WO2020076817A1 - Engineering of dnase enzymes for manufacturing and therapy - Google Patents

Engineering of dnase enzymes for manufacturing and therapy Download PDF

Info

Publication number
WO2020076817A1
WO2020076817A1 PCT/US2019/055178 US2019055178W WO2020076817A1 WO 2020076817 A1 WO2020076817 A1 WO 2020076817A1 US 2019055178 W US2019055178 W US 2019055178W WO 2020076817 A1 WO2020076817 A1 WO 2020076817A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
variant
amino acid
linker
fusion
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/055178
Other languages
English (en)
French (fr)
Inventor
Tobias A. FUCHS
R. Abdul HAKKIM
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Neutrolis Inc
Original Assignee
Neutrolis Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP19870853.9A priority Critical patent/EP3864147A4/en
Priority to AU2019358915A priority patent/AU2019358915B2/en
Priority to MX2021004022A priority patent/MX2021004022A/es
Priority to JP2021518905A priority patent/JP2022504400A/ja
Priority to SG11202103426XA priority patent/SG11202103426XA/en
Priority to KR1020217013090A priority patent/KR20210072790A/ko
Priority to EA202190940A priority patent/EA202190940A1/ru
Priority to BR112021006737-0A priority patent/BR112021006737A2/pt
Priority to CA3115766A priority patent/CA3115766A1/en
Priority to IL325846A priority patent/IL325846A/en
Priority to CN201980073970.5A priority patent/CN112996911A/zh
Application filed by Neutrolis Inc filed Critical Neutrolis Inc
Priority to IL282058A priority patent/IL282058B1/en
Priority to US16/697,502 priority patent/US10988746B2/en
Publication of WO2020076817A1 publication Critical patent/WO2020076817A1/en
Priority to US16/915,547 priority patent/US11058724B2/en
Priority to US17/210,129 priority patent/US11840712B2/en
Anticipated expiration legal-status Critical
Priority to US17/344,442 priority patent/US20210299178A1/en
Priority to US17/668,674 priority patent/US11578314B2/en
Priority to US18/497,106 priority patent/US12565642B2/en
Priority to US18/658,758 priority patent/US20240374643A1/en
Priority to JP2024133817A priority patent/JP7818850B2/ja
Priority to AU2025283522A priority patent/AU2025283522B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/47Hydrolases (3) acting on glycosyl compounds (3.2), e.g. cellulases, lactases
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • A61K9/0029Parenteral nutrition; Parenteral nutrition compositions as drug carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/76Albumins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/80Vectors or expression systems specially adapted for eukaryotic hosts for fungi
    • C12N15/81Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P21/00Preparation of peptides or proteins
    • C12P21/02Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y301/00Hydrolases acting on ester bonds (3.1)
    • C12Y301/21Endodeoxyribonucleases producing 5'-phosphomonoesters (3.1.21)
    • C12Y301/21001Deoxyribonuclease I (3.1.21.1)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site

Definitions

  • This invention relates to the field of engineered DNASE enzymes.
  • Inflammation is an essential host response to control invading microbes and heal damaged tissues. Uncontrolled and persistent inflammation causes tissue injury in a plethora of inflammatory disorders. Neutrophils are the predominant leukocytes in acute inflammation. During infections, neutrophils generate neutrophil extracellular traps (NETs), lattices of DNA-filaments decorated with toxic histones and enzymes that immobilize and neutralize bacteria. However, inappropriately released NETs may harm host cells due to their cytotoxic, proinflammatory, and prothrombotic activity.
  • NETs neutrophil extracellular traps
  • DNASE 1 forms along with DNASE1-LIKE 1 (D1L1), DNASE 1 -LIKE 2 (D1L2) and DNASE1-LIKE 3 (D1L3), the DNASE 1 -protein family, a group of homologous secreted DNase enzymes.
  • DNASE2A and DNASE2B form an additional group of homologous extracellular DNase enzymes.
  • DNASE1- and DNASE2- protein family members are evolutionary conserved and expressed in various species, including humans. Recombinant human DNASE1- and DNASE2-protein family members provide drug candidates for NET-associated diseases. While Dl has been developed for some therapeutic applications in patients, the conditions for large-scale manufacturing of the other members of the DNASE1 -protein family have not been described.
  • the present invention provides engineered human extracellular DNASE proteins (e.g., variants of DNASE1 (Dl), DNASE1-LIKE 1 (D1L1), DNASE 1 -LIKE 2 (D1L2), DNASE1-LIKE 3 Isoform 1 (D1L3), DNASE 1 -LIKE 3 Isoform 2 (D1L3-2), DNASE2A (D2A), and DNASE2B (D2B)) that are useful for treating conditions characterized by extracellular DNA, extracellular chromatin, and neutrophil extracellular trap (NET) accumulation and/or release.
  • the DNase variants described herein are more suitable for therapy and/or more amenable to large- scale manufacturing.
  • the DNase variants described herein have benefits for medical therapy, including systemic therapy.
  • benefits include slower drug elimination, e.g., increased circulatory half-life (e.g., serum half-life), an extended duration of pharmacodynamic activity, high chromatin-degrading activity, and protease resistance.
  • the invention provides a D1L3 variant, wherein the D1L3 variant has one or more of increased protein stability, slower drug elimination and increased duration of pharmacodynamic activity, resistance to proteolytic degradation, higher production levels with in vitro expression systems, better suitability for purification, and not substantially less, the same, or better chromatin and/or NET-degrading activity as compared to wild-type D1L3 Isoform 1 enzyme of SEQ ID NO:4 or wild-type D1L3 Isoform 2 enzyme of SEQ ID NO:5.
  • the D1L3 variant is a fusion protein that comprises an amino acid sequence that is at least 80% identical to the mature enzyme defined by SEQ ID NO:4 or SEQ ID NO:5, an albumin amino acid sequence at the N-terminus of the mature enzyme, and optionally a linking amino acid sequence between the albumin amino acid sequence (the albumin domain) and the D1L3 amino acid sequence (the D1L3 domain).
  • the D1L3 exhibits slower elimination (e.g., improved circulatory half-life or serum half-life) and an extended duration of pharmacodynamic activity, including for systemic therapy.
  • the fusion of albumin with linking sequence to the D1L3 domain does not substantially impact chromatin- degrading activity of the enzyme (e.g., a measured using an in vitro assay) as compared to the enzyme without an albumin fusion.
  • the D1L3 domain of the fusion protein has a deletion of all or part of the C-terminal basic domain that is present in the wild-type D1L3 enzyme. Deletion or inactivation of the C-terminal basic domain substantially improves chromatin degrading activity. That is, removal of the C-terminal basic domain (BD) activates the wild-type D1L3 enzyme for degrading chromatin.
  • BD C-terminal basic domain
  • the D1L3 variant has one or more building block substitutions from Dl.
  • the D1L3 variant may have the building block substitution of Q282_S305delinsK, which includes a deletion of the C-terminal basic domain, which domain is absent in Dl.
  • the D1L3 variant has an amino acid substitution at the position corresponding to position 101 of SEQ ID NO:4. The substitution can be Arg based on the corresponding building block from Dl, or in some embodiments is Lys. Substitutions at this position can enhance chromatin degrading activity of a D1L3 variant.
  • the linker where present may be a flexible linker, a rigid linker, or a physiologically-cleavable linker, such as a protease-cleavable linker.
  • the linker may be a hydrophilic amino acid sequence, and may be predominately constructed from amino acids selected from Gly, Ala, Ser, Thr, and Pro.
  • the variant is a flexible linker that is predominately glycine and serine residues (e.g., (G y S) n linkers, where y is from 1 to 5, and n is from 1 to 20).
  • the linker is an a-helical linker.
  • the linker has at least 15 amino acids, or at least 25 amino acids.
  • longer linkers of at least 15 amino acids can provide improvements in yield upon expression in mammalian and non-mammalian expression systems, such as CHO cells or Pichia pastoris.
  • longer linker sequences showed improved chromatin-degrading activity in an in vitro chromatin-degrading assay, as compared to shorter linker sequences.
  • the D1L3 variant comprises the amino acid sequence of any one of SEQ ID NOS: 17 to 30, in each case optionally having from one to twenty amino acid modifications independently selected from insertions, deletions, or substitutions.
  • These sequences provide exemplary fusion proteins between D1L3 (or D1L3 variants) with albumin sequences, including with various linker designs.
  • the amino acid modifications are in the D1L3 domain, the albumin domain, or both domains.
  • the variant has the amino acid sequence of SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, or SEQ ID NO: 30.
  • the D1L3 variant comprises, in order from N-terminus to C-terminus: an albumin amino acid sequence, an intermediate or long flexible linker, and a D1L3 amino acid sequence (i.e., including D1L3 variants).
  • SEQ ID NO: 28 further comprises an albumin fusion at the C-terminus through a long flexible peptide linker.
  • the linker is cleavable by a protease, such as a coagulation pathway protease, such as activated Factor XII.
  • a protease such as a coagulation pathway protease, such as activated Factor XII.
  • the linker contains amino acid sequence of Factor XI and/or prekallikrein.
