 577 and 589 to 1587.
- such methods comprise administering to a patient a pharmaceutical composition comprising two or three anti-SARS-CoV- 2 antibodies, wherein at least one of the antibodies is selected from antibodies 292, 309, 364, 373, 388, 408, 414, 417, 419, 442, 445, 447, 462, 479, 481, 483, 488, 494, 506, 540, 549, 553, 555, and 562.
- such methods comprise administering to a patient a pharmaceutical composition comprising two or three anti-SARS-CoV-2 antibodies, wherein at least one of the antibodies is 555.
- such methods comprise administering to a patient a pharmaceutical composition comprising two or three anti-SARS-CoV-2 antibodies, wherein at least one of the antibodies neutralize SARS-CoV-2. In some embodiments, such methods comprise administering to a patient a pharmaceutical composition comprising two or three anti-SARS-CoV- 2 antibodies, wherein at least one antibody or antigen-binding fragment thereof blocks SARS- CoV-2 binding to ACE2. In some embodiments, such methods comprise administering to a patient a pharmaceutical composition comprising two or three anti-SARS-CoV-2 antibodies, wherein at least one antibody or antigen-binding fragment thereof binds the RBD of the SARS-CoV-2 S protein.
- such methods comprise administering to a patient a pharmaceutical composition comprising two or three anti-SARS-CoV-2 antibodies, wherein at least one antibody or antigen-binding fragment thereof binds the NTD domain of the SARS-CoV-2 S protein. In some embodiments, such methods comprise administering to a patient a pharmaceutical composition comprising two or three anti-SARS-CoV-2 antibodies, wherein at least one antibody or antigen- binding fragment thereof binds the S2 domain of the SARS-CoV-2 S protein.
- such methods comprise administering to a patient a pharmaceutical composition comprising two or three anti-SARS-CoV-2 antibodies, wherein at least one antibody or antigen- binding fragment thereof binds the RBD of the SARS-CoV-2 S protein and at least one antibody or antigen-binding fragment thereof binds the NTD or S2 domain of the SARS-CoV-2 S protein.
- a SARS- CoV-2-linked disease e.g., COVID-19
- administering to a patient an antibody comprises a heavy chain comprising SEQ ID NO: 5363 and a light chain comprising SEQ ID NO: 5364, or a pharmaceutical composition comprising such an antibody.
- such methods further comprise administering to the patient another antibody that binds the SARS-CoV- 2 S protein, e.g., CB-6.
- methods of treating or preventing a SARS-CoV-2-linked disease comprise administering to a patient a pharmaceutical composition comprising an antibody comprises a heavy chain comprising SEQ ID NO: 5363 and a light chain comprising SEQ ID NO: 5364, and at least one additional antibody that binds SARS-CoV-2 (e.g., CB6).
- an antibody comprises a heavy chain comprising SEQ ID NO: 5363 and a light chain comprising SEQ ID NO: 5364, or a pharmaceutical composition comprising such an antibody.
- such methods further comprise administering to the patient another antibody that binds the SARS-CoV- 2 S protein, e.g., CB-6.
- provided herein are methods of reducing COVID-19 related hospitalization or Emergency Room (ER) visit of a patient having COVID-19 by administering to the patient a therapeutically effective amount of an anti-SARS-CoV-2 antibody described herein or a pharmaceutical composition comprising such an antibody.
- methods of reducing COVID-19 related hospitalization or ER visit of a patient having COVID-19 by administering to the patient a therapeutically effective amount of an antibody comprises a heavy chain comprising SEQ ID NO: 5363 and a light chain comprising SEQ ID NO: 5364, or a pharmaceutical composition comprising such an antibody.
- an antibody comprises a heavy chain comprising SEQ ID NO: 5363 and a light chain comprising SEQ ID NO: 5364, and another anti-SARS-CoV-2 antibody (e.g., an antibody that binds the SARS- CoV-2 S protein, e.g., CB6).
- another anti-SARS-CoV-2 antibody e.g., an antibody that binds the SARS- CoV-2 S protein, e.g., CB6
- kits for treating or preventing COVID- 19 comprising: contacting a sample obtained from a patient with an antibody or antigen-binding fragment thereof described herein, conjugated to a detectable agent; detecting specific binding of the antibody or antigen-binding fragment thereof to a SARS-CoV-2 antigen present in the sample; and administering to the patient a therapeutically effective amount of an antibody or antigen- binding fragment thereof described herein or a pharmaceutical composition comprising such an antibody or antigen-binding fragment thereof.
- the patient has moderate to severe COVID-19, but is not hospitalized. In some embodiments, the patient has mild to moderate COVID-19.
- mild COVID-19 patients can include individuals who have any of various signs and symptoms, e.g., fever, cough, sore throat, malaise, headache, muscle pain, without shortness of breath, dyspnea, or abnormal imaging.
- Moderate COVID-19 patients can include individuals who have evidence of lower respiratory disease by clinical assessment or imaging and a saturation of oxygen (SaO2) greater than (>)93 percent (%) on room air at sea level.
- the patient is at risk for contracting COVID-19.
- the patient has a positive SARS-CoV- 2 viral testing result.
- the patient is an adult or pediatric patient who is 12 years of age and older and weigh at least 40 kilograms (kg).
- the patient is at high risk for progressing to severe COVID-19 and/or hospitalization, e.g., the patient (i) is 65 years of age or older ( ⁇ 65); (ii) has a body mass index (BMI) of 35 or greater ( ⁇ 35); (iii) has chronic kidney disease; (iv) has diabetes; (v) has immunosuppressive disease, (vi) is receiving immunosuppressive treatment; (vii) is 55 years of age or older ( ⁇ 55) and has cardiovascular disease, hypertension, chronic obstructive pulmonary disease, or other chronic respiratory disease; or (viii) is 12 – 17 years of age and have a BMI ⁇ 85% for their age and gender, or sickle cell disease, congenital or acquired heart disease, neurodevelopmental disorders (e.g., cerebral palsy), a medical-related technological dependence (e.g., tracheostomy, gastrostomy, or positive pressure ventilation not related to COVID-19), or asthma, reactive airway or other chronic respiratory disease that requires daily medication
- BMI
- the patient has mild to moderate COVID-19 and the patient is at high risk for progressing to severe COVID-19 and/or hospitalization, e.g., the patient (i) is 65 years of age or older ( ⁇ 65); (ii) has a body mass index (BMI) of 35 or greater ( ⁇ 35); (iii) has chronic kidney disease; (iv) has diabetes; (v) has immunosuppressive disease, (vi) is receiving immunosuppressive treatment; (vii) is 55 years of age or older ( ⁇ 55) and has cardiovascular disease, hypertension, chronic obstructive pulmonary disease, or other chronic respiratory disease; or (viii) is 12 – 17 years of age and have a BMI ⁇ 85% for their age and gender, or sickle cell disease, congenital or acquired heart disease, neurodevelopmental disorders (e.g., cerebral palsy), a medical-related technological dependence (e.g., tracheostomy, gastrostomy, or positive pressure ventilation not related to COVID-19), or asthma, reactive
- BMI
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- antigen-binding fragments or pharmaceutical compositions comprising one or more (e.g., two or three) anti-coronavirus antibodies (e.g., anti-SARS-CoV-2 antibodies) or antigen-binding fragments, for use in therapy.
- anti-SARS-CoV-2 antibodies or antigen- binding fragments or pharmaceutical compositions comprise one or more (e.g., two or three) anti- SARS-CoV-2 antibodies or antigen-binding fragments, for use in the treatment or prevention of COVID-19.
- anti-coronavirus antibodies e.g., anti-SARS-CoV- 2 antibodies
- antigen-binding fragments described herein in the manufacture of a medicament for the treatment or prevention of COVID-19.
- anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- mode of intended delivery e.g., mode of intended delivery
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- Various pharmaceutically acceptable carriers which include vehicles, adjuvants, and diluents, are readily available from numerous commercial sources.
- anti-coronavirus antibodies may be administered to a patient neat or with a minimum of additional components.
- anti-coronavirus antibodies may be formulated to contain suitable pharmaceutically acceptable carriers comprising excipients and auxiliaries that are well known in the art and are relatively inert substances that facilitate administration or which aid processing of the active compounds into preparations that are pharmaceutically optimized for delivery.
- excipients can give form or consistency or act as a diluent to improve the pharmacokinetics of the antibody.
- excipients include but are not limited to stabilizing agents, wetting, and emulsifying agents, salts for varying osmolality, encapsulating agents, buffers, and skin penetration enhancers.
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- Suitable lipophilic solvents or vehicles include fatty oils, for example, sesame oil, or synthetic fatty acid esters, for example, ethyl oleate or triglycerides.
- Aqueous injection suspensions may contain substances that increase the viscosity of the suspension and include, for example, sodium carboxymethyl cellulose, sorbitol, and/or dextran. Optionally, the suspension may also contain stabilizers. Liposomes can also be used to encapsulate the agent for delivery into the cell.
- Suitable formulations for enteral administration include hard or soft gelatin capsules, pills, tablets, including coated tablets, elixirs, suspensions, syrups or inhalations and controlled release forms thereof.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- compositions may be formulated into preparations in solid, semi-solid, liquid, or gaseous forms; including, but not limited to, tablets, capsules, powders, granules, ointments, solutions, suppositories, enemas, injections, inhalants, and aerosols.
- the appropriate formulation and route of administration may be selected according to the intended application and therapeutic regimen.
- the pharmaceutical compositions described herein comprise one or more anti-SARS-CoV-2 antibodies.
- the pharmaceutical compositions further comprise one or more of the following excipients: histidine, sodium chloride, sucrose, polysorbate 80.
- the pharmaceutical compositions comprise at least one anti-SARS-CoV-2 antibody (e.g., 555), histidine, sodium chloride, sucrose, polysorbate 80. In some embodiments, the pharmaceutical compositions have a pH of about 6.0. In some embodiments, the pharmaceutical composition comprises at least one anti-SARS-CoV-2 antibody (e.g., 555), 5 mM histidine, 50 mM NaCl, 6% sucrose, and 0.05% polysorbate 80 and has a pH of about 6.0. In some embodiments, the anti-SARS-COV-2 antibody concentration in the pharmaceutical composition is about 10 mg/mL to about 150 mg/mL.
- the anti-SARS-COV-2 antibody concentration in the pharmaceutical composition is about 35 mg/mL to about 125 mg/mL. In some embodiments, the anti-SARS-COV-2 antibody concentration in the pharmaceutical composition is about 35 mg/mL. In some embodiments, the anti-SARS-COV-2 antibody concentration in the pharmaceutical composition is about 125 mg/mL.
- the particular dosage regimen i.e., dose, timing, and repetition, will depend on the particular individual and that individual's medical history. Empirical considerations such as pharmacokinetics (e.g., half-life, clearance rate, etc.) will contribute to the determination of the dosage.
- Frequency of administration may be determined and adjusted over the course of therapy, and is based on reducing the number of hyperproliferative or neoplastic cells, including tumor initiating cells, maintaining the reduction of such neoplastic cells, reducing the proliferation of neoplastic cells, or delaying the development of metastasis.