  • the linker includes a peptide sequence that is targeted for cleavage by a neutrophil specific protease, such as neutrophil elastase, cathepsin G, or proteinase 3.
  • the invention provides variants of extracellular DNASE enzymes engineered to have advantages in manufacturing, providing for production of the recombinant enzyme suitable for use in therapy.
  • the invention provides a recombinant Dl, D1L1, D1L2, and D1L3 variant comprising one or more amino acid substitutions in cysteine residues (or PEGylation of Cys residues) resulting in reduced intra- and inter-molecular cross-linking via disulfide bridges during protein expression.
  • the invention provides variants of extracellular DNASE enzymes engineered to have advantages in protease resistance, for improving in vivo exposure, e.g., slowing elimination, e.g. extending half-life (e.g., serum half-life), and extending duration of pharmacodynamic activity, as well as reducing proteolysis during recombinant enzyme production.
  • This disclosure identifies, for example, D1L3 residues that are sensitive to proteolysis by plasmin, thrombin, and/or trypsin, as well as residues (e.g., paired basic amino acids) that are sensitive to proteases produced by mammalian and non-mammalian cell lines. Engineered mutation of these residues can confer these advantages in protease resistance.
  • the invention provides a method for recombinant production of extracellular DNASE proteins, including variants thereof described herein.
  • the method employs a non-mammalian expression system, e.g., a eukaryotic non-mammalian expression system, such as Pichia pastoris.
  • a non-mammalian expression system e.g., a eukaryotic non-mammalian expression system, such as Pichia pastoris.
  • the Pichia pastoris encodes the DNase enzyme with its native signal peptide allowing for secretion from host cells.
  • the expression system is a mammalian cell expression system, such as Chinese Hamster Ovary (CHO) cells.
  • the recombinant expression system has a deletion or inactivation of one or more proteases that cleave at paired basic amino acids.
  • exemplary enzymes include Furin (expressed by CHO cells) and Aspartic proteinase 3 (Yspl) and Kexin (Kex2) expressed by Pichia pastoris. In some embodiments, these enzymes are not genetically deleted or inactivated, but their activity is inhibited with a protease inhibitor during recombinant protein production.
  • the growth medium for the non-mammalian expression system or mammalian expression system is supplemented with polyanions such as dextran sulfate, heparins, ferric citrate, and EDTA.
  • the growth medium of Pichia pastoris or other expression system is supplemented with dextran sulfate that has an average molecular weight of between 5 kDa and 100 kDa.
  • the polyanion may be added to the culture in an amount sufficient to complex with the recombinant protein produced.
  • the recombinant extracellular DNASE proteins and variants thereof from the culture medium of non- mammalian expression system or mammalian expression system are purified through a method that includes the dissociation of recombinant extracellular DNASE proteins and variants from polyanions such as dextran sulfate, heparins, and EDTA.
  • the invention provides isolated polynucleotides encoding the Dl, D1L1, D1L2, or D1L3 variants, as well as vectors and host cells.
  • Polynucleotides may be encoding mRNA or DNA.
  • Host cells can be cells of a recombinant expression system, including bacterial or eukaryotic, whether non-mammalian such as Pichia pastoris, or mammalian such as CHO cells. In other embodiments, the host cell can be delivered for DNASE therapy.
  • the invention in some embodiments provides host cells, e.g., human cells, e.g., white blood cells, modified to secrete one or more of the extracellular DNASE proteins described herein, and intended for administration as a therapeutic agent.
  • host cells e.g., human cells, e.g., white blood cells
  • the invention further provides pharmaceutical compositions comprising the extracellular DNASE protein or variant thereof as described herein, or optionally the polynucleotide or the vector as described, and a pharmaceutically acceptable carrier.
  • the pharmaceutical composition may be formulated for any administration route.
  • the invention provides a method for treating a subject in need of extracellular DNA degradation, extracellular chromatin degradation, extracellular trap (ET) degradation and/or neutrophil extracellular trap (NET) degradation, by administering a therapeutically effective amount of the extracellular DNASE or variant thereof or composition described herein.
  • FIG. 1 illustrates that the mutations Q101R and Q282_S305delinsK in SEQ ID NO: 4 increase the activity to degrade high-molecular weight chromatin of DNASE1L3.
  • CHO cells were transiently transfected with wild-type DNASE1L3 or DNASE1L3 with building block substitutions. Supernatants of transfected cells were incubated with purified nuclei (high-molecular weight chromatin) or buffer. DNA was isolated and analyzed by agarose gel electrophoresis. The figure shows the agarose gel stained with a DNA dye.
  • FIG. 2 shows that the characterization of two DNASE 1L3 variants.
  • Different concentrations of supernatants of CHO cell that were transfected with wild-type DNASE1L3 or DNASE1L3 with a Q101R or Q282_S305delinsK mutation were analyzed by Western Blot (WB) using an anti-DNASElL3 antibody.
  • a larger (variant 1) and a smaller (variant 2) bands were detected in samples with wild-type DNASE1L3 and the Q101R mutant. Only the smaller band (variant 2) was shown in samples with the Q282_S305delinsK mutant.
  • the chromatin degrading activity in the different concentrations of supernatants was analyzed.
  • the figure shows DNA analyzed by agarose gel electrophoresis. Both, Q101R or Q282_S305delinsK mutations, increased the chromatin degrading activity compared to wild-type DNASE 1L3.
  • FIG. 3 illustrates the presence of DNASE1L3 variant 1 and 2 in supernatants of CHO cell that were stably transfected with wild-type DNASE1L3.
  • Samples were analyzed by Western Blot (WB) using an anti-DNASElL3 antibody. A larger (variant 1) and a smaller (variant 2) bands were detected in 5 clones.
  • FIG. 4 shows C-terminal amino acid sequences of recombinantly expressed wild-type D1L3 in Pichia pastoris to identify frequent cleavage sites.
  • Amino acid sequencing of purified wild-type D1L3 identified three C-terminal deletion mutants: K29l_S305del, K292_S305del, and S293_S305del. The C-terminus of wild-type D1L3 was not detected.
  • FIG. 5 shows that the addition of dextran sulfate to CHO medium improves protein yield.
  • Stable pools of CHO cells expressing wild-type D1L3 were incubated in standard CHO medium or CHO medium supplemented with dextran sulfate.
  • Supernatants were analyzed by Western Blot (WB) using an anti-DNASElL3 antibody.
  • WB Western Blot
  • the figure shows that D1L3 expresses poorly in CHO cells with low yield. Addition of dextran sulfate increases the yield, but does not prevent production fragmentation.
  • FIG. 6 illustrates the use of anion exchange surface and cation exchange surface for affinity purification of dextran sulfate-complexed D1L3.
  • FIG. 7 lists trypsin cleavage site mutation strategies to limit D1L3 degradation.
  • FIG. 8 is an alignment of human Dl (SEQ ID NO: 1) and human D1L3 (SEQ ID NO: 4) amino acid sequences, with plasmin sensitive KR residues shown.
  • FIG. 9 illustrates plasmin cleavage site mutation strategies to limit D1L3 degradation.
  • FIG. 10 shows that D1L3 with plasmin cleavage sites mutated retains enzymatic activity.
  • Supernatants from cells that were transiently transfected DNASE 1L3 containing mutations in four putative plasmid cleavage sites (Kl80_Al8ldelinsGL, Pl98_A20ldelinsRPSQ, K259A, R285A) were incubated with purified nuclei (high- molecular weight chromatin) or buffer.
  • DNA was isolated and analyzed by agarose gel electrophoresis. The figure shows the agarose gel stained with a DNA dye.
  • FIG. 11 lists plasmin cleavage sites based on plasmin digestion and shows mutation strategies to limit D1L3 degradation.
  • FIG. 12 shows that D1L3 has a propensity to misfold when expressed in CHO cells.
  • Panel A illustrates a simple expression vector for D1L3 expression using the native secretory signal peptide. Supernatants of stable pools were analyzed by Western Blot using an anti-DNASElL3 antibody
  • Panel B shows presence of high molecular weight aggregates under non-reducing conditions, which are resolved under reducing conditions.
  • FIG. 13 is an alignment of human Dl (SEQ ID NO: 1) and human D1L3 (SEQ ID NO: 4) amino acid sequences, with conserved and non-conserved cysteine residues shown.
  • FIG. 14 lists the cysteine residues in D1L3, and shows mutation strategies to limit high molecular weight aggregates during protein expression.
  • FIG. 15 shows that C68A and C194A mutation in D1L3 does not impact chromatin degrading activity.
  • the mutations C24A and C52A abrogated chromatin degrading activity.
  • Supernatants from cells that were transiently transfected with mutated DNASE1L3 variants were incubated with purified nuclei or buffer. DNA was isolated and analyzed by agarose gel electrophoresis. The figure shows the agarose gel stained with a DNA dye.
  • FIG. 16A illustrates expression of D1L3 in Pichia pastoris using either the native secretory signal or a-mating factor from Saccharomyces cerevisiae (aMF). aMF resulted in glycosylation and non-processing of the signal peptide (FIG. 16B).
  • FIG. 17A illustrates a fusion construct with aMF, human serum albumin
  • FIG. 17B illustrates the expression levels human serum albumin (HSA) fusion constructs of Basic Domain Deleted-DNASElL3 (BDD-D1L3) or wild-type DNASE1L3 (D1L3) in Pichia pastoris.
  • the HSA is fused either to the N- or C-terminus of BDD-D1L3 or D1L3.
  • Two linker sequences, Ll and L2, were placed between HSA and BDD-D1L3 or D1L3.
  • FIG. 19 illustrates the expression levels human serum albumin (HSA) fusion constructs of wild-type DNASE1L3 (D1L3) in Pichia pastoris.
  • the HSA is fused to the N- terminus of D1L3.
  • Three different linker sequences (L2, L3, L4) were placed between HSA and D1L3.
  • FIG. 20 illustrates the expression levels and chromatin degrading activity of human serum albumin (HSA) fusion constructs of Basic Domain Deleted-DNASElL3 (BDD-D1L3) produced in Pichia pastoris.
  • the HSA is fused to the N- terminus of BDD- D1L3.
  • Three different linker sequences (L5, L6, L7) were placed between HSA and D1L3.
  • FIG. 21A shows that DnaseP ⁇ DnaselB 1 mice injected with SED ID NO: 14 and SEQ ID NO: 19 show similar chromatin degrading activity in serum.
  • FIG. 21B shows that SEQ ID NO: 19 has a circulation half-life of 3.3 days in mice expressing the human FcRn receptor.
  • FIG. 22 illustrates the expression levels and chromatin degrading activity of human serum albumin (HSA) fusion constructs of Basic Domain Deleted-DNASElL3 (BDD-D1L3) produced in Pichia pastoris.
  • HSA human serum albumin
  • BDD-D1L3 Basic Domain Deleted-DNASElL3
  • the HSA is fused to the N- terminus and C- terminus of BDD-D1L3.
  • Two different linker sequences (L7 and L8) were placed between HSA and BDD-D1L3.
  • FIG.23 illustrates a fusion construct with HSA and a linker cleavable by Factor Xlla.
  • a linker containing a human Factor XI sequence (SEQ ID NO: 42) and a linker containing a human prekallekrein (SEQ ID NO: 44) sequence are shown.
  • FIG. 24 illustrates other constructs that employ Factor Xlla cleavable linkers for half-life extended fusion proteins, including for human extracellular DNases, human coagulation factors, and human complement factors. DESCRIPTION OF THE INVENTION
  • the present invention provides candidates of engineered human extracellular DNASE proteins (e.g., variants of DNASE 1 (Dl), DNASE 1 -LIKE 1 (D1L1), DNASE1- LIKE 2 (D1L2), DNASE 1 -LIKE 3 Isoform 1 (D1L3), DNASE 1 -LIKE 3 Isoform 2 (D1L3-2), DNASE2A (D2A), and DNASE2B (D2B)) that are useful for treating conditions characterized by extracellular DNA, extracellular chromatin, and neutrophil extracellular trap (NET) accumulation and/or release.
  • the DNase variants described herein are more suitable and/or effective for therapy and/or are more amenable to large-scale manufacturing.
  • the DNase variants described herein have benefits for systemic therapy. Such benefits include longer exposure (e.g., slower elimination, longer circulatory half-life), extended duration of pharmacodynamic action, improved chromatin-degrading activity, and protease resistance.
  • a reference to“an agent” includes a single agent and a plurality of such agents.
  • chromatinase refers to a class of deoxyribonuclease enzyme that exhibits more than a negligible ability to cut, cleave or digest chromatin, i.e., DNA associated with one or more histone proteins.
  • Human DNASE1L3 is a chromatinase.
  • the various DNASE1L3 variants disclosed herein are chromatinases. Not all DNASE enzymes are chromatinases.
  • human DNASE1 has essentially no ability to cut, cleave, or digest chromatin and is not a chromatinase.
  • half-life refers to the elimination half- life of the concentration of the drug in an animal, as measured in a matrix of interest, e.g., serum or plasma.
  • a matrix of interest e.g., serum or plasma.
  • half-life extension or extended half-life are expressions that refer to a slower rate of elimination.
  • isolated means altered or removed from the natural state.
  • nucleic acid or a peptide naturally present in a living animal is not“isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is“isolated.”
  • An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
  • nuclear contents e.g., DNA bound to histone proteins that are released from an immune cell, typically a neutrophil, in a programmed fashion.
  • nucleotide sequence or nucleic acid encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
  • the phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
  • extracellular DNASE refers to extracellular DNASE proteins of the DNASE1- and DNASE2-family (e.g., DNASE1 (Dl), DNASE1-LIKE 1 (D1L1), DNASE1-LIKE 2 (D1L2), DNASE1-LIKE 3 Isoform 1 (D1L3), DNASE1-LIKE 3 Isoform 2 (D1L3-2), DNASE2A (D2A), and DNASE2B (D2B)).
  • DNASE1 DNASE1 (Dl)
  • DNASE1-LIKE 1 D1L1
  • D1L2 DNASE1-LIKE 2
  • D1L3 DNASE1-LIKE 3 Isoform 1
  • D1L3-2 DNASE1-LIKE 3 Isoform 2
  • D2A DNASE2A
  • DNASE2B DNASE2B
  • the extracellular DNASE or variant thereof is fused, optionally by means of an interposed linker, to a half-life extending moiety, such as albumin, transferrin, an Fc, or elastin-like protein, or a variant thereof. See, e.g., US 9,458,218, which is hereby incorporated by reference in its entirety.
  • the extracellular DNASE or variant thereof is dimerized by an immunoglobulin hinge region.
  • the engineered enzymes described herein may also include an Fc-fusion domain (e.g., a hinge and CH2 domains and CH3 domains of an immunoglobulin).
  • the DNASE (e.g., D1L3 variant) is fused to an albumin amino acid sequence or domain, e.g., human albumin or a fragment or variant thereof.
  • albumin can be joined to the DNASE, optionally with an interposed linker, at the N-terminus and/or the C-terminus of the engineered extracellular DNASE or variant thereof.
  • An exemplary albumin amino acid sequence is provided by SEQ ID NO: 39.
  • D1L3 and Dl, or variants as described herein are together dimerized by an Fc hinge region, creating a dimeric molecule with synergistic functional properties for degrading NETs.
  • the extracellular DNASE or variant thereof is fused at the N-terminus to an albumin amino acid sequence, through a peptide linker.
  • the peptide linker may be a flexible linker, a rigid linker, or in some embodiments a physiologically-cleavable linker (e.g., a protease-cleavable linker).
  • the linker is 5 to 100 amino acids in length, or is 5 to 50 amino acids in length.
  • the linker is an organic molecule, group, polymer (e.g., PEG), or chemical moiety that is covalently coupled to the extracellular DNASE and half-life extending moiety (e.g., albumin).
  • the invention provides a D1L3 variant, wherein the D1L3 variant has one or more of increased protein stability, increased pharmacokinetic exposure and duration of pharmacodynamic activity, resistance to proteolytic degradation, higher production levels with in vitro expression systems, better suitability for purification, and not substantially less, the same, or better chromatin and/or NET-degrading activity as compared to wild-type D1L3 Isoform 1 enzyme of SEQ ID NO:4 or wild-type D1L3 Isoform 2 enzyme of SEQ ID NO:5.
  • the term“D1L3” includes either Isoform 1 or Isoform 2.
  • the DNA- and/or chromatin- and/or NET-degrading activity of an enzyme can be measured in vitro, for example by incubation of the enzyme with DNA, chromatin, or NETs, obtained, e.g., from purified nuclei, DNA, or ex vivo blood or neutrophils induced to form NETs.
  • DNA, chromatin, or NETs obtained, e.g., from purified nuclei, DNA, or ex vivo blood or neutrophils induced to form NETs.
  • the DNA- and/or chromatin- and/or NET-degrading activity of an enzyme e.g.
  • a D1L3 variant can be measured in vivo, for example by administering the enzyme to a subject, wherein the subject produces or is induced to produce extracellular DNA, chromatin, or NETs, and measuring the effect of the enzyme on concentrations of DNA, chromatin, or NET levels in a matrix, e.g. serum, preferably with a parallel negative control, or by temporally comparing the concentrations before and after administration of the enzyme.
  • a matrix e.g. serum
  • the D1L3 variant has approximately the same chromatin- and/or NET-degrading activity as compared to wild-type D1L3 Isoform 1 enzyme of SEQ ID NO:4 or wild-type D1L3 Isoform 2 enzyme of SEQ ID NO:5. In some embodiments, D1L3 variant has higher chromatin- and/or NET-degrading activity as compared to wild-type D1L3 Isoform 1 enzyme of SEQ ID NO:4 or wild-type D1L3 Isoform 2 enzyme of SEQ ID NO:5.
  • the D1L3 variant is a fusion protein comprising an albumin domain, an optional linker, and a D1L3 domain.
  • the albumin domain and optional linker are located on the N-terminal side of the D1L3 domain.
  • the albumin domain and optional linker are located on the C-terminal side of the D1L3 domain.
  • the optional linker is interposed between the albumin domain and the D1L3 domain.