- sustained continuous release formulations of a subject therapeutic composition may be appropriate.
- Various formulations and devices for achieving sustained release are known in the art.
- Pharmaceutical compositions are administered in therapeutically effective amount for treatment or prophylaxis of a coronavirus infection.
- the term "therapeutically effective amount” means that amount of an anti-coronavirus antibody (e.g., anti-SARS-CoV-2 antibody) or pharmaceutical composition comprising the same that will elicit the biological or medical response in a subject that is sought by a medical doctor or other clinician.
- an anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- pharmaceutical composition comprising the same that will elicit the biological or medical response in a subject that is sought by a medical doctor or other clinician.
- a "therapeutically effective amount” is intended to include an amount sufficient to achieve one or more of the following effects: (i) reduction or amelioration the severity of a viral infection, viral disease or a symptom associated therewith; (ii) reduction in the duration of a viral infection, viral disease, or a symptom associated therewith; (iii) prevention of the progression of a viral infection, viral disease, or a symptom associated therewith; (iv) regression of a viral infection, viral disease, or a symptom associated therewith; (v) prevention of the development or onset of a viral infection, viral disease, or a symptom associated therewith; (vi) prevention of the recurrence of a viral infection, viral disease, or a symptom associated therewith; (vii) reduction or prevention of the spread of coronavirus from one cell to another cell, one tissue to another tissue, or one organ to another organ; (viii) prevention or reduction of the spread/transmission of coronavirus from one subject to another subject
- a therapeutically effective amount of an anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- pharmaceutical composition comprising the same has a beneficial effect but does not cure a viral infection or a disease associated therewith.
- therapy may encompass the administration of multiple doses of an anti- coronavirus antibody (e.g., anti-SARS-CoV-2 antibody) or pharmaceutical composition comprising the same at a certain frequency to achieve an amount of the therapy that has a prophylactic and/or therapeutic effect.
- coronavirus and other viral infections include fever, cough and/or sore throat, runny or stuffy nose, headache and/or body aches, chills, fatigue, generalized weakness, nausea, and vomiting and/or diarrhea.
- a therapeutically effective amount is typically dependent on the weight of the subject being treated, his or her physical condition, the extensiveness of the condition to be treated, and the age of the subject being treated.
- anti-coronavirus antibodies e.g., anti-SARS-CoV- 2 antibodies
- disclosed herein may be administered in an amount in the range of about 10 ng/kg body weight to about 100 mg/kg body weight per dose.
- antibodies may be administered in an amount in the range of about 50 ⁇ g/kg body weight to about 5 mg/kg body weight per dose. In other embodiments, antibodies may be administered in an amount in the range of about 100 ⁇ g/kg body weight to about 10 mg/kg body weight per dose. In other embodiments, antibodies may be administered in an amount in the range of about 100 ⁇ g/kg body weight to about 20 mg/kg body weight per dose. In other embodiments, antibodies may be administered in an amount in the range of about 0.5 mg/kg body weight to about 20 mg/kg body weight per dose.
- antibodies may be administered in a dose of at least about 100 ⁇ g/kg body weight, at least about 250 ⁇ g/kg body weight, at least about 750 ⁇ g/kg body weight, at least about 3 mg/kg body weight, at least about 5 mg/kg body weight, or at least about 10 mg/kg body weight.
- an anti-SARS-CoV-2 antibody or a pharmaceutical composition comprising such an antibody is administered intravenously or subcutaneously to a patient at a dose of about 100 mg to about 10,000 mg.
- an anti-SARS-CoV-2 antibody e.g., 555
- a pharmaceutical composition comprising such an antibody is administered intravenously or subcutaneously to a patient at a dose of about 700 mg to about 7000 mg (e.g., about 700 mg, about 750 mg, about 800 mg, about 850 mg, about 900 mg, about 950 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, about 1600 mg, about 1700 mg, about 1800 mg, about 1900 mg, about 2000 mg, about 2100 mg, about 2200 mg, about 2300 mg, about 2400 mg, about 2500 mg, about 2600 mg, about 2700 mg, about 2800 mg, about 2900 mg, about 3000 mg, about 3100 mg, about 3200 mg, about 3300 mg, about 3400 mg, about 3500 mg, about 3600 mg, about 3700 mg, about 3800 mg, about 3900 mg, about 4000 mg, about 4100 mg, about 4200 mg, about
- an anti-SARS-CoV-2 antibody e.g., 555
- a pharmaceutical composition comprising such an antibody is administered intravenously or subcutaneously to a patient at a dose of about 700 mg, 1400 mg, 2800 mg, 4200 mg, 5600 mg, or 7000 mg.
- an anti-SARS-CoV-2 antibody e.g., 555
- a pharmaceutical composition comprising such an antibody is administered intravenously or subcutaneously to a patient at a dose of about 35 mg to about 700 mg (e.g., about 35 mg, about 70 mg, about 105 mg, about 140 mg, about 150 mg, about 175 mg, about 210 mg, about 245 mg, about 280 mg, about 315 mg, about 350 mg, 385 mg, 420 mg, 455 mg, 490 mg, 525 mg, 560 mg, 595 mg, 630 mg, 665 mg, or 700 mg).
- about 35 mg to about 700 mg e.g., about 35 mg, about 70 mg, about 105 mg, about 140 mg, about 150 mg, about 175 mg, about 210 mg, about 245 mg, about 280 mg, about 315 mg, about 350 mg, 385 mg, 420 mg, 455 mg, 490 mg, 525 mg, 560 mg, 595 mg, 630 mg, 665 mg, or 700 mg
- an anti-SARS-CoV-2 antibody e.g., 555 or a pharmaceutical composition comprising such an antibody
- a pharmaceutical composition comprising such an antibody is administered intravenously or subcutaneously to a patient at a dose of about 70 mg, 140 mg, 150 mg, 175mg, 210 mg, 280 mg, 350 mg, 420 mg, 490mg, 560 mg, or 630 mg.
- an anti-SARS-CoV-2 antibody (e.g., 555) or a pharmaceutical composition comprising such an antibody is administered intravenously or subcutaneously to a patient at a dose of about 700 mg.
- an anti-SARS-CoV- 2 antibody e.g., 555 or a pharmaceutical composition comprising such an antibody
- an anti-SARS-CoV-2 antibody e.g., 555
- a pharmaceutical composition comprising such an antibody is administered intravenously or subcutaneously to a patient at a dose of about 175 mg.
- an anti-SARS-CoV-2 antibody e.g., 555
- a pharmaceutical composition comprising such an antibody is administered intravenously or subcutaneously to a patient at a dose of about 150 mg.
- BSA Body Surface Area
- antibodies are administered in dosages from 50 mg/m 2 to 500 mg/m 2 and even more preferably at dosages of 100 mg/m 2 , 150 mg/m 2 , 200 mg/m 2 , 250 mg/m 2 , 300 mg/m 2 , 350 mg/m 2 , 400 mg/m 2 or 450 mg/m 2 .
- Escalation for an individual patient can occur at the discretion of a clinician in the absence of any clinically significant occurrence that the clinician might reasonably believe would present an undue safety risk for the patient, such as, for example, Grade ⁇ 3 non-hematologic toxicity, Grade ⁇ 3 nausea, vomiting or diarrhea uncontrolled by maximum antiemetic/anti- diarrhea therapy, Grade 4 neutropenia lasting > 7 days in the absence of growth factor support, Grade 3 or 4 neutropenia of any duration accompanied with fever ⁇ 38.5 o C and/or systemic infection, or other Grade ⁇ 4 hematologic toxicity.
- Anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- An exemplary treatment regimen entails administration once per every two weeks, once a month, or once every 3 to 6 months.
- patients can receive the antibody (e.g., as an intravenous formulation) once every four weeks as a cycle, for example every twenty-eight days.
- the dosing frequency can be adjusted depending on the pharmacokinetic profile of the antibody in the patient. For example, the half-life of the antibody may warrant a two week frequency of dosing.
- two or more antibodies with different binding specificities may be administered simultaneously, in which case the dosage of each antibody administered falls within the ranges indicated.
- Intervals between single dosages can be weekly, monthly, or yearly. Intervals can also be irregular depending upon levels of antibody in the blood and other clinical indicia.
- the dosage is adjusted to achieve a plasma antibody concentration of about 1–1000 mg/mL or about 25–300 mg/mL.
- antibodies can be administered as a sustained release formulation, in which case less frequent administration is required.
- Antibodies may be administered to the patient for at least 9 months, at least 12 months, or for a longer period of time to achieve a desired result.
- Dosage and frequency vary depending on the half-life of the antibody in the patient. In general, human antibodies show the longest half-life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time.
- a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, until a partial or complete response is achieved, and/or until the patient shows lessening or amelioration of symptoms of disease. Thereafter, the patent can be administered a prophylactic regime.
- the duration of a therapeutic regimen depends on the disease being treated, the age and condition of the patient, the stage and type of the patient's disease, how the patient responds to the treatment, etc. A clinician can observe the therapy's effects closely and make any adjustments as needed.
- the two or more therapeutic agents are administered simultaneously or sequentially in any order, i.e., an antibody disclosed herein is administered prior to administering a second therapeutic agent, concurrently with a second therapeutic agent, or subsequent to administration of a second therapeutic agent.
- a combination therapy may be performed by administering a first therapeutic agent prior to (e.g., 1 minute, 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concurrently with, or subsequent to (e.g., 1 minute, 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) administering a second therapeutic agent.
- a first therapeutic agent prior to (e.g., 1 minute, 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks
- each component of a combination therapy can be controlled independently.
- one therapeutic agent may be administered orally three times per day, while the second therapeutic agent may be administered intramuscularly once per day.
- Combination therapy may be given in on-and-off cycles that include rest periods.
- the compounds may also be admixed or otherwise formulated together such that one administration delivers both therapeutic agents.
- each therapeutic agent is generally present in an amount of 1-95% by weight of the total weight of the composition.
- therapeutic agents can be formulated separately and in individual dosage amounts.
- Combinations of therapeutic agents for treatment can be provided as components of a pharmaceutical pack.
- combination therapies elicit a synergistic therapeutic effect, i.e., an effect greater than the sum of their individual effects or therapeutic outcomes, such as those described above.
- a synergistic therapeutic effect may be an effect of at least about two-fold greater than sum of the therapeutic effects elicited by the single agents of a given combination, or at least about five-fold greater, or at least about ten-fold greater, or at least about twenty-fold greater, or at least about fifty-fold greater, or at least about one hundred-fold greater.
- a synergistic therapeutic effect may also be observed as an increase in therapeutic effect of at least 10% compared to the sum of the therapeutic effects elicited by the single agents of a given combination, or at least 20%, or at least 30%, or at least 40%, or at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 90%, or at least 100%, or more.
- a synergistic effect is also an effect that permits reduced dosing of therapeutic agents when they are used in combination.
- the inventions disclosed herein also encompass pharmaceutical packs and kits comprising one or more containers and comprising one or more doses of an anti-coronavirus (e.g., anti-SARS-CoV-2 antibody) disclosed herein.