  • the albumin amino acid sequence or domain of the fusion protein is at least about 75%, or at least about 80%, or at least about 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% identical to the reference albumin sequence defined by SEQ ID NO: 39.
  • the albumin amino acid sequence or domain comprises or consists of the reference albumin sequence defined by SEQ ID NO:39.
  • the albumin amino acid sequence binds to the neonatal Fc receptor (FcRn), e.g., human FcRn.
  • the albumin amino acid sequence may be a variant of wild-type HSA (e.g., as represented by SEQ ID NO: 39).
  • albumin variants may have from one to twenty, or from one to ten amino acid modifications independently selected from deletions, substitutions, and insertions with respect to SEQ ID NO: 39.
  • the albumin amino acid sequence is any mammalian albumin amino acid sequence.
  • the albumin amino acid sequence or domain is a fragment of full-length albumin, as represented by SEQ ID NO: 39.
  • a fragment of an albumin can refer to an amino acid sequence comprising a fusion of multiple domains of albumin (see, e.g., WO2011/124718), such as domains I and III, and domains II and III.
  • a fragment of albumin has at least about 100 amino acids or at least about 200 or at least about 300 amino acids of the full-length sequence.
  • the albumin fragment maintains the ability to bind human FcRn.
  • the DlL3-like domain of the fusion protein is at least about 85%, or at least about 90%, or at least about 95%, at least about 97%, or at least about 98%, or at least about 99% identical to the mature D1L3 enzyme reference sequence defined by SEQ ID NO:4 or SEQ ID NO:5.
  • the D1L3 domain comprises or consists of the reference sequence defined by SEQ ID NO:4 or SEQ ID NO:5.
  • the reference sequence does not include the C-terminal basic domain of SEQ ID NO: 4 or 5 defined by the C-terminal 23 amino acids.
  • the fusion protein comprises an D1L3 domain, wherein the amino acid sequence of the D1L3 domain is at least about 80% identical to the mature enzyme defined by SEQ ID NO:4 or SEQ ID NO:5.
  • the fusion protein can further comprise the albumin amino acid sequence or domain at the N-terminus of the mature enzyme, and a linking amino acid sequence between the albumin amino acid sequence and the amino acid sequence of the mature enzyme.
  • the D1L3 domain comprises an amino acid sequence that is at least about 90% identical to the mature enzyme reference sequence defined by SEQ ID NO:4 or SEQ ID NO:5.
  • the reference sequence does not include the C-terminal basic domain of SEQ ID NO: 4 or 5 defined by the C-terminal 23 amino acids.
  • the fusion protein comprising the D1L3 domain exhibits improved circulatory half-life and duration of pharmacodynamic effect, including for systemic therapy.
  • the fusion of albumin with linking sequence does not substantially impact (or in some embodiments does not have any negative impact on) chromatin-degrading activity as determined using an in vitro chromatin-degrading assay, as compared to the variant without an albumin fusion.
  • sequences refer to mature enzymes lacking the signal peptide. Further, unless stated otherwise, amino acid positions are numbered with respect to the full- translated DNase sequence, including signal peptide, for clarity. Accordingly, for example, reference to sequence identity to the enzyme of SEQ ID NO:4 (human D1L3, Isoform 1) refers to a percent identity with the mature enzyme having M21 at the N- terminus. Similarly, reference to sequence identity to the enzyme of SEQ ID NO: l (human Dl) refers to a percent identity with the mature enzyme having L23 at the N- terminus. In some embodiments, the D1L3 has a deletion of all or part of the C-terminal basic domain.
  • the C-terminal basic domain is defined as the C-terminal 23 amino acids of SEQ ID NO:4 or SEQ ID NO:5. Deletion or inactivation of the C-terminal basic domain of D1L3 substantially improves chromatin degrading activity. See FIGS. 1, 2, and 4.
  • the D1L3 variant has a deletion of C-terminal basic domain amino acids, such as at least 5 amino acids, or in some embodiments at least 10 amino acids, or in some embodiments at least 15 amino acids, or in some embodiments at least 20 amino acids of the C-terminal basic domain.
  • the D1L3 variant has a deletion of the entire C-terminal basic domain defined by the C-terminal 23 amino acids of SEQ ID NO:4 or SEQ ID NO:5.
  • Exemplary BD deletions include Q282_S305delinsK (see SEQ ID NO: 9), S305delinsK (see SEQ ID NO: 10), K292_S305del (see SEQ ID NO: 11), and S293_S305del (see SEQ ID NO: 12).
  • the C-terminus of the D1L3 domain (having a BD deletion) has from 1 to 10 or from 1 to 5 amino acids at the C-terminus that do not align with the C-terminal BD, and which do not negatively impact chromatin degrading activity in an in vitro assay.
  • the D1L3 variant is an engineered fusion protein comprising: a DNASE1L3 domain of a sequence selected from SEQ ID NO: 8 through SEQ ID NO: 16; a linker of a sequence selected from SEQ ID NO:3l through SEQ ID NO:38; and an albumin domain having the sequence of SEQ ID NO:39 or a variants or fragment as described.
  • the D1L3 variant has one or more building block substitutions from Dl, which are described in PCT/US2018/04708, which is hereby incorporated by reference.
  • the D1L3 sequence or domain contains a building block substitution from Dl, which can he selected from one or more of: M2l_R22delinsLK, C24_S 25 delins AA, V28_S30delinsIQT, S34T, Q36_V44delinsMSNATLVSY, K47_K50delinsQILS, C52Y, I55_M58delinsIALVQE, I60_K6ldelinsVR, N64_I70delinsHLTAVGK, M72_K74delinsLDN, R77_I83delinsQDAPD, N86H, I89V, S 91 _R92delinsEP, T97S, Q101R, A103L, L105V, Kl07_Ll l0delinsRPDQ,
  • VI l3_Rl 15 delins AVD, H118Y, H120D, Yl22_Al27delinsGCEPCGN, V129T, S131N, F 135_V 136delins AI, W138R, Ql40_Hl43delinFSRF,
  • the D1L3 variant may have the building block substitution from Dl of Q282_S305delinsK, which includes a deletion of the C terminal basic domain, which is absent in Dl.
  • the D1L3 enzyme has an amino acid substitution at the position corresponding to position 101 of SEQ ID NO:4.
  • the substitution can be Arg based on the corresponding building block from Dl, or in some embodiments is Lys. Substitutions at this position can enhance chromatin-degrading activity of D1L3. Other substitutions at this position will likely show similar properties.
  • Linkers where present can be selected from flexible, rigid, and cleavable peptide linkers.
  • Flexible linkers are predominately or entirely composed of small, non-polar or polar residues such as Gly, Ser and Thr.
  • An exemplary flexible linker comprises (Gly y Ser)n linkers, where y is from 1 to 10 (e.g., from 1 to 5), and n is from 1 to about 10, and in some embodiments, is from 3 to about 6. In exemplary embodiments, y is from 2 to 4, and n is from 3 to 8. Due to their flexibility, these linkers are unstructured. More rigid linkers include poly proline or poly Pro- Ala motifs and a-helical linkers.
  • An exemplary a-helical linker is A(EAAAK) n A, where n is as defined above (e.g., from 1 to 10, or 2 to 6).
  • linkers can be predominately composed of amino acids selected from Gly, Ser, Thr, Ala, and Pro.
  • Exemplary linker sequences contain at least 10 amino acids, and may be in the range of 15 to 35 amino acids.
  • Exemplary linker designs are provided as SEQ ID NOS: 31 to 38.
  • the variant comprises a linker, wherein the amino acid sequence of the linker is predominately glycine and serine residues, or consists essentially of glycine and serine residues.
  • the ratio of Ser and Gly in the linker is, respectively, from about 1 : 1 to about 1 : 10, from about 1 :2 to about 1 :6, or about 1:4.
  • Exemplary linker sequences comprise S(GGS)4GSS (SEQ ID NO: 36), S(GGS GS (SEQ ID NO: 37), (GGS GS (SEQ ID NO: 39).
  • the linker has at least 10 amino acids, or at least 15 amino acids, or at least 20 amino acids, or at least 25 amino acids.
  • the linker may have a length of from 15 to 30 amino acids.
  • longer linkers of at least 15 amino acids can provide improvements in yield upon expression in Pichia pastoris. See FIG.20.
  • longer linker sequences showed improved chromatin-degrading activity, as compared to shorter linker sequences. See FIG. 20.
  • D1L3 variant is a fusion protein comprising the amino acid sequence of any one of SEQ ID NOS: 17 to 30.
  • the D1L3 variant is a fusion protein comprising the amino acid sequence of any one of SEQ ID NOS: 17 to 30 and having from one to twenty or from one to ten, or from one to five amino acid modifications independently selected from amino acid insertions, deletions, or substitutions with respect to the reference sequence selected from SEQ ID NOS: 17 to 30.
  • the amino acid modifications are in the D1L3 domain, the albumin domain, or in both domains of the fusion protein.
  • the variant has the amino acid sequence of SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, or SEQ ID NO: 30.
  • the albumin amino acid sequence is fused at the N-terminus or N-terminal side of D1L3 (or variant) through an intermediate or long flexible linker.
  • the linker is a physiologically-cleavable linker, such as a protease-cleavable linker.
  • the protease may be a coagulation pathway protease, such as activated Factor XII.
  • the linker comprises the amino acid sequence of Factor XI (SEQ ID NO: 42) and/or prekallikrein (SEQ ID NO: 44 or 45) or a physiologically cleavable fragment thereof.
  • the linker amino acid sequence from Factor XI contains all or parts of SEQ ID NO: 42 (e.g., parts of SEQ ID NO:42, including modifications of SEQ ID NO:42 that allow for cleavage by Factor Xlla).
  • the linker amino acid sequence from prekallikrein contains all or parts of SEQ ID NO: 44 (e.g., parts of SEQ ID NO: 44, including modifications of SEQ ID NO: 44 that allow for cleavage by Factor Xlla).
  • the linker includes a peptide sequence that is targeted for cleavage by a neutrophil specific protease, such as neutrophil elastase, cathepsin G, and proteinase 3.
  • D1L3 fusion proteins comprise a combination of three amino acid sequences that can be independently selected from sequences disclosed herein, and such sequences arranged in order from N-terminus to C-terminus: Fusion 1: SEQ ID NO:4, SEQ ID NO:3l, SEQ ID NO:39; Fusion 2: SEQ ID NO:5, SEQ ID NO:3l, SEQ ID NO:39; Fusion 3: SEQ ID NO:8, SEQ ID NO:3l, SEQ ID NO:39; Fusion 4: SEQ ID NO:9, SEQ ID NO:3l, SEQ ID NO:39; Fusion 5: SEQ ID NO: 10, SEQ ID NO:3l, SEQ ID NO:39; Fusion 6: SEQ ID NO: 11, SEQ ID NO:3l, SEQ ID NO:39; Fusion 7: SEQ ID NO: 12 SEQ ID NO:3l, SEQ ID NO:39; Fusion 8: SEQ ID NO: 13, SEQ ID NO:3l, SEQ ID NO:39; Fusion 9: SEQ ID NO:
  • Fusion 104 SEQ ID NO: 10, SEQ ID NO:43, SEQ ID NO:39;
  • Fusion 105 SEQ ID NO: 11, SEQ ID NO:43, SEQ ID NO:39;
  • Fusion 106 SEQ ID NO: 12 SEQ ID NO:43, SEQ ID NO:39;
  • Fusion 107 SEQ ID NO: 13, SEQ ID NO:43, SEQ ID NO:39;
  • Fusion 108 SEQ ID NO: 14, SEQ ID NO:43, SEQ ID NO:39;
  • Fusion 109 SEQ ID NO: 15, SEQ ID NO:43, SEQ ID NO:39;
  • Fusion 110 SEQ ID NO: 16, SEQ ID NO:43, SEQ ID NO:39;
  • Fusion 111 SEQ ID NO: 4, SEQ ID NO: 44, SEQ ID NO: 39;
  • Fusion 112 SEQ ID NO:5, SEQ ID NO:44, SEQ ID NO:39;
  • Fusion 113 SEQ ID NO:8, SEQ ID NO:44, SEQ ID NO:39;
  • Fusion 114 SEQ ID NO: 9, SEQ ID NO: 44, SEQ ID NO: 39;
  • Fusion 115 SEQ ID NO: 10, SEQ ID NO:44, SEQ ID NO:39;
  • Fusion 116 SEQ ID NO: 11, SEQ ID NO:44, SEQ ID NO:39;
  • Fusion 118 SEQ ID NO: 13, SEQ ID NO:44, SEQ ID NO:39;
  • Fusion 120 SEQ ID NO: 15, SEQ ID NO:44, SEQ ID NO:39;
  • Fusion 121 SEQ ID NO: 16, SEQ ID NO:44, SEQ ID NO:39;
  • Fusion 122 SEQ ID NO:4, SEQ ID NO:45, SEQ ID NO:39;
  • Fusion 123 SEQ ID NO:5, SEQ ID NO:45, SEQ ID NO:39;
  • Fusion 124 SEQ ID NO:8, SEQ ID NO:45, SEQ ID NO:39;
  • Fusion 125 SEQ ID NO:9, SEQ ID NO:45, SEQ ID NO:39;
  • Fusion 126 SEQ ID NO: 10, SEQ ID NO:45, SEQ ID NO:39;
  • Fusion 127 SEQ ID NO: 11, SEQ ID NO:45, SEQ ID NO:39;
  • Fusion 128 SEQ ID NO: 12 SEQ ID NO:45, SEQ ID NO:39;
  • Fusion 129 SEQ ID NO: 13, SEQ ID NO:45, SEQ ID NO:39;
  • Fusion 130 SEQ ID NO: 14, SEQ ID NO:45, SEQ ID NO:39;
  • Fusion 131 SEQ ID NO: 15, SEQ ID NO:45, SEQ ID NO:39;
  • Fusion 132 SEQ ID NO: 16, SEQ ID NO:45, SEQ ID NO:39;
  • the fusion protein is synthesized with a signal peptide.
  • the signal peptide may be removed during secretion from the host cell.
  • Exemplary signal peptides are shown SEQ ID NOS: 4 to 16 and SEQ ID NOS: 44 to 46.
  • the fusion protein is the mature protein, that is, lacking a signal peptide.
  • the fusion protein is selected from fusion proteins 1 to 132, and the selected fusion protein may optionally have up to 20 (or up to 10) amino acid modifications independently selected from amino acid deletions, insertions, and substitutions.
  • the invention provides variants of extracellular DNASE enzymes engineered to have advantages in manufacturing, providing for production of the recombinant enzyme suitable for use in therapy, and which can optionally be used in connection with fusion protein embodiments (including albumin fusion embodiments) as already described.
  • the invention provides a recombinant Dl, D1L1, D1L2, and D1L3 variant comprising one or more amino acid substitutions or deletions of cysteine residues resulting in reduced intra- and inter-molecular cross- linking via disulfide bridges during protein expression.
  • the DNase variant may lack one, two, or three cysteine residues present in the wild-type sequence (e.g., one, two, or three cysteine residues are deleted), or has one or more of such cysteine(s) substituted with other amino acid(s).
  • the one or more cysteine residues are substituted with an amino acid independently selected from Ala, Gly, and Ser, or one or more of the cysteine residues are substituted as part of a building block substitution.
  • the one or more cysteine residues that are substituted is/are not conserved between other members of the Dl protein family (e.g., Dl, D1L1, D1L2, and D1L3).
  • the engineered enzyme comprises or further comprises at least one building block substitution from another member of the Dl protein family and/or other point mutation that results in increased protein stability, increased resistance towards degradation by proteases, increased bioavailability, and substantially the same or better DNA and/or chromatin and/or NET-degrading activity (in vitro or in vivo) as compared to the wild-type enzyme.
  • the substitutions and/or modifications include, among other modifications, only a single modification in cysteine residues. In some embodiments, removal of a single cysteine residue is sufficient for significant advantages in manufacturing.
  • the invention provides variants of extracellular DNASE enzymes engineered to have advantages in protease resistance, for improving in vivo half-life as well as reducing proteolysis during recombinant enzyme production.
  • This disclosure identifies, for example, D1L3 residues that are sensitive to proteolysis by plasmin, thrombin, and/or trypsin, as well as residues (e.g., paired basic amino acids) that are sensitive to proteases produced by mammalian and non-mammalian cell lines.
  • the recombinant extracellular DNASE variants described herein may have a combination of point mutations including substitutions in cysteine residues, substitutions in protease-sensitive residues, and/or may comprise one or more block substitutions.
  • Building Block Protein Engineering (BBPE) is described in PCT/US18/47084 and US 62/800,790, the disclosures of which are hereby incorporated by reference.
  • BBPE involves providing a protein-protein alignment of donor and recipient extracellular DNASE enzyme and identifying variable amino acid sequences for transfer (“building block”).
  • the variable amino acid(s) are flanked by one or more conserved amino acids in the donor and recipient extracellular DNASE enzymes (upstream and downstream of the building block). These building blocks can be swapped between recipient and donor proteins, to produce a chimeric enzyme.
  • the invention provides a method for recombinant production of extracellular DNASE proteins, including variants thereof described herein.
  • the method employs a non-mammalian expression system, such as Pichia pastoris.
  • the Pichia pastoris encodes the DNase enzyme with the native signal peptide allowing for secretion from host cells.
  • the expression system is a mammalian cell expression system, such as Chinese Hamster Ovary (CHO) cells.
  • the invention avoids inter-molecular and intra-molecular disulfide bonds that otherwise form and hinder recombinant production.
  • substantial reductions in erroneous inter-molecular and intra-molecular disulfide bonds can be achieved with the substitution of a single cysteine residue.
  • the recombinant expression system has a deletion or inactivation of one or more proteases that cleave at paired basic amino acids.
  • exemplary enzymes include Furin (expressed by CHO cells) and Aspartic proteinase 3 (Yspl) and Kexin (Kex2) expressed by Pichia pastoris.