- an anti-coronavirus e.g., anti-SARS-CoV-2 antibody
- a unit dosage wherein the unit dosage contains a predetermined amount of a composition comprising, for example, an anti-coronavirus antibody (e.g., anti-SARS-CoV-2 antibody) disclosed herein, with or without one or more additional agents.
- a composition comprising, for example, an anti-coronavirus antibody (e.g., anti-SARS-CoV-2 antibody) disclosed herein, with or without one or more additional agents.
- an anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- the composition contained in the unit dosage may comprise saline, sucrose, or the like; a buffer, such as phosphate, or the like; and/or be formulated within a stable and effective pH range.
- the composition may be provided as a lyophilized powder that may be reconstituted upon addition of an appropriate liquid, for example, sterile water.
- the composition comprises one or more substances that inhibit protein aggregation, including, but not limited to, sucrose and arginine. Any label on, or associated with, the container(s) indicates that the enclosed composition is used for diagnosis or treatment.
- the present invention also provides kits for producing single-dose or multi-dose administration units of an anti-coronavirus antibody (e.g., an anti-SARS-CoV-2 antibody) disclosed herein and, optionally, one or more other diagnostic or therapeutic agents.
- the kit comprises a container and a label or package insert on or associated with the container.
- kits include, for example, bottles, vials, syringes, etc.
- the containers may be formed from a variety of materials such as glass or plastic.
- the container holds a composition that is effective for treating the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- kits will generally contain in a suitable container a pharmaceutically acceptable formulation of the anti-coronavirus antibody (e.g., anti-SARS-CoV-2 antibodies) and, optionally, one or more other diagnostic or therapeutic agents.in the same or different containers.
- the kits may also contain other pharmaceutically acceptable formulations, either for diagnosis or combined therapy.
- kits may also provide appropriate reagents to conjugate the anti-coronavirus antibody (e.g., anti- SARS-CoV-2 antibodies) with the other diagnostic or therapeutic agent(s).
- the kits may have a single container that contains the anti-coronavirus antibody (e.g., anti-SARS-CoV-2 antibody), with or without additional components, or they may have distinct containers for each desired agent.
- a single solution may be pre-mixed, either in a molar equivalent combination, or with one component in excess of the other.
- kits may also comprise a second/third container means for containing a sterile, pharmaceutically acceptable buffer or other diluent such as bacteriostatic water for injection (BWFI), phosphate-buffered saline (PBS), Ringer's solution and dextrose solution.
- BWFI bacteriostatic water for injection
- PBS phosphate-buffered saline
- Ringer's solution dextrose solution.
- kits may also contain a means by which to administer the antibody and any optional components to the patient, e.g., one or more needles or syringes, or even an eye dropper, pipette, or other such like apparatus, from which the formulation may be injected or introduced into the patient.
- kits will also typically include a means for containing the vials, or such like, and other component in close confinement for commercial sale, such as, e.g., injection or blow-molded plastic containers into which the desired vials and other apparatus are placed and retained.
- anti-coronavirus antibody e.g., anti-SARS-CoV-2 antibody
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- anti-coronavirus antibodies may be used in conjunction with, or comprise, diagnostic or therapeutic devices useful in the diagnosis or treatment of proliferative disorders.
- anti-coronavirus antibodies e.g., anti-SARS-CoV-2 antibodies
- certain diagnostic devices or instruments may be used to detect, monitor, quantify or profile cells or marker compounds involved in the etiology or manifestation a coronavirus infection.
- the samples were enriched for antibody-secreting B-cells and screened using single cell secretion assays, to enrich for antibodies that bind to recombinant SARS-CoV spike protein and/or SARS-CoV-2 spike protein using two different miniaturized single cell secretion assays: a multiplexed bead-based assay and a live-cell assay.
- the live cell assay is an ideal strategy to rapidly express and screen unknown antigens during a pandemic, without the need for recombinant protein expression and in-depth knowledge of the target.
- the bead assay unique antibody sequences were confirmed to bind the screening target (SARS-CoV-2 full length spike) using a multiplexed bead assay on high throughput flow cytometry.
- Different optically encoded bead types were conjugated to one of the following unique antigens: full length spike of SARS-CoV-2, MERS, SARS-CoV, HKU1, WIV1 or the S1 subunit of SARS-CoV-2 spike.
- Purified antibodies were incubated with the multiplexed beads, and negative control beads conjugated to BSA-His or FoldOn-Hisat either 50nM, 10nM or 2nM antibody concentration for 30 minutes at room temperature.
- CHO cells were transiently transfected to express the full length spike protein of either wild type or mutant (V483A, D614G, V367F) SARS-CoV-2 on the cell surface.
- Full length spike protein sequences of either wildtype or reported viral mutants V483A, D614G, V467F.
- SARS-CoV-2 and GFP inserts were cloned into the vector backbone pCDNA3.1.
- Suspension CHO cells were transiently transfected with the plasmid using electroporation.
- Full length native conformation spike protein expression was confirmed by testing with benchmark antibodies discovered against SARS-CoV that target different stalk and head domains using flow cytometry.
- Western blot was performed with a whole cell and plasma membrane isolate to confirm full length protein expression on the cell surface.
- Purified antibodies were incubated with the readout cells, and an untransfected control CHO line either at 50 nM, 10 nM or 2 nM antibody concentration for 30 minutes at 4 o C. CHO cells were washed and binding was detected by using a fluorescently labeled anti-human secondary antibody. Fluorescence was measured using high throughput plate-based flow cytometry.
- Benchmark antibodies identified to SARS-CoV were used as positive controls due to similarity in spike sequences between SARS-CoV and SARS-CoV-2; human IgG isotype and an irrelevant antibody were used as negative controls. Median fluorescence intensity of each antibody was normalized over the median fluorescence intensity of the human isotype control for respective antigens. The median fold over isotype values from different validation experiments were plotted. Mean and standard deviation was calculated where applicable and the values plotted as a column bar graph with median fold over isotype on Y-axis and the different antibodies represented along the X-axis. Antibody values greater than 5-fold over isotype were considered as binders. The cut- off value was determined based on the binding to the negative controls.
- Table 1-1 shows the results of a bead assay described above demonstrating which exemplary anti-coronavirus antibodies bind to wild-type SARS-CoV-2.
- Columns A-F 50 nM SARS-CoV-2.
- Columns G and H 10 nM SARS-CoV-2.
- Column I 2 nM SARS-CoV-2. Blank cells: data not available.
- Table 1-2 shows the results of a live cell assay described above demonstrating which exemplary anti-coronavirus antibodies bind to wild-type SARS-CoV-2.
- Columns A-E 50 nM SARS-CoV-2.
- Table 1-3 shows the results of a live cell assay described above demonstrating which exemplary anti-coronavirus antibodies bind to wild-type SARS-CoV-2. Columns A-E: 50 nM SARS-CoV-2 V483A mutant. Column F: 50 nM SARS-CoV-2 V367F mutant. Column G: 50 nM SARS-CoV-2 D641G mutant. Blank cells: data not available. [00298] Table 1-4 shows the results of a bead assay described above demonstrating which exemplary anti-coronavirus antibodies cross-react with SARS.
- Table 1-5 shows the results of a bead assay described above demonstrating which exemplary anti-coronavirus antibodies cross-react with WIV1.
- Columns A-E 50 nM WIV1.
- Columns F and G 10 nM WIV1.
- Column H 2 nM WIV1. Blank cells: data not available.
- Table 1-1 Binding to Wild-Type SARS-CoV-2 (Bead Assay)
- Table 1-2 Binding to Wild-Type SARS-CoV-2 (Live Cell Assay)
- Example 2 [00306] Expression and Purification of Antibodies [00307] Antibodies were expressed and purified essentially as follows. An appropriate host cell, such as HEK 293 or CHO, was either transiently or stably transfected with an expression system for secreting antibodies using an optimal predetermined HC:LC vector ratio (such as 1:3 or 1:2) or a single vector system encoding both the HC and the LC. Clarified media, into which the antibody had been secreted, was purified using any of many commonly-used techniques.
- An appropriate host cell such as HEK 293 or CHO
- an optimal predetermined HC:LC vector ratio such as 1:3 or 1:2
- Clarified media into which the antibody had been secreted
- the medium may be conveniently applied to a MABSELECT® column (GE Healthcare), or KappaSelect column (GE Healthcare) for Fab fragment, that has been equilibrated with a compatible buffer, such as phosphate buffered saline (pH 7.4).
- a compatible buffer such as phosphate buffered saline (pH 7.4).
- the column was washed to remove nonspecific binding components.
- the bound antibody was eluted, for example, by pH gradient (such as 20 mM Tris buffer, pH 7.0 to 10 mM sodium citrate buffer, pH 3.0, or phosphate buffered saline pH 7.4 to 100 mM glycine buffer, pH 3.0).
- Antibody fractions were detected, such as by SDS-PAGE, and then were pooled.
- Antibody encoding plasmid DNA was transfected into Expi293-FTM cells (GIBCO) to produce antibodies using the manufacturer's recommended protocol with some modifications.
- Expi293-FTM cells were aliquoted into 24 well plates and incubated with shaking at 37°C with 8% CO2 and 85% humidity.
- Heavy and light chain plasmids were pooled at a 1:1 heavy to light chain mass, mixed with Expi293Fectamine, and added dropwise to cells in each well.
- Expi293F Enhancer I and II were added 20 hr post-transfection and cell supernatants were harvested 4 d post transfection.
- Antibody encoding plasmid DNA was transfected into Expi293-FTM cells (GIBCO)
- Expi293-FTM cells GEBCO
- 8 ⁇ L of a 25% slurry solution of magnetic protein A beads (GenScript) were added to 30 ⁇ g of expressed mAb and incubated overnight with shaking at 37°C.
- beads were washed and protein eluted with 480 ⁇ L of 100 mM glycine pH 2.0. Elution fractions were neutralized to pH 7.0 and dried onto filter plates.
- the dried mAb was resuspended in buffer to a final concentration of approximately 1 mg/mL and sterile filtered.
- Tm melting temperature
- Percent aggregation and polydispersity of mAbs was assessed by dynamic light scattering (DLS) on a DYNAPRO® Plate Reader III instrument (Wyatt). DLS of individual samples (7 ⁇ L of mAb at varying concentrations (0.5 – 2 mg/mL)) was acquired at 20°C with 5 x 5 s acquisitions per sample. Data was analyzed in the Dynamics software (Wyatt) using the regularization algorithm. Percent polydispersity and percent mass of soluble mAbs were calculated for the size range of 2 – 10 nm. See Table 2-5. No value available where empty. [00319] Table 2-5: Amount of soluble antibody (%) and polydispersity of soluble antibody (%) determined by dynamic light scattering (DLS).
- Example 3 Antibody characterization using high-throughput surface plasmon resonance
- High-throughput surface plasmon resonance capture kinetic experiments were performed on an CARTERRA® LSATM instrument equipped with an HC-30M chip type. Purified monoclonal antibodies obtained from HEK cells were immobilized on a chip by direct coupling. The chip surface was activated and mAbs diluted to either 10 ug/mL or 1 ⁇ g/mL were printed onto the chip surface for 10 min. The chip surface was quenched, followed by washing. Relevant benchmarks and negative control mAbs were also printed on the chip surface.
- a 3-fold dilution series of the antigen of interest starting at 300 nM ir was sequentially injected onto the chip surface. For each concentration, the Ag was injected for 5 min (association phase), followed by running buffer injection for 15 min (dissociation phase). Regeneration cycles were performed between each dilution series. The data were analyzed using the CARTERRA® Kinetics analysis software and fit globally to a 1:1 Langmuir binding model to determine apparent association (ka) and dissociation (kd) kinetic rate constants and binding affinity constants (KD). See Table 3-1.
- Example 4 [00330] Epitope Binning, ACE2 Blocking and Binding Kinetics of Selected mAbs [00331]
- a CARTERRA® LSATM instrument a fully integrated HT-SPRTM (high throughput surface plasmon resonance) system, was used for premix epitope binning, ACE2 blocking assay, and binding kinetics measurement of selected anti-SARS-CoV2 mAbs colony-cloned from CHO cells. The assays were performed according to the manufacturer’s brochure. The reagents used in the experiments are shown in Table 4-1. [00332] Table 4-1: Reagents
- the instrument uses a multi-channel buffer of 25 mM MES at pH 5.5, and a single- channel buffer of 1x HBSEP+.
- HC30M chips were used and the array preparation was performed according to the CARTERRA® protocol, including chip activation for 7 minutes in activation buffer (100 ⁇ L ECD + 100 ⁇ L sNHS + 100 ⁇ L 25mM MES pH 5.5), coupling to samples in 10 mM acetate (pH 4.0) for 10 minutes, and deactivation for 7 minutes in 1M ethanolamine (pH 8.5).
- the prepared HC30M chips were tested against SARS-CoV- 2 spike protein with titration beginning at 200 nM with three-fold serial dilutions, with association for 5 minutes and dissociation for 20 minutes. Regeneration was performed in 20 mM glycine (pH 2.0) with 1M NaCl for 45 seconds twice.
- the tested concentrations were 500 nM, 250 nM, and 125 nM. The test was performed at either 25oC or 37oC.
- Tables 4-2 and 4-3 summarize the epitope bin, binding kinetics, neutralization and ACE2-blocking activities of selected mAbs, including 292, 309, 364, 373, 388, 408, 414, 417, 419, 442, 445, 447, 462, 479, 481, 483, 488, 494, 506, 540, 549, 553, 555, and 562.
- Table 4-2 Epitope bins, binding kinetics, neutralization, and ACE2-blocking activities of selected mAbs
- Table 4-3 Epitope Bins
- Example 5 Biophysical Characterization of Selected mAbs
- SEC-HPLC analytical size exclusion chromatography
- HIC-HPLC hydrophobic interaction chromatography - high performance liquid chromatography
- Heparin-HPLC heparin chromatography
- CIC cross-interaction chromatography
- AC-SINS affinity-capture self-interaction nanoparticle spectroscopy
- HIC-HPLC 20 ⁇ g IgG samples (1 mg/mL) were diluted 1:1 with 2x Buffer A concentrate (2 M ammonium sulfate, 0.1 M sodium phosphate at pH 6.8) to achieve a final ammonium sulfate concentration of 1 M before analysis.
- a TSKGEL® butyl-NPR (4.6 mm ID x 10 cm, 2.5 ⁇ m, Tosoh # 42168) column was used with a linear gradient (0-100% buffer B) of mobile phase A (1M ammonium sulfate, 50 mM sodium phosphate, pH 6.8) and mobile phase B solution (50 mM sodium phosphate, pH 6.8) over 23 min at a flow rate of 1 mL/min with UV absorbance monitoring at 280 nm. Retention time of main peak is reported.
- the CIC column was prepared by coupling ⁇ 30 mg of human serum polyclonal antibodies (I4506; Sigma) to a 1-mL HITRAP® column (17-0716-01; GE Healthcare), followed by quenching with ethanolamine.
- the blank column was prepared in the same except without human serum IgGs. Approximately 20 ⁇ g of each antibody was tested at a flow rate of 0.2 mL/min using 10 mM sodium citrate, 10 mM NaCl, pH 6.5 as a mobile phase on an Agilent 1260 series HPLC system. Retention times obtained by both IgG and blank columns were used to calculate k’.
- AC-SINS [00353] The AC-SINS assay was performed as described previously with modifications (Wu, J. et al., Protein Eng. Des. Sel. 28, 403-14, 2015). In short, gold nanoparticles (15705; Ted Pella Inc.) were coated with 100% capturing anti-human goat IgG Fc (109-005-008; Jackson ImmunoResearch). The conjugation reaction was quenched with 1 ⁇ g/mL polyethylene glycol (PEG) and eluted into 0.25x PBS.
- PEG polyethylene glycol
- Example 6 Pseudoneutralization assay
- Pseudoneutralization assays were performed using four concentrations of antibodies. Antibody dilutions were premixed with pseudotyped lentivirus expressing the SARS-COV-2 full- length spike protein and incubated with 293T cells transiently expressing human ACE2 receptor for 72 hours. Cells were lysed and viral entry into cells was quantified by Promega Luciferase assay kit using a plate reader. % neutralization at each concentration was calculated by comparison to virus only (0% neutralization) and cell only (100% neutralization) control wells (see Table 6- 1). All assays were run in duplicate.
- Table 6-2 [00360] Table 6-3 [00361] Table 6-4: IC50 and IC80 values for select anti-coronavirus antibodies
- Example 7 [00363] Epitope Mapping of Anti-SARS-COV-2 Antibody 555 and other Anti-SARS-COV- 2 Antibodies by Hydrogen Deuterium Exchange Mass Spectrometry (HDX-MS) [00364] Hydrogen deuterium exchange with mass spectrometry (HDX-MS) was performed in order to determine where the exemplified antibody (mAb 555) binds the SARS COV-2 spike protein.
- HDX-MS Hydrogen deuterium exchange with mass spectrometry
- Peptide identification for SARS Cov-2 spike was performed on a Waters SYNAPTTM G2Si (Waters Corporation) instrument using 5 ⁇ g of SARS COV-2 spike at zero exchange (0.1 X PBS in H2O) using nepenthesin II (Nep II) for digestion.
- the mass spectrometer was set in HDMSe (Mobility ESI+ mode); in a mass acquisition range of m/z 255.00–1950.00; with a scan time of 0.4 s. Data was processed using PLGS 2.3.2 (Waters Corporation).
- the complex of human SARS COV-2 spike with mAb 555 was prepared at the molar ratio of 1:1.2 in 10 mM sodium phosphate buffer, pH 7.4 containing 150 mM NaCl (1xPBS buffer).
- the experiment was initiated by adding 25uL of D2O buffer containing 0.1x PBS to 2.5 ul of spike (1 mg/ mL) or spike-mAb 555 complex at 15 ⁇ C for various amounts of time (0s, 10s, 30s, 2 min, 10 min and 120 min) using a custom Tecan sample preparation system (Espada et al., J. Am. Soc. Mass Spectrom., 2019, 30:2580-2583).
- the reaction was quenched using equal volume of was 0.32M TCEP, 3 M guanidine HCl, 0.1M phosphate pH 2.5 for two minutes at 4 ⁇ C and immediately frozen at -70 ⁇ C.
- the sample injection system is comprised of a UR3 robot, a LEAP PAL3 HDX autosampler, and a HPLC system interfaced with a Waters SYNAPT® G2-Si (Waters Corporation) (modified from Espada et al.).
- the LC mobile phases consisted of water (A) and acetonitrile (B), each containing 0.2% formic acid.
- Each sample was thawed using 50 ⁇ L of 0.32M TCEP, 1.5 M guanidine HCl, 0.1M phosphate pH 2.5, for 1 min and injected on to a Nep II column for digestion at 4 ⁇ C with mobile phase A at the flow rate of 250 ⁇ L/min for 2.5 minutes.
- the resulting peptides were trapped on a Waters BEH VANGUARDTM Pre-column at 4 ⁇ C, and chromatographically separated using a Waters ACQUITY UPLCTM BEH C18 analytical column at 4 ⁇ C with a flow rate of 200 ⁇ L/min and a gradient of 3%–85% mobile phase B over 7 minutes, and directed into mass spectrometer for mass analysis.
- the SYNAPT® G2-Si was calibrated with Glu-fibrinopeptide prior to use. Mass spectra were acquired over the m/z range of 255 to 1950 in HDMS mode, with the lock mass m/z of 556.2771 (Leucine Enkephalin). The relative deuterium incorporation for each peptide was determined by processing the MS data for deuterated samples along with the undeuterated control using the identified peptide list in DYNAMXTM 3.0 (Waters Corporation). The free and bound states of SARS Cov-2 spike were compared for deuterium incorporation differences. [00365] The results are shown in Table 7.1. Sequence coverage for the SARS Cov-2 spike was 63.5 %.
- Example 8 [00370] Epitope Mapping of Anti-SARS-COV-2 Fabs by Negative-Stain Electron Microscopy (nsEM) [00371] Anti-SARS-CoV-2 antibodies were produced by expression in Chinese hamster ovary (CHO) cells, and purified using standard antibody purification techniques. The Fab portions of the antibodies were generated by proteolytic digestion using papain, followed by removal of un-cleaved protein using standard chromatography techniques.
- SARS-CoV-2 spike ectodomain was diluted to 0.04 mg/mL in 2 mM Tris pH 8.0, 200 mM NaCl, 0.02% NaN3 (dilution buffer) in the presence of 10-fold excess Fab, and incubated on ice for either 10 seconds (Fab 555), 2 minutes (Fab 447), 5 minutes (Fabs 309, 488, 562, 506, 442, 417, 462, 292, 540, 479, 553, 388), or 20 minutes (Fabs 447, 483, 419, 494).
- CF400-Cu grids (Electron Microscopy Sciences) were plasma cleaned for 30 seconds in a SOLARUS® 950 plasma cleaner (Gatan) with a 4:1 ratio of O 2 /H 2 .4.8 ⁇ l of the protein sample was applied to the grid and allowed to incubate for 30 sec. The grid was then washed twice with dilution buffer stained with methylamine tungstate (NANO-W, Nanoprobes). Grids were then imaged using an FEI TALOSTM TEM (Thermo Scientific) and a Ceta 16M detector. Micrographs were collected manually using TIA v4.14 software at a magnification of x92,000, corresponding to a pixel size of 1.63 ⁇ /pixel.
- CTF estimation and particle picking were performed in cisTEM.2D classification was performed in either cisTEM (Grant, et al., 2018. “CisTEM, User-Friendly Software for Single-Particle Image Processing.” Edited by Edward H Egelman. ELife 7 (March): e35383) or CRYOSPARCTM (Punjani, Nature Methods 14 (3): 290–96, 2017), and ab initio reconstruction and refinement for 3D maps were performed in CRYOSPARCTM. [00373] Binding kinetics were determined based on biolayer interferometry.
- nsEM results and binding kinetics for Fabs 555, 447, 494, 483, 419 and 388 are shown in Figures 2-8.
- the other Fabs were not seen by nsEM.