  • these enzymes are not genetically deleted or inactivated, but their activity is inhibited with a protease inhibitor during recombinant protein production.
  • the growth medium for the non-mammalian expression system or mammalian expression system is supplemented with polyanions such as dextran sulfate, heparins, ferric citrate, and EDTA.
  • the growth medium of Pichia pastoris or other expression system is supplemented with dextran sulfate that has an average molecular weight of between 5 kDa and 100 kDa.
  • the dextran sulfate has an average molecular weight that is about 10 kDa or less, or about 20 kDa or less, or about 30 kDa or less, or about 40 kDa or less, or about 50 kDa or less, or about 75 kDa or less, or about 100 kDa or less.
  • the polyanion is added to the culture in an amount sufficient to complex with the recombinant protein produced.
  • the recombinant extracellular DNASE proteins and variants thereof from the culture medium of non-mammalian expression system or mammalian expression system are purified through a method that includes the dissociation of recombinant extracellular DNASE proteins and variants from poly anions such as dextran sulfate, heparins, EDTA.
  • the purification method includes strong anion exchange resins such as triethylaminoethyl.
  • the extracellular DNASE protein produced according to the method is D1L3 or a variant thereof.
  • the invention provides a D1L3 variant comprising an amino acid sequence that is at least 80% identical to the enzyme defined by SEQ ID NO: 4 (human D1L3, Isoform 1) or SEQ ID NO: 5 (human D1L3, Isoform 2), and having one or more substitutions of cysteine residues and/or one or more substitutions of amino acids that are sensitive to proteolysis, e.g., in vivo proteolysis.
  • the D1L3 protein variant comprises one or more additional modifications that result in increased protein stability (e.g., protease resistance), higher production levels with in vitro expression systems, and/or not substantially less, the same, or better DNA and/or chromatin and/or NET-degrading activity as compared to wild-type D1L3 protein of SEQ ID NO:4 or SEQ ID NO: 5.
  • the D1L3 variant may comprise at least one additional building block substitution or point mutation disclosed in PCT/US2018/47084 (which is hereby incorporated by reference in its entirety), or may include one or more substitutions described herein for increasing protease resistance.
  • the D1L3 variant has a substitution of Cys 68, which is optionally substituted with an amino acid selected from Ala, Ser, and Gly.
  • the variant comprises the substitution N64_I70delinsHLTAVGK.
  • the sequence HLTAVGK can be further modified by one, two, or three substitutions, deletions, and/or insertions (collectively), with the proviso that a Cys residue is not included.
  • the D1L3 variant comprises an amino acid sequence that has at least about 85%, at least about 90%, at least about 95%, or at least about 98% identity to the reference SEQ ID NO:4 or SEQ ID NO: 5.
  • the invention provides a D1L3 enzyme having a polyethylene glycol (PEG) moiety conjugated at the position corresponding to Cys 68, which is believed to be an unpaired cysteine.
  • the D1L3 variant has a PEG conjugation to the amino acid corresponding to Cl 94.
  • the PEG moiety will provide a half-life extension property, while avoiding disulfide scrambling and/or protein misfolding.
  • the PEG moiety is conjugated through maleimide chemistry, which can be conducted under mild conditions.
  • conjugation chemistries are known and may be used, such as vinyl sulfone, dithyopyridine, and iodoacetamide activation chemistries.
  • the PEG moiety can be linear or branched, and can be generally in the range of 10 kDa to 40 kDa, or in the range of 20 to 30 kDa.
  • the invention provides a D1L3 variant comprising one or more substituted arginine and/or lysine residues resulting in increased protease resistance.
  • the D1L3 variant has a substitution at one or more positions corresponding to K180, K200, K259, and/or R285 of SEQ ID NO:4.
  • such lysine and arginine residues are identified as potential protease-sensitive sites.
  • one or more (e.g., 1, 2, 3, or 4) of these residues may be modified with a non-charged residue, such as a residue independently selected from Ala, Gly, Leu, Ile, Val, Thr, Ser, and Pro.
  • protease-sensitive lysine or arginine residues are substituted as part of a building block substitution.
  • the D1L3 variant may comprise one or more substitutions selected from: Kl80_Al8ldelinsGL, Pl98_A20ldelinsRPSQ, and K259A.
  • the D1L3 variant comprises one or both substitutions: Kl80_Al8ldelinsGL, and/or Pl98_A20ldelinsRPSQ, either of which are optionally modified by one or two amino acid substitutions, deletions, or insertions, with the proviso that the building block substitution is not modified by substitution or insertion with an R or K residue.
  • the D1L3 variant has increased resistance to proteolysis by one or more proteases selected from plasmin, thrombin, and/or trypsin.
  • the D1L3 variant comprises one or more mutations of a paired basic residue.
  • the paired basic residue corresponds to a position selected from K50/R51, R80/R81, K114/R115, K199/K200, K226/K227, K291/K292, R297/K298/K299, and K303/R304 of SEQ ID NO:4.
  • the D1L3 variant has one or more substitutions selected from a substitution corresponding to R114T, R114A, R114D, R114Q, K227S, and K227E of SEQ ID NO:4.
  • the one or more mutations of a paired basic residue include an amino acid substitution corresponding to R51K, R81K, R115K, and R304K.
  • the paired basic residue is substituted using a corresponding building block substitution.
  • the D1L3 variant will be more resistant to proteases expressed by the recombinant protein expression system (e.g., CHO and Pichia pas tor is).
  • the invention provides a DNase 1 (Dl) variant comprising an amino acid sequence that is at least 80% identical to the enzyme defined by SEQ ID NO: 1, with one or more substitutions of cysteine residues.
  • the Dl protein variant has one or more additional modifications resulting in increased protein stability, higher production levels with in vitro expression systems, and/or not substantially less, the same, or better DNA and/or chromatin and/or NET-degrading activity as compared to wild-type Dl protein of SEQ ID NO: l.
  • the Dl variant may comprise at least one additional building block substitution or point mutation disclosed in PCT/US2018/47084, which is hereby incorporated by reference in its entirety.
  • the Dl variant has a substitution of one or both of Cl 23 and C126, and which is/are optionally substituted with Ala, Ser, and Gly. In some embodiments, the Dl variant comprises the substitution Gl22_Nl28delinsYQGDA. In some embodiments, the Dl variant comprises an amino acid sequence that has at least 85%, at least 90%, at least 95%, or at least 98% identity to SEQ ID NO: 1.
  • the invention provides a Dl enzyme having a PEG moiety conjugated at the position corresponding to Cl 23 and/or C126.
  • the PEG moiety will provide a half-life extension property, while avoiding disulfide scrambling and/or protein misfolding.
  • the PEG moiety is conjugated through maleimide chemistry, which can be conducted under mild conditions. Other conjugation chemistries are known and may be used, such as vinyl sulfone, dithyopyridine, and iodoacetamide activation chemistries.
  • the PEG moiety can be linear or branched, and can be generally in the range of 10 kDa to 40 kDa, or in the range of 20 to 30 kDa.
  • the invention provides aDlLl variant comprising an amino acid sequence that is at least 80% identical to the enzyme defined by SEQ ID NO: 2, with one or more substituted cysteine residues.
  • the cysteine residue(s) are optionally non- conserved within the Dl family (e.g., C22 and/or C50), and are optionally substituted with Gly, Arg, or Ser, or are substituted as part of a building block substitution.
  • the D1L1 variant comprises an amino acid sequence that has at least 85%, at least 90%, at least 95%, or at least 98% identity to SEQ ID NO: 2.
  • the invention provides a D1L1 enzyme having a PEG moiety conjugated at the position corresponding to C22 and/or C50.
  • the PEG moiety will provide a half-life extension property, while avoiding disulfide scrambling and/or protein misfolding.
  • the PEG moiety is conjugated through maleimide chemistry, which can be conducted under mild conditions. Other conjugation chemistries are known and may be used, such as vinyl sulfone, dithyopyridine, and iodoacetamide activation chemistries.
  • the PEG moiety can be linear or branched, and can be generally in the range of 10 kDa to 40 kDa, or in the range of 20 to 30 kDa.
  • the invention provides aDlL2 variant comprising an amino acid sequence that is at least 80% identical to the enzyme defined by SEQ ID NO: 3, with one or more substituted cysteine residues.
  • the cysteine residues may be non-conserved within the Dl family (e.g., C43), and is/are optionally substituted with Gly, Arg, or Ser, or are substituted as part of a building block substitution.
  • the D1L2 variant comprises an amino acid sequence that has at least 85%, at least 90%, at least 95%, or at least 98% identity to SEQ ID NO: 3.
  • the invention provides a D1L2 enzyme having a PEG moiety conjugated at the position corresponding to C43.
  • the PEG moiety will provide a half-life extension property, while avoiding disulfide scrambling and/or protein misfolding.
  • the PEG moiety is conjugated through maleimide chemistry, which can be conducted under mild conditions. Other conjugation chemistries are known and may be used, such as vinyl sulfone, dithyopyridine, and iodoacetamide activation chemistries.
  • the PEG moiety can be linear or branched, and can be generally in the range of 10 kDa to 40 kDa, or in the range of 20 to 30 kDa.