- the nsEM imaging and three dimensional reconstruction of the complex confirms that Fab 555 binds the RBD domain of the SARS-CoV-2 spike protein in an orientation that would directly interfere with the known ACE2- spike protein interaction (Yan, et al., 2020, Science 367(6485): 1444-1448).
- Example 9 Live Virus Neutralization Assay of anti-SARS-COV-2 Antibodies
- the efficacy of some anti-SARS-CoV-2 antibodies is measured by detecting the neutralization of infectious SARS-CoV-2 virus in a dose-response mode using cultured Vero E6 cells. These cells are known to be highly susceptible to infection by SARS-CoV-2.
- the assays were developed and performed at three independent laboratories by modifying previously published methods for use with SAR-CoV-2.
- Assays at Lab 1 and Lab 2 were conducted using natural virus produced by infecting cultured Vero E6 cells with the SARS-CoV-2 clinical isolate USA/WA/1/2020 (BEI resources number NR52281) and incubating at 37 ⁇ C until cytopathology was evident (typically 48-72 hours). Expansion was limited to only 1-2 passages in cell culture to retain integrity of the original viral sequence. The virus stock was quantified by standard plaque assay, and aliquots were stored at - 80 ⁇ C. A freshly-thawed aliquot is used for each neutralization experiment.
- Assays at Lab 2 were also conducted using the Italy-INMI1 isolate of SARS-CoV- 2 (European Virus Archive – Global, ref #008V-03893), similarly grown in Vero E6 cells, titered by plaque assay and stored frozen. [00380] Assays at Lab 3 were performed using a modified version of the USA/WA/1/2020 isolate in which a non-essential gene (ORF7) was replaced by the NANOLUC® luciferase reporter gene (Promega). This technology was previously described for SARS-CoV and MERS-CoV (Sheahan, et al., Sci. Transl. Med. 2017;9 eaal3653).
- Sequences of SARS-CoV-2 were downloaded from the GISAID database (Elbe, S., and Buckland-Merrett, G., 2017, Global Challenges, 1: 33-46) every 4 days as full-length DNA sequences, which were then processed via custom MATLAB® (MathWorks) scripts to align the spike sequences and extract mutational information with respect to a reference spike protein sequence from the strain hCoV-19/Wuhan/IVDC-HB-01/2019 (EPI_ISL_402119).
- Optional patient metadata generated by bioinformatic tools Nextstrain (Hadfield et al., 2018, Bioinformatics; 34(23), 4121–4123) were used to supplement the sequence data.
- Sequences were discarded if they contained >5% ambiguous bases of the spike protein, had ⁇ 80% DNA identity to the reference spike, or contained multiple inserted or deleted bases, all of which indicate sequencing errors rather than antigenic drift.
- the MATLAB® scripts parsed the filtered data to summarize the frequency of mutation, the codons of the mutated residues, potential mutations, duration in circulation, and locations of strain isolation.
- mutations must appear >5 times, be isolated from >1 locations, be circulating for >13 days, and reside within the receptor binding domain (RBD, residues 329-520).
- mAb 555 was confirmed to bind the screening target (SARS-CoV-2 full length spike) using high throughput flow cytometry.
- CHO cells were transiently transfected to express the full length spike protein of either the reference sequence or mutants of SARS-CoV-2 spike protein on the cell surface.
- mAb 555 was incubated with the readout cells, and an untransfected control CHO line either at 50nM antibody concentration for 30 minutes at 4 ⁇ C. CHO cells were washed, and binding was detected by using a fluorescently labeled anti-human secondary antibody. Fluorescence was measured using high throughput plate-based flow cytometry.
- Benchmark antibodies identified to SARS were used as positive control due to similarity in spike sequences between SARS and SARS-CoV-2; human IgG isotype and an irrelevant antibody were used as negative controls. Median fluorescence intensity of each antibody was normalized over the median fluorescence intensity of the human isotype control for respective antigens. Antibody values greater than 5-fold over isotype were considered as binders. The cut-off value was determined based on the binding to the negative controls. [00396] mAb 555 was capable of binding to three of the mutations tested (Table 10.2). Of the mutations that have been observed, only two mutated residues (G476S and V483A) reside within the epitope for mAb 555.
- Table 10.2 Binding of mAb 555 to mutant forms of the full length SARS-CoV-2 spike protein by high-throughput flow cytometry [00399] Table 10.3: Effect of the V483A mutation on the binding affinity of mAb 555, measured by surface plasmon resonance (CARTERRA® LSA) [00400]
- Example 11 Nucleic Acid Sequence of Encoding Genes and Translated Amino Acid Sequence of mAb 555 [00402] Non-coding sequences are italicized. DNA coding sequence for the mskappa ss is underlined with a solid line. DNA coding sequence for the variable domain is in bold font.
- DNA coding sequence for the human kappa constant domain is in normal font.
- DNA coding sequence for the translational stop codons are italicized and underlined with a solid line.
- DNA Sequence for encoding the mAb 555 HC [00404] Non-coding sequences are italicized. DNA coding for mskappa ss is underlined with a solid line. DNA coding for the variable domain of anti-SARS-COV-2 HC is in bold font.
- DNA coding sequence for the human IgG1 constant domain is in normal font.
- DNA coding sequence for the translational stop codons are italicized and underlined with a solid line.
- DNA Sequence for encoding the mAb 555 LC [00406] Non-coding sequences are italicized. DNA coding sequence for the mskappa ss is underlined with a solid line. DNA coding sequence for the variable domain is in bold font. DNA coding sequence for the human kappa constant domain is in normal font. DNA coding sequence for the translational stop codons are italicized and underlined with a solid line. [00407] Deduced Mature Amino Acid Sequence for mAb 555 HC (SEQ ID NO: 5363) [00408] The variable domain is in bold font and the human IgG1 G1m3 constant chain is in normal font.
- the IgG1 hinge region is underlined.
- the CDR sequences are shown using borders.
- Deduced Mature Amino Acid Sequence for mAb 555 LC (SEQ ID NO: 5364)
- the variable domain is in bold font and the human kappa constant domain is in normal font.
- CDR sequences are shown using borders.
- X-Ray Crystallography Analysis of Selected Anti-SARS-COV-2 Antibodies [00416] X-ray crystallography analysis of anti-SARS-CoV-2 Fabs 555, 481 and 488 (all RBD binders) are performed as follows. A 12 mg/mL solution of 555 Fab-RBD complex was set up in vapor diffusion sitting drops at a ratio of 1:1 with a well solution of 100 mM sodium acetate pH 4.6 and 20 % PEG 10K. Crystals appeared within two days and were harvested on the 3rd day after the set up.
- Crystals were flash-frozen in liquid nitrogen following 1-minute incubation in cryoprotectant solution containing 25% glycerol in mother liquor.
- Diffraction data were collected at Lilly Research Laboratories Collaborative Access Team (LRL-CAT) and beamline at Sector 31 of the Advanced Photon Source at Argonne National Laboratory, Chicago, Illinois. Crystals stored in liquid nitrogen were mounted on a goniometer equipped with an Oxford Cryosystems Cryostat maintained at a temperature of 100 ⁇ K. The wavelength used was 0.9793 ⁇ collecting 900 diffraction images at a 0.2 degree oscillation angle and 0.12 seconds exposure time on a Pilatus3 S 6M detector at a distance of 392 mm.
- the diffraction data were indexed and integrated using auto PROC/XDS and merged and scaled in AIMLESS from the CCP4 suite (Vonrhein, Acta Crystallogr D Biol Crystallogr 67, 293-302, 2011; Kabsch, Acta crystallographica. Section D, Biological crystallography 66, 133-144, 2010; Evans, Acta Crystallogr D Biol Crystallogr 69, 1204-1214, 2013; Winn, Acta crystallographica. Section D, Biological crystallography 67, 235-242, 2011).
- Non-isomorphous data readily yielded initial structures by Molecular Replacement using for the Fab portion crystal structures from the proprietary Eli Lilly structure database and for the SARS2 spike RBD the public domain structure with the access code 6yla [Huo et al. 2020; manuscript in preparation].
- the initial structure coordinates for each dataset were further refined using Refmac5 (CCP4) applying isotropic temperature factors. Model building was performed with Coot (CCP4) and final structure validation with MolProbity (Chen, et al., Acta Crystallogr D Biol Crystallogr 66: 12-21, 2010) and CCP4 validation tools.
- FIG. 9A The crystal structures of Fabs 481, 488 and 555, in complex with the SARS-CoV-2 spike protein RBD are shown in Figure 9A.
- Fabs 481 and 488 bind in a nearly identical fashion almost completely obscuring the ACE2 binding site. This binding site is expected to be accessible in the “up” conformation of the RBD.
- Fab 555 binds to a different epitope on RBD that is slightly overlapping with the ACE2 binding site ( Figure 9B).
- the epitope of Fab 555 ( Figures 9C and 9D) is predicted to be fully accessible on both the “up” and the “down” conformation of the RBD.
- SARS-COV-2 spike protein residues with at least one atom that is within 4.5 ⁇ to any residue of the antibody/Fab is considered part of the epitope for the antibody/Fab.
- the epitope of Fab/mAb 555 comprises one or more of the following amino acid residues of SARS-COV-2 spike protein: Y351, Y449, N450, L452, L455, F456, T470, I472, N481, G482, V483, E484, G485, F486, Y489, F490, L492, Q493, S494 (the residue positions correspond to SEQ ID NO: 5317).
- the epitope of Fab/mAb 481 comprises one or more of the following amino acid residues of SARS-COV-2 spike protein: R403, D405, R408, Q409, T415, G416, K417, D420, Y421, Y453, L455, F456, R457, K458, S459, N460, Y473, Q474, A475, G476, F486, N487, Y489, Q493, S494, Y495, G496, Q498, T500, N501, G502, Y505 (the residue positions correspond to SEQ ID NO: 5317).
- the epitope of Fab/mAb 481 comprises one or more of the following amino acid residues of SARS-COV-2 spike protein: R403, T415, G416, K417, D420, Y421, L455, F456, R457, K458, S459, N460, Y473, Q474, A475, G476, S477, F486, N487, Y489, N501, G502, Y505 (the residue positions correspond to SEQ ID NO: 5317).
- Table 12.2 Interactions between SARS-COV-2 spike protein residues and Fab 481 residues
- Example 13 Rhesus Macaque Model of SARS-CoV-2 Infection
- rhesus macaques were intravenously (IV) administered with 1 mg/kg, 2.5 mg/kg, 15 mg/kg, or 50 mg/kg of mAb 555 or 50 mg/kg of an IgG1 control antibody 24 hours prior to virus challenge.
- Rhesus macaques were inoculated intranasally and intratracheally with a total of 1.1x10 5 TCID 50 of SARS-CoV-2 (USA-WA1/2020) and were monitored by twice daily cage-side observations, and respiratory exams throughout the study.
- BAL Bronchoalveolar lavage
- gRNA Viral genomes
- sg mRNA subgenomic RNA
- COVID specific observations were collected daily in conscious animals to monitor overall health and welfare and determine the need for veterinary intervention and/or euthanasia. COVID observations were scored on a scale of 0 to 10 and included measures of respiratory rate and dyspnea, overall appearance, activity, and responsiveness. Clinical observations were assessed cage-side twice daily and included evaluations of overall animal appearance, fecal consistency, and appetence. Body weights and rectal body temperatures were measured daily in anesthetized animals. At termination on study Day 6, macroscopic observations in the lung were evaluated by a board-certified veterinary pathologist.
- Bronchioalveolar lavage (BAL), nasal and oral swabs were collected on days 1, 3 and 6, and lung tissue samples (at necropsy, day 6) were collected to assess genomic and subgenomic viral RNA via qRT PCR, conducted as reported (Chandrashekar et al, Science 2020).
- the lower limit of detection for genomic and sub-genomic RNA copies was 50. Where values were below the lower limit of detection in the assay, a value of 25 (1/2 the limit of quantitation) was used for calculations.
- Serum samples were also collected for determination of LYCoV-555 concentrations by total human IgG ELISA assay.
- Example 14 Characterization of Additional Anti-SARS-CoV2 Antibodies
- Additional anti-SARS-CoV2 antibodies were characterized using the methods described in Examples 3-6, 9, and 10.
- the spike protein binding, ACE2 blocking, and binding affinity determination were performed using methods described in Example 4.
- the pseudoneutralization assay was performed using methods described in Example 6.
- Competitive binding assays were performed using methods similar to the epitope binning assays described in Example 4. The results are shown in Table 14-1.
- the live virus neutralization assay was performed at Lab 4 using cultured Vero E6 cells infected with the SARS-CoV-2 virus clinical isolate USA/WA/1/2020.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Virology (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- Biotechnology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Communicable Diseases (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
- Cell Biology (AREA)
- Pulmonology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Oncology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2020435452A AU2020435452A1 (en) | 2020-03-09 | 2020-12-09 | Anti-coronavirus antibodies and methods of use |
| BR112022017986A BR112022017986A2 (pt) | 2020-03-09 | 2020-12-09 | Anticorpos anticoronavírus e métodos de uso |
| CN202080100619.3A CN116096742A (zh) | 2020-03-09 | 2020-12-09 | 抗冠状病毒抗体及使用方法 |
| IL296224A IL296224A (en) | 2020-03-09 | 2020-12-09 | Antibodies against corona virus and methods of use |
| CA3171237A CA3171237A1 (en) | 2020-03-09 | 2020-12-09 | Anti-coronavirus antibodies and methods of use |
| MX2022011142A MX2022011142A (es) | 2020-03-09 | 2020-12-09 | Anticuerpos anti-coronavirus y metodos de uso. |
| JP2022554810A JP2023517234A (ja) | 2020-03-09 | 2020-12-09 | 抗コロナウイルス抗体および使用の方法 |
Applications Claiming Priority (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202062987313P | 2020-03-09 | 2020-03-09 | |
| US62/987,313 | 2020-03-09 | ||
| US202063010999P | 2020-04-16 | 2020-04-16 | |
| US63/010,999 | 2020-04-16 | ||
| US202063030530P | 2020-05-27 | 2020-05-27 | |
| US63/030,530 | 2020-05-27 | ||
| US202063036089P | 2020-06-08 | 2020-06-08 | |
| US63/036,089 | 2020-06-08 | ||
| US202063080351P | 2020-09-18 | 2020-09-18 | |
| US63/080,351 | 2020-09-18 | ||
| US202063085042P | 2020-09-29 | 2020-09-29 | |
| US63/085,042 | 2020-09-29 | ||
| US202063116483P | 2020-11-20 | 2020-11-20 | |
| US63/116,483 | 2020-11-20 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021183195A1 true WO2021183195A1 (en) | 2021-09-16 |
Family
ID=73835506
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/063991 Ceased WO2021183195A1 (en) | 2020-03-09 | 2020-12-09 | Anti-coronavirus antibodies and methods of use |
| PCT/US2021/020843 Ceased WO2021183359A1 (en) | 2020-03-09 | 2021-03-04 | Anti-coronavirus antibodies and methods of use |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/020843 Ceased WO2021183359A1 (en) | 2020-03-09 | 2021-03-04 | Anti-coronavirus antibodies and methods of use |
Country Status (14)
| Country | Link |
|---|---|
| US (5) | US20210292393A1 (cg-RX-API-DMAC7.html) |
| EP (2) | EP3878862A3 (cg-RX-API-DMAC7.html) |
| JP (2) | JP2023517234A (cg-RX-API-DMAC7.html) |
| KR (2) | KR102535195B1 (cg-RX-API-DMAC7.html) |
| CN (2) | CN116096742A (cg-RX-API-DMAC7.html) |
| AU (2) | AU2020435452A1 (cg-RX-API-DMAC7.html) |
| BR (2) | BR112022017986A2 (cg-RX-API-DMAC7.html) |
| CA (2) | CA3171237A1 (cg-RX-API-DMAC7.html) |
| GB (1) | GB2593023A (cg-RX-API-DMAC7.html) |
| IL (2) | IL296224A (cg-RX-API-DMAC7.html) |
| MA (1) | MA52390A (cg-RX-API-DMAC7.html) |
| MX (2) | MX2022011142A (cg-RX-API-DMAC7.html) |
| TW (2) | TWI782366B (cg-RX-API-DMAC7.html) |
| WO (2) | WO2021183195A1 (cg-RX-API-DMAC7.html) |
Cited By (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022035918A1 (en) * | 2020-08-11 | 2022-02-17 | Eli Lilly And Company | Anti-sars-cov-2 antibodies |
| WO2022162587A1 (en) * | 2021-01-27 | 2022-08-04 | Centre Hospitalier Universitaire Vaudois (C.H.U.V.) | Anti-sars-cov-2 antibodies and use thereof in the treatment of sars-cov-2 infection |
| WO2022261153A1 (en) * | 2021-06-08 | 2022-12-15 | Eli Lilly And Company | 2019 novel coronavirus antibody-containing pharmaceutical formulations |
| WO2022263638A1 (en) * | 2021-06-17 | 2022-12-22 | Centre Hospitalier Universitaire Vaudois (C.H.U.V.) | Anti-sars-cov-2 antibodies and use thereof in the treatment of sars-cov-2 infection |
| WO2023287875A1 (en) * | 2021-07-14 | 2023-01-19 | Regeneron Pharmaceuticals, Inc. | Anti-sars-cov-2-spike glycoprotein antibodies and antigen-binding fragments |
| US20230073821A1 (en) * | 2021-08-27 | 2023-03-09 | International Business Machines Corporation | Antigen-binding proteins targeting coronavirus (cov) variants |
| WO2023056482A1 (en) * | 2021-10-01 | 2023-04-06 | Academia Sinica | Antibody specific to spike protein of sars-cov-2 and uses thereof |
| WO2023084055A1 (en) * | 2021-11-12 | 2023-05-19 | Rq Biotechnology Limited | Compositions |
| WO2023059900A3 (en) * | 2021-10-08 | 2023-06-01 | Invivyd, Inc. | Pharmaceutical formulations comprising anti-coronavirus s protein antibodies and uses thereof |
| US11732030B2 (en) | 2020-04-02 | 2023-08-22 | Regeneron Pharmaceuticals, Inc. | Anti-SARS-CoV-2-spike glycoprotein antibodies and antigen-binding fragments |
| WO2023178182A1 (en) * | 2022-03-16 | 2023-09-21 | 10X Genomics, Inc. | Compositions and methods for detection and treatment of coronavirus infection |
| WO2023133338A3 (en) * | 2022-01-10 | 2023-10-19 | University Of Pittsburgh – Of The Commonwealth System Of Higher Education | Molecules that bind to neutrophil elastase polypeptides |
| WO2023193017A3 (en) * | 2022-04-01 | 2023-11-09 | Invivyd, Inc. | Sars-cov2 antibodies and uses thereof |
| US11918641B2 (en) | 2020-05-08 | 2024-03-05 | Academia Sinica | Chimeric influenza vaccines |
| US11999777B2 (en) | 2020-06-03 | 2024-06-04 | Regeneron Pharmaceuticals, Inc. | Methods for treating or preventing SARS-CoV-2 infections and COVID-19 with anti-SARS-CoV-2 spike glycoprotein antibodies |
| WO2024097660A3 (en) * | 2022-11-01 | 2024-06-13 | Providence Health & Services - Oregon | Monoclonal antibodies specific for fas ligand and uses thereof |
| US12030927B2 (en) | 2022-02-18 | 2024-07-09 | Rq Biotechnology Limited | Antibodies capable of binding to the spike protein of coronavirus SARS-CoV-2 |
| US12085340B2 (en) | 2016-11-08 | 2024-09-10 | Academia Sinica | Recombinant virus, composition comprising the same, and uses thereof |
| WO2024187177A3 (en) * | 2023-03-09 | 2024-10-24 | The Johns Hopkins University | Recombinant antibody for the treatment of extracellular dna overload |
| US12216120B2 (en) | 2020-03-26 | 2025-02-04 | Vanderbilt University | Human monoclonal antibodies to severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) |
| US12257298B2 (en) | 2021-04-12 | 2025-03-25 | Academia Sinica | Coronavirus vaccine |
| US12318485B2 (en) | 2023-04-08 | 2025-06-03 | Rock Biomedical, Inc. | Methods and compositions for targeted delivery by polymersomes |
| US12384811B2 (en) | 2019-04-05 | 2025-08-12 | Academia Sinica | Sialidase-resistant saccharide and method of making and using the same |
| US12508235B2 (en) | 2023-04-08 | 2025-12-30 | Rock Biomedical, Inc. | Methods and compositions for dendritic cell targeting nano-delivery |
| US12545941B2 (en) | 2023-05-17 | 2026-02-10 | Rock Biomedical, Inc. | MGAT1 deficient cells and uses thereof |
Families Citing this family (37)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4679095A3 (en) * | 2015-05-18 | 2026-05-06 | Agensys, Inc. | Antibodies that bind to axl proteins |