  • the invention provides isolated polynucleotides encoding the Dl, D1L1, D1L2, or D1L3 variants disclosed herein, as well as vectors and host cells.
  • Host cells can be cells of any expression system, including bacterial or eukaryotic, whether non-mammalian such as Pichia pastoris, or mammalian such as CHO cells.
  • delivery of polynucleotides is used for therapy.
  • Encoding polynucleotides can be delivered as mRNA or as DNA constructs using known procedures, e.g., electroporation or cell squeezing, and/or vectors (including viral vectors).
  • mRNA polynucleotides can include known modifications (mmRNA) to avoid activation of the innate immune system. See WO 2014/028429, which is hereby incorporated by reference in its entirety.
  • the polynucleotide is delivered to the body of a subject.
  • the polynucleotides is delivered into a cell in vitro, and the cell is delivered to the body of a subject.
  • the cell can be, for example, a white blood cell (e.g., a T cell or macrophage), an endothelial cell, an epithelial cell, a hepatocyte, or a stem cell.
  • the invention provides a method for producing an extracellular DNASE variant described herein.
  • the method comprises culturing cells expressing a polynucleotide encoding the extracellular DNASE, and recovering the recombinant DNase protein.
  • the cells may be prokaryotic or eukaryotic.
  • the DNase is expressed using a non-mammalian expression system, which is optionally Pichia pastoris or Saccharomyces spp.
  • a mammalian expression system such as CHO cells, is employed.
  • the invention further provides pharmaceutical compositions comprising the extracellular DNASE or variant thereof as described herein, or optionally the polynucleotide or the vector as described, and a pharmaceutically acceptable carrier.
  • a vector generally comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell.
  • Numerous vectors are known in the art including, but not limited to, linear polynucleotides, polynucleotides associated with ionic or amphiphilic compounds, plasmids, and viruses.
  • Exemplary vectors include autonomously replicating plasmids or a virus.
  • the term should also be construed to include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, polylysine compounds, liposomes, and the like.
  • Examples of viral vectors include, but are not limited to, adenoviral vectors, adeno- associated virus vectors, retroviral vectors, and the like.
  • the pharmaceutical composition may be formulated for any administration route, including topical, parenteral, or pulmonary administration.
  • the composition is formulated for intradermal, intramuscular, intraperitoneal, intraarticular, intravenous, subcutaneous, intraarterial, oral, sublingual, pulmonary, or transdermal administration.
  • the composition is formulated for intravenous or subcutaneous administration.
  • the invention provides a method for treating a subject in need of extracellular DNA degradation, extracellular chromatin degradation, extracellular trap (ET) degradation and/or neutrophil extracellular trap (NET) degradation.
  • the method comprises administering a therapeutically effective amount of the extracellular DNASE or variant thereof or composition described herein.
  • Exemplary indications where a subject is in need of extracellular DNA or chromatin degradation are disclosed in PCT/US 18/47084, the disclosure of which is hereby incorporated by reference.
  • the invention provides a method for treating a subject in need thereof, the method comprising administering a therapeutically effective amount of a protein that is represented by any one of the sequences SEQ ID NO:8 to SEQ ID NO:30.
  • the invention likewise provides the use of one or more of the extracellular DNASE proteins for the treatment or prevention of diseases associated with ETs and/or NETs.
  • the present invention provides a method for treating, preventing, or managing diseases or conditions characterized by the presence or accumulation of NETs.
  • diseases or conditions include, but are not limited to, diseases associated with chronic neutrophilia, neutrophil aggregation and leukostasis, thrombosis and vascular occlusion, ischemia-reperfusion injury, surgical and traumatic tissue injury, an acute or chronic inflammatory reaction or disease, an autoimmune disease, cardiovascular disease, metabolic disease, systemic inflammation, inflammatory diseases of the respiratory tract, renal inflammatory diseases, inflammatory diseases related to transplanted tissue (e.g. graft-versus-host disease) and cancer (including leukemia).
  • transplanted tissue e.g. graft-versus-host disease
  • cancer including leukemia
  • the present invention pertains to the treatment of diseases or conditions characterized by deficiency of D1L3, or a deficiency of Dl.
  • the subject has a mutation (e.g., a loss of function mutation) in the Dnasell3 gene or the Dnasel gene.
  • Such subjects can manifest with an autoimmune disease (e.g., systemic lupus erythematosus (SLE) (including lupus nephritis), scleroderma or systemic sclerosis, rheumatoid arthritis, inflammatory bowel disease (including Crohn’s disease and ulcerative colitis), and urticarial vasculitis).
  • SLE systemic lupus erythematosus
  • scleroderma or systemic sclerosis e.g., rheumatoid arthritis
  • inflammatory bowel disease including Crohn’s disease and ulcerative colitis
  • urticarial vasculitis e.g., system
  • the subject has an acquired inhibitor of Dl (e.g., anti -DNasel -antibody and actin) and/or D1L3 (e.g., anti- Dnase 113 -antibody).
  • Dl e.g., anti -DNasel -antibody and actin
  • D1L3 e.g., anti- Dnase 113 -antibody
  • Such subjects can also have an autoimmune or inflammatory disease (e.g., SLE, systemic sclerosis).
  • the subject has or is at risk of NETs occluding ductal systems.
  • the DNASE enzymes disclosed herein can be administered to a subject to treat pancreatitis, cholangitis, conjunctivitis, mastitis, dry eye disease, obstructions of vas deferens, or renal diseases.
  • the subject has or is at risk of NETs accumulating on endothelial surfaces (e.g. surgical adhesions), the skin (e.g. wounds/scarring), or in synovial joints (e.g. gout and arthritis, e.g., rheumatoid arthritis).
  • endothelial surfaces e.g. surgical adhesions
  • the skin e.g. wounds/scarring
  • synovial joints e.g. gout and arthritis, e.g., rheumatoid arthritis.
  • the DNASE enzymes described herein can be administered to a subject to treat a condition characterized by an accumulation of NETs on an endothelial surface such as, but not limited to, a surgical adhesion.
  • ANCA-associated vasculitis asthma, chronic obstructive pulmonary disease, a neutrophilic dermatosis, dermatomyositis, bums, cellulitis, meningitis, encephalitis, otitis media, pharyngitis, tonsillitis, pneumonia, endocarditis, cystitis, pyelonephritis, appendicitis, cholecystitis, pancreatitis, uveitis, keratitis, disseminated intravascular coagulation, acute kidney injury, acute respiratory distress syndrome, shock liver, hepatorenal syndrome, myocardial infarction, stroke, ischemic bowel, limb ischemia, testicular torsion, preeclampsia, eclampsia, and solid organ transplant (e.g., kidney, heart, liver, and
  • DNASE enzymes disclosed herein can be used to prevent a scar or contracture, e.g., by local application to skin, in an individual at risk thereof, e.g., an individual with a surgical incision, laceration, or bum.
  • the subject has a disease that is or has been treated with wild-type Dnases, including Dl and streptodomase.
  • diseases or conditions include thrombosis, stroke, sepsis, lung injury, atherosclerosis, viral infection, sickle cell disease, myocardial infarction, ear infection, wound healing, liver injury, endocarditis, liver infection, pancreatitis, primary graft dysfunction, limb ischemia reperfusion, kidney injury, blood clotting, alum-induced inflammation, hepatorenal injury, pleural exudations, hemothorax, intrabiliary blood clots, post pneumatic anemia, ulcers, otolaryngological conditions, oral infections, minor injuries, sinusitis, post-operative rhinoplasties, infertility, bladder catheter, wound cleaning, skin reaction test, pneumococcal meningitis, gout, leg ulcers, cystic fibrosis, Appelgener’s syndrome, asthma, lobar ate
  • CHO cells Chinese Hamster Ovary (CHO) cells. Indeed, wild-type DNASE1 (Dl; domase alpha) is typically produced in CHO cells. Despite significant advantages in cell line development and large-scale production using CHO cells, there still remains a significant challenge in the production of Dnase enzymes due to a considerable degree of variability and no reliable methods for predicting or modeling cell growth characteristics. Importantly, CHO cells were not able to stably produce hyperactive variants of Dl, which prevented their clinical manufacturing, and prior to the present disclosure, the manufacturing properties of other DNASE1 -protein family members, including DNASE1-LIKE 3 (D1L3), were unknown.
  • D1-LIKE 3 DNASE1-LIKE 3
  • D1L3 Using CHO and microbial expression systems, several challenges were identified in manufacturing of D1L3, including low production yield, proteolytic degradation, protein misfolding, and erroneous or undesired glycosylation. This disclosure provides technical solutions to these and other challenges in manufacturing, which also can improve the therapeutic properties of D1L3.
  • Example 1 Expression and Characterization of D1L3 with Basic Domain Deletion (BDD) in Chinese Hamster Ovarian (CHO) Cells and in Pichia pastoris
  • DNASE1 and DNASE1L3 preferentially cleave protein-free DNA and DNA- histone-complexes (i.e. chromatin), respectively.
  • BD basic domain
  • a protein engineering technology termed Building Block Protein Engineering is described in PCT/US 18/47084 and US 62/800,790, the disclosures of which are hereby incorporated by reference in their entireties. This approach can be applied to members of the DNASE1 and DNASE2 -protein family.
  • the method is based on the following steps: providing a protein-protein alignment of donor and recipient Dnase enzymes; identifying variable amino acid sequences for transfer, the variable amino acids being flanked by one or more conserved amino acids in the donor and recipient Dnase enzymes; substituting the variable amino acids of the recipient Dnase with the variable amino acids of the donor Dnase to create a chimeric Dnase; and recombinantly producing the chimeric Dnase.
  • wild-type D1L3 was substituted with building block substitutions from Dl, as disclosed in PCT/US2018/047084.
  • the building block substitutions to D1L3 are selected from human Dl and result in variants of human D1L3, which feature the following mutations: M2l_R22delinsLK, C24_S25delinsAA, V28_S30delinsIQT, S34T, Q36_V44delinsMSNATLVSY, K47_K50delinsQILS, C52Y, I55 M58delinsIALV QE, I60_K6ldelinsVR, N64_I70delinsHLTAVGK,
  • Tl56_Tl57delins A A, El59_Sl6ldelinsGDA, K163A, E167A, Vl69_El70delinsYD, T173L, Kl 76_Rl 78delinsQEK, Kl80_Al8ldelinsGL, Nl83_Fl86delinsDVML, P 198 A201 delinsRP S Q, K203_N204delinsSS, R208W, D210S, R212T, V214Q, G218P, Q220_E221 delins S A, V225_S228delinsATP, N230H, L238_R239delinsVA, Q241 _S246delinsMLLRGA, K250D, N252_V254delinsALP, D256N, K259A, K262G, T264_E267delinsSDQL, L269_V27ldelinsQAI, F275Y
  • DlL3variants were screened for loss or gain of chromatin-degrading activity.
  • D1L3 variants were transiently expressed in CHO cells using an in vitro expression vector. Culture supernatants were collected and tested for chromatin degrading activity using purified nuclei as a source of chromatin.
  • the building block substitutions #17 and #63 from Dl significantly improved the degradation of high-molecular weight (HMW) chromatin to small fragments, when compared to wild-type D1L3.
  • Building block substitution #7 causes a missense mutation Q101R, which replaces glutamine at position 101 with arginine (SEQ ID NO: 8).
  • FIG. 5 shows a Western Blot of human D1L3 expressed and secreted by CHO cells in a bioreactor under cGMP-compatible conditions. Samples were collected at different time points (tl - t3). Only minor levels of D1L3 and D1L3 fragments were detected. The data suggest that low production yield of D1L3 is a challenge in manufacturing of D1L3.
  • poly anions can comprise one or more of heparin, dextran sulfate, ferric citrate, and ethylenediaminetetraacetic acid, and represent the biologically active ingredient in“anti-cell clumping reagents”.
  • dextran sulfate to the CHO culture medium and observed a strong increase in D1L3 as well as D1L3 fragments (FIG. 5). The data illustrate that poly anions increased production yield of D1L3, but did not prevent proteolytic degradation.
  • FIG. 6A shows that polyanions, such as dextran sulfate (DS), form a complex with D1L3.
  • the DlL3-DS-complex prevents the interaction and scavenging of D1L3 by negatively charged surfaces during the production process.
  • negatively charged surfaces include, but are not limited to, the cell surface of production cells (e.g. CHO cells, Pichia pastoris, Saccharomyces spp.), DNA exposed by dying cells, and bioreactor surfaces.
  • FIG. 6B and FIG. 6C show the two-step purification process of D1L3 from DS-DlL3-complexes. As shown in FIG. 6, the first step aims to dissociate the DS-D1L3 complex.
  • the dissociation can be achieved by incubating the DS-D1L3 complex with strong anion exchange surfaces, which bind DS and thus liberate D1L3.
  • the purification process can include the passage of culture medium containing the DS-D1L3 through a chromatography column that is filled with a strong anion exchange resin followed by the collection of the flow through, which contains the DS-free D1L3.
  • the second step of the purification process is shown in FIG. 6C and includes the affinity purification of D1L3 from the DS-free flow through via the application of a strong cation exchange resin.
  • the production yield of D1L3 can be substantially increased through the addition of poly anions, such as dextran sulfate.
  • Wild-type D1L3 contains 50 arginine and lysine residues, which makes the enzyme particularly susceptible to proteases like trypsin, thrombin, and plasmin.
  • trypsin and plasmin cleavage sites were identified in D1L3. The sites can be mutated to generated protease-resistance variants of D1L3.
  • D1L3 was digested with trypsin.
  • D1L3 fragments were isolated, and the amino acid sequence of the fragments determined using combinations of liquid chromatography (LC) and mass spectrometry (MS). It was identified that trypsin cleaved D1L3 at the following arginine and lysine residues: R22, R29, R51, R66, R80, R81, R95, K99, R115, K147, K163, K180, R208, R212, R235, R239, K250, and K262.
  • arginine and lysine residues can be substituted with small amino acids such as alanine, valine, and serine or with amino acids that have similar properties according to the Grantham’s distance score (e.g. histidine, glutamine, and glutamate; FIG. 7).
  • Dl which is protease resistant, features arginine and lysine residues corresponding to R51, R95, K99, and R235, suggesting that these residues are not primarily responsible for proteolytic degradation of D1L3.
  • R22 (Mutation: M2l_R22delinsLK), R29 (V28_S30delinsIQT), R66 (N64_I70delinsHLTAVGK), R80 (R77_I83delinsQDAPD), R81 (R77_I83delinsQDAPD), R115 (Vl l3_Rl l5delinsAVD), K163 (K163A), K180 (Kl80_Al8ldelinsGL), R208 (R208W) MR212 (R212T), R239 (L238_R239delinsVA), K250 (K250D), and K262 (K262G).
  • Plasmin is a plasma protease that is generated by activation of its zymogen plasminogen. Plasminogen activator inhibitor 1 (PAI-l) inhibits the activation of plasmin. Interestingly, PAI-l increases the enzymatic activity of D1L3 in serum, suggesting that plasmin may proteolytically inactivate D1L3. However, the plasmin cleavage sites in D1L3 have not been identified.
  • D1L3 contains a total of four putative plasmin- cleavage sites (FIG. 8): (Site 1) K180/A181 (K160/A161 without signal peptide), (Site 2) K200/A201 (K180/A181 without signal peptide), (Site 3) K259/A260 (K239/A240 without signal peptide), and (Site 4) R285/A286 (R270/A250 without signal peptide).
  • D1L3 was digested with purified plasmin.
  • D1L3 fragments were isolated, and the amino acid sequence of the fragments determined using combinations of LC and MS.
  • plasmin cleaved D1L3 at the following arginine and lysine residues: R22, R29, K45, K47, K74, R81, R92, K107, K176, R212, R226, R227, K250, K259, and K262.
  • arginine and lysine residues can be substituted with small amino acids such as alanine, valine, and serine or with amino acids that have similar properties according to the Grantham’s distance score (e.g.
  • Dl which is protease resistant, features a lysine residue corresponding to K45, suggesting that this residue is not primarily responsible for proteolytic degradation of D1L3 by plasmin.
  • Building Block Protein Engineering was applied to transfer the following Building Blocks from Dl to replace Building Blocks of D1L3 that contain the trypsin cleavage sites in silico (FIG.
  • R22 (Mutation: M2l_R22delinsLK), R29 (V28_S30delinsIQT), K47 (K47_K50delinsQILS), K74 (M72_K74delinsLDN), R81 (R77_I83delinsQDAPD), R92 (S9l_R92delinsEP), K107 (Kl 07_L 11 OdelinsRPDQ), K176 (Kl76_Rl78delinsQEK), R212 (R212T), K226 (V225_S228delinsATP), K227 (V225_S228delinsATP), K250 (K250D), K259 (K259A), and K262 (K262G).
  • PACE paired basic amino acid cleaving enzyme
  • DNASE 1L3 and DNASE1L3 variants enable their expression in CHO md Pichia pastoris with reduced fragmentation.
  • Analysis of DNASE1L3 fragments identified feature paired basic amino acid at positions: K50/R51, R80/R81, K114/R115, K199/K200, K226/K227, K291/K292, R297/K298/K299, and K303/R304 in SEQ ID NO: 2.
  • DNASE1L3 from other species feature amino acid substitutions at these cleavage sites, including R114T (Mouse), R114A (Rat), Rl 14D (Guinea pig), Rl 14Q (Cow), K227S (Dog), and K227E (Elephant). These amino acid substitutions can be applied to human DNASE1L3 to render the enzyme resistant to proteolytic degradation, including during expression in CHO cells and Pichia pastoris.
  • Kexin preferably cleaves after KR and RR residues.
  • the application of reducing conditions to proteins of bioreactor material dissolved D1L3 aggregates.
  • the data illustrate that D1L3 aggregate formation is caused by intra- and/or inter-molecular cross-linking via disulfide bridges during protein expression.
  • the gel was run under non-reducing conditions and shows the accumulation of high-molecular weight aggregates of D1L3 over time.
  • the gel was run under reducing conditions and no aggregates were detected.
  • the