| WO2016187354A1 (en) * | 2015-05-18 | 2016-11-24 | Agensys, Inc. | Antibodies that bind to axl proteins |
| TWI789711B (zh) * | 2020-02-24 | 2023-01-11 | 中國科學院微生物研究所 | 新型冠狀病毒的人源單克隆抗體及其應用 |
| WO2021231976A1 (en) | 2020-05-14 | 2021-11-18 | Xencor, Inc. | Heterodimeric antibodies that bind prostate specific membrane antigen (psma) and cd3 |
| TW202208423A (zh) * | 2020-05-17 | 2022-03-01 | 英商阿斯特捷利康英國股份有限公司 | Sars-cov-2抗體及其選擇和使用方法 |
| US20220003779A1 (en) * | 2020-07-03 | 2022-01-06 | The Research Foundation For The State University Of New York | Methods for qualitative and quantitative analysis of a plurality of biomarkers |
| US11740240B2 (en) * | 2020-07-20 | 2023-08-29 | Bio-Rad Laboratories, Inc. | Immunoassay for SARS-CoV-2 neutralizing antibodies and materials therefor |
| KR20230078748A (ko) * | 2020-10-02 | 2023-06-02 | 일라이 릴리 앤드 캄파니 | 항체 정제 공정에서의 숙주 세포 단백질 함량을 감소시키는 방법 및 감소된 숙주 세포 단백질 함량을 가지는 항체 조성물 |
| EP4228697A4 (en) | 2020-10-16 | 2025-01-01 | Invisishield Technologies Ltd. | Compositions for preventing or treating viral and other microbial infections |
| CN115141270A (zh) * | 2021-03-29 | 2022-10-04 | 深圳市康麦生物技术有限公司 | 特异性结合新型冠状病毒的抗体 |
| CN113461810B (zh) * | 2021-05-17 | 2021-12-28 | 深圳市福田区格物智康病原研究所 | 一种抗新型冠状病毒刺突蛋白的全人源单克隆抗体及其应用 |
| WO2023285620A2 (en) * | 2021-07-14 | 2023-01-19 | Alchemab Therapeutics Ltd. | Compositions and methods for targeting viral proteins |
| CN113735969B (zh) * | 2021-09-20 | 2023-05-12 | 中国人民解放军军事科学院军事医学研究院 | 一种全人源抗新冠病毒广谱高中和活性单克隆抗体及应用 |
| JP2024536380A (ja) * | 2021-10-07 | 2024-10-04 | セキラス ピーティーワイ リミテッド | 抗SARS-CoV-2抗体及びその使用I |
| EP4413035A1 (en) * | 2021-10-22 | 2024-08-14 | Atreca, Inc. | Antibodies to coronavirus sars-cov-2 |
| WO2023076419A2 (en) * | 2021-10-27 | 2023-05-04 | Twist Bioscience Corporation | Sars-cov-2 antibodies and methods of use |
| WO2023079137A1 (en) * | 2021-11-05 | 2023-05-11 | Katholieke Universiteit Leuven | Neutralizing anti-sars-cov-2 human antibodies |
| WO2023086827A1 (en) * | 2021-11-09 | 2023-05-19 | Rhode Island Hospital | Predicting covid-19 antibodies among survivors with deep rna sequencing |
| EP4183800A1 (en) * | 2021-11-19 | 2023-05-24 | Medizinische Hochschule Hannover | Novel sars-cov-2 neutralizing antibodies |
| CA3237165A1 (en) * | 2021-11-19 | 2023-05-25 | Jeng-Horng Her | Bispecific antibodies targeting cd137 and uses thereof for anti-cancer immunotherapy |
| CN116217711A (zh) * | 2021-12-03 | 2023-06-06 | 广东菲鹏生物有限公司 | 一种SARS-CoV-2检测方法和试剂盒 |
| KR102793620B1 (ko) | 2021-12-09 | 2025-04-09 | 한국화학연구원 | 사스-코로나바이러스-2 뉴클레오캡시드 단백질에 대한 단클론 항체 및 이의 용도 |
| CN119421953A (zh) | 2022-01-28 | 2025-02-11 | 株式会社伊贝克 | 具有突变株交叉性的抗SARS-CoV-2人中和抗体及其抗原结合片段 |
| WO2023159061A2 (en) * | 2022-02-15 | 2023-08-24 | Board Of Regents, The University Of Texas System | Human monoclonal antibodies targeting the s2 subunit of the sars-cov-2 spike protein |
| US12365743B2 (en) | 2022-02-23 | 2025-07-22 | Xencor, Inc. | Anti-CD28 x anti-PSMA antibodies |
| WO2023159316A1 (en) * | 2022-02-28 | 2023-08-31 | Immune Biosolutions Inc. | Formulation of anti-sars-cov-2 neutralizing antibodies and uses thereof |
| US20260035438A1 (en) * | 2022-03-04 | 2026-02-05 | The Scripps Research Institute | Human broadly neutralizing antibodies against betacoronaviruses |
| CN114349855B (zh) * | 2022-03-18 | 2022-06-28 | 百斯医学诊断科技(北京)有限公司 | 新型冠状病毒Delta突变株特异性抗体及其应用 |
| WO2023183848A2 (en) * | 2022-03-25 | 2023-09-28 | The Rockefeller University | Anti-sars-cov-2 antibodies and methods of use thereof |
| CN114656555B (zh) * | 2022-04-08 | 2024-03-19 | 广州医科大学附属第一医院(广州呼吸中心) | 抗SARS-CoV-2病毒的中和抗体及其制备方法和应用 |
| CA3256035A1 (en) | 2022-04-14 | 2023-10-19 | Invisishield Technologies Ltd. | COMPOSITIONS FOR PREVENTING OR TREATMENT OF CORONAVIRUS INFECTIONS |
| WO2023201306A1 (en) | 2022-04-14 | 2023-10-19 | Invisishield Technologies Ltd. | Compositions for preventing or treating influenza infections |
| WO2024025940A1 (en) * | 2022-07-26 | 2024-02-01 | Ap Biosciences, Inc. | Sars-cov-2 antibodies and bispecific antibodies |
| CN116143910B (zh) * | 2022-10-12 | 2026-03-24 | 水木未来(北京)科技有限公司 | 靶向SARS-CoV-2刺突蛋白的纳米抗体及其应用 |
| JP2026503220A (ja) | 2022-12-21 | 2026-01-28 | ナショナル ユニヴァーシティー オブ シンガポール | Sars-cov-2スパイクタンパク質結合分子 |
| WO2025222126A1 (en) * | 2024-04-19 | 2025-10-23 | Vanderbilt University | Var2csa antibodies and methods of use thereof |
| US20260061066A1 (en) * | 2024-06-03 | 2026-03-05 | Uct Bioscience Co., Ltd. | Anti-grp78 antibody, immunoconjugate and uses thereof |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005012360A2 (en) * | 2003-07-22 | 2005-02-10 | Crucell Holland B.V. | Binding molecules against sars-coronavirus and uses thereof |
| CN111592595A (zh) * | 2020-04-27 | 2020-08-28 | 南京医科大学 | 抗新型冠状病毒SARS-Cov-2的中和性抗体及其应用 |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6323840B1 (en) | 1999-09-17 | 2001-11-27 | Cts Corporation | Surface-mount pointing device |
| US20040191260A1 (en) * | 2003-03-26 | 2004-09-30 | Technion Research & Development Foundation Ltd. | Compositions capable of specifically binding particular human antigen presenting molecule/pathogen-derived antigen complexes and uses thereof |
| US7892563B2 (en) | 2003-05-20 | 2011-02-22 | Wyeth Holdings Corporation | Methods for treatment of severe acute respiratory syndrome (SARS) |
| EP1644414B1 (en) | 2003-07-22 | 2015-01-14 | Crucell Holland B.V. | Binding molecules against sars-coronavirus and uses thereof |
| US8106170B2 (en) | 2004-11-11 | 2012-01-31 | Crucell Holland B.V. | Compositions against SARS-coronavirus and uses thereof |
| CA2595780A1 (en) | 2005-02-08 | 2006-08-17 | Shibo Jiang | Neutralizing monoclonal antibodies against severe acute respiratory syndrome-associated coronavirus |
| CN105934441A (zh) * | 2013-11-26 | 2016-09-07 | 贝勒医学院 | 新型sars免疫原性组合物 |
| JO3701B1 (ar) * | 2014-05-23 | 2021-01-31 | Regeneron Pharma | مضادات حيوية بشرية لمتلازمة الشرق الأوسط التنفسية - بروتين كورونا فيروس الشوكي |
| WO2016161390A1 (en) * | 2015-04-03 | 2016-10-06 | Eureka Therapeutics, Inc. | Constructs targeting afp peptide/mhc complexes and uses thereof |
| EP3892297A1 (en) | 2020-04-09 | 2021-10-13 | Eberhard Karls Universität Tübingen Medizinische Fakultät | Peptides and combinations of peptides for use in immunotherapy against an infection by sars-cov-2 (covid-19) |
| CN112300375B (zh) * | 2020-11-06 | 2022-10-25 | 江苏三木化工股份有限公司 | 一种水性光固化环氧丙烯酸树脂的制备方法 |
-
2020
- 2020-12-09 MX MX2022011142A patent/MX2022011142A/es unknown
- 2020-12-09 IL IL296224A patent/IL296224A/en unknown
- 2020-12-09 AU AU2020435452A patent/AU2020435452A1/en not_active Abandoned
- 2020-12-09 CN CN202080100619.3A patent/CN116096742A/zh active Pending
- 2020-12-09 CA CA3171237A patent/CA3171237A1/en active Pending
- 2020-12-09 WO PCT/US2020/063991 patent/WO2021183195A1/en not_active Ceased
- 2020-12-09 BR BR112022017986A patent/BR112022017986A2/pt unknown
- 2020-12-09 JP JP2022554810A patent/JP2023517234A/ja active Pending
- 2020-12-09 US US17/116,588 patent/US20210292393A1/en not_active Abandoned
- 2020-12-14 KR KR1020200174502A patent/KR102535195B1/ko active Active
- 2020-12-14 EP EP20213900.2A patent/EP3878862A3/en active Pending
- 2020-12-14 TW TW109144053A patent/TWI782366B/zh active
- 2020-12-14 MA MA052390A patent/MA52390A/fr unknown
- 2020-12-14 GB GB2019709.1A patent/GB2593023A/en not_active Withdrawn
-
2021
- 2021-03-04 AU AU2021234242A patent/AU2021234242A1/en not_active Abandoned
- 2021-03-04 MX MX2022011141A patent/MX2022011141A/es unknown
- 2021-03-04 CN CN202180033718.9A patent/CN116096744A/zh active Pending
- 2021-03-04 BR BR112022017930A patent/BR112022017930A2/pt unknown
- 2021-03-04 US US17/192,243 patent/US20220356229A1/en not_active Abandoned
- 2021-03-04 CA CA3171139A patent/CA3171139A1/en active Pending
- 2021-03-04 WO PCT/US2021/020843 patent/WO2021183359A1/en not_active Ceased
- 2021-03-04 EP EP21719305.1A patent/EP4118110A1/en not_active Withdrawn
- 2021-03-04 KR KR1020227032747A patent/KR20220167273A/ko active Pending
- 2021-03-04 IL IL296333A patent/IL296333A/en unknown
- 2021-03-04 JP JP2022554815A patent/JP2023517236A/ja active Pending
- 2021-03-08 TW TW110108164A patent/TWI847020B/zh active
- 2021-06-22 US US17/354,476 patent/US11447541B1/en active Active
- 2021-06-22 US US17/354,434 patent/US11370828B2/en active Active
-
2023
- 2023-03-31 US US18/194,105 patent/US12172038B2/en active Active
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005012360A2 (en) * | 2003-07-22 | 2005-02-10 | Crucell Holland B.V. | Binding molecules against sars-coronavirus and uses thereof |
| CN111592595A (zh) * | 2020-04-27 | 2020-08-28 | 南京医科大学 | 抗新型冠状病毒SARS-Cov-2的中和性抗体及其应用 |
Non-Patent Citations (28)
| Title |
|---|
| "GenBank", Database accession no. YP_009724390.1 |
| "UniProt", Database accession no. P59594 |
| BERKEY ET AL., STAT MED., vol. 14, no. 4, 1995, pages 395 - 411 |
| BIN JU ET AL: "Potent human neutralizing antibodies elicited by SARS-CoV-2 infection", 26 March 2020 (2020-03-26), XP055737104, Retrieved from the Internet <URL:https://www.biorxiv.org/content/10.1101/2020.03.21.990770v2.full.pdf> [retrieved on 20201006], DOI: 10.1101/2020.03.21.990770 * |
| CHANDRASHEKAR ET AL., SCIENCE, vol. 367, no. 6485, 2020, pages 1444 - 1448 |
| CHEN ET AL., ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 66, 2010, pages 12 - 21 |
| CHEN PETER ET AL: "SARS-CoV-2 Neutralizing Antibody LY-CoV555 in Outpatients with Covid-19", THE NEW ENGLAND JOURNAL OF MEDICINE, vol. 384, no. 3, 28 October 2020 (2020-10-28), US, pages 229 - 237, XP055806786, ISSN: 0028-4793, DOI: 10.1056/NEJMoa2029849 * |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| ELBE, S.BUCKLAND-MERRETT, G., GLOBAL CHALLENGES, vol. 1, 2017, pages 33 - 46 |
| ESPADA ET AL., J. AM. SOC. MASS SPECTROM., vol. 30, 2019, pages 2580 - 2583 |
| EVANS, ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 69, 2013, pages 1204 - 1214 |
| GRANT ET AL.: "ELife", vol. 7, March 2018, article "CisTEM, User-Friendly Software for Single-Particle Image Processing", pages: e35383 |
| HADFIELD ET AL., BIOINFORMATICS, vol. 34, no. 23, 2018, pages 4121 - 4123 |
| JACOBS, S.A. ET AL., PHARM. RES., vol. 27, 2010, pages 65 - 71 |
| JONES BRYAN E. ET AL: "Title: LY-CoV555, a rapidly isolated potent neutralizing antibody, provides protection in a non-human primate model of SARS-CoV-2 infection", BIORXIV, 9 October 2020 (2020-10-09), XP055806789, Retrieved from the Internet <URL:https://www.biorxiv.org/content/10.1101/2020.09.30.318972v3.full.pdf> [retrieved on 20210523], DOI: 10.1101/2020.09.30.318972 * |
| KABSCH, ACTA CRYSTALLOGRAPHICA. SECTION D, BIOLOGICAL CRYSTALLOGRAPHY, vol. 66, 2010, pages 133 - 144 |
| LI WEI ET AL: "Rapid identification of a human antibody with high prophylactic and therapeutic efficacy in three animal models of SARS-CoV-2 infection", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 117, no. 47, 2 November 2020 (2020-11-02), pages 29832 - 29838, XP055806787, ISSN: 0027-8424, DOI: 10.1073/pnas.2010197117 * |
| MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745 |
| MAEDA ET AL., MABS, vol. 9, no. 5, 2017, pages 844 - 853 |
| NATURE, vol. 342, 1989, pages 877 - 883 |
| PUNJANI, NATURE METHODS, vol. 14, no. 3, 2017, pages 290 - 96 |
| SHEAHAN ET AL., SCI. TRANSL. MED., vol. 9, 2017, pages eaal3653 |
| SHI, R. ET AL.: "A human neutralizing antibody targets the receptor binding site of SARS-CoV-2", NATURE, 2020, Retrieved from the Internet <URL:https://doi.org/10.1038/s41586-020-2381-y> |
| VIECHTBAUER, J STAT. SOFTWARE, vol. 6, no. 3, 2010, pages 1 - 48 |
| VONRHEIN, ADA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 67, 2011, pages 293 - 302 |
| WINN, ACTA CRYSTALLOGRAPHICA, SECTION D, BIOLOGICAL CRYSTALLOGRAPHY, vol. 67, 2011, pages 235 - 242 |
| WU, J. ET AL., PROTEIN ENG. DES. SEL., vol. 28, 2015, pages 403 - 14 |
| XIAOLONG TIAN ET AL: "Potent binding of 2019 novel coronavirus spike protein by a SARS coronavirus-specific human monoclonal antibody", EMERGING MICROBES & INFECTIONS, vol. 9, no. 1, 17 February 2020 (2020-02-17), pages 382 - 385, XP055736759, DOI: 10.1080/22221751.2020.1729069 * |
Cited By (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12607406B2 (en) | 2016-11-08 | 2026-04-21 | Academia Sinica | Recombinant virus, composition comprising the same, and uses thereof |
| US12085340B2 (en) | 2016-11-08 | 2024-09-10 | Academia Sinica | Recombinant virus, composition comprising the same, and uses thereof |
| US12384811B2 (en) | 2019-04-05 | 2025-08-12 | Academia Sinica | Sialidase-resistant saccharide and method of making and using the same |
| US12216120B2 (en) | 2020-03-26 | 2025-02-04 | Vanderbilt University | Human monoclonal antibodies to severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) |
| US11732030B2 (en) | 2020-04-02 | 2023-08-22 | Regeneron Pharmaceuticals, Inc. | Anti-SARS-CoV-2-spike glycoprotein antibodies and antigen-binding fragments |
| US12251440B2 (en) | 2020-04-02 | 2025-03-18 | Regeneron Pharmaceuticals, Inc. | Anti-SARS-CoV-2-spike glycoprotein antibodies and antigen-binding fragments |
| US11918641B2 (en) | 2020-05-08 | 2024-03-05 | Academia Sinica | Chimeric influenza vaccines |
| US12178870B2 (en) | 2020-05-08 | 2024-12-31 | Academia Sinica | Chimeric influenza vaccines |
| US11999777B2 (en) | 2020-06-03 | 2024-06-04 | Regeneron Pharmaceuticals, Inc. | Methods for treating or preventing SARS-CoV-2 infections and COVID-19 with anti-SARS-CoV-2 spike glycoprotein antibodies |
| WO2022035918A1 (en) * | 2020-08-11 | 2022-02-17 | Eli Lilly And Company | Anti-sars-cov-2 antibodies |
| WO2022162587A1 (en) * | 2021-01-27 | 2022-08-04 | Centre Hospitalier Universitaire Vaudois (C.H.U.V.) | Anti-sars-cov-2 antibodies and use thereof in the treatment of sars-cov-2 infection |
| US12257298B2 (en) | 2021-04-12 | 2025-03-25 | Academia Sinica | Coronavirus vaccine |
| WO2022261153A1 (en) * | 2021-06-08 | 2022-12-15 | Eli Lilly And Company | 2019 novel coronavirus antibody-containing pharmaceutical formulations |
| WO2022263638A1 (en) * | 2021-06-17 | 2022-12-22 | Centre Hospitalier Universitaire Vaudois (C.H.U.V.) | Anti-sars-cov-2 antibodies and use thereof in the treatment of sars-cov-2 infection |
| US12496470B2 (en) | 2021-07-14 | 2025-12-16 | Regeneron Pharmaceuticals, Inc. | Anti-SARS-CoV-2-spike glycoprotein antibodies and antigen-binding fragments |
| WO2023287875A1 (en) * | 2021-07-14 | 2023-01-19 | Regeneron Pharmaceuticals, Inc. | Anti-sars-cov-2-spike glycoprotein antibodies and antigen-binding fragments |
| US20230073821A1 (en) * | 2021-08-27 | 2023-03-09 | International Business Machines Corporation | Antigen-binding proteins targeting coronavirus (cov) variants |
| US12600764B2 (en) * | 2021-08-27 | 2026-04-14 | International Business Machines Corporation | Antigen-binding proteins targeting coronavirus (COV) variants |
| US11866485B2 (en) | 2021-10-01 | 2024-01-09 | Academia Sinica | Antibody specific to spike protein of SARS-CoV-2 and uses thereof |
| WO2023056482A1 (en) * | 2021-10-01 | 2023-04-06 | Academia Sinica | Antibody specific to spike protein of sars-cov-2 and uses thereof |
| US12157763B2 (en) | 2021-10-01 | 2024-12-03 | Academia Sinica | Antibody specific to spike protein of SARS-CoV-2 and uses thereof |
| WO2023059900A3 (en) * | 2021-10-08 | 2023-06-01 | Invivyd, Inc. | Pharmaceutical formulations comprising anti-coronavirus s protein antibodies and uses thereof |
| WO2023084055A1 (en) * | 2021-11-12 | 2023-05-19 | Rq Biotechnology Limited | Compositions |
| WO2023133338A3 (en) * | 2022-01-10 | 2023-10-19 | University Of Pittsburgh – Of The Commonwealth System Of Higher Education | Molecules that bind to neutrophil elastase polypeptides |
| US12030927B2 (en) | 2022-02-18 | 2024-07-09 | Rq Biotechnology Limited | Antibodies capable of binding to the spike protein of coronavirus SARS-CoV-2 |
| WO2023178182A1 (en) * | 2022-03-16 | 2023-09-21 | 10X Genomics, Inc. | Compositions and methods for detection and treatment of coronavirus infection |
| WO2023193017A3 (en) * | 2022-04-01 | 2023-11-09 | Invivyd, Inc. | Sars-cov2 antibodies and uses thereof |
| WO2024097660A3 (en) * | 2022-11-01 | 2024-06-13 | Providence Health & Services - Oregon | Monoclonal antibodies specific for fas ligand and uses thereof |
| WO2024187177A3 (en) * | 2023-03-09 | 2024-10-24 | The Johns Hopkins University | Recombinant antibody for the treatment of extracellular dna overload |
| US12318485B2 (en) | 2023-04-08 | 2025-06-03 | Rock Biomedical, Inc. | Methods and compositions for targeted delivery by polymersomes |
| US12508235B2 (en) | 2023-04-08 | 2025-12-30 | Rock Biomedical, Inc. | Methods and compositions for dendritic cell targeting nano-delivery |
| US12545941B2 (en) | 2023-05-17 | 2026-02-10 | Rock Biomedical, Inc. | MGAT1 deficient cells and uses thereof |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| TWI782366B (zh) | 抗冠狀病毒抗體及使用方法 | |
| US12216120B2 (en) | Human monoclonal antibodies to severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) | |
| US20240182548A1 (en) | Sars-cov-2 antibodies and methods of selecting and using the same | |
| EP4230650B1 (en) | Antibodies capable of binding to the spike protein of coronavirus sars-cov-2 | |
| HK40049849A (en) | Anti-coronavirus antibodies and methods of use | |
| US20230295310A1 (en) | CD3 T-Cell Engagers and Methods of Use | |
| EP4514842B1 (en) | Sars-cov-2 antibodies and methods of using the same | |
| US20250304659A1 (en) | HUMAN MONOCLONAL ANTIBODIES TO SEVERE ACUTE RESPIRATORY SYNDROME CORONAVIRUS 1 (SARS-CoV-1) | |
| WO2024120517A1 (zh) | 特异性结合rsv的抗体 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20859653 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2022554810 Country of ref document: JP Kind code of ref document: A Ref document number: 3171237 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202217053137 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2020435452 Country of ref document: AU Date of ref document: 20201209 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022017986 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112022017986 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220908 |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 20859653 Country of ref document: EP Kind code of ref document: A1 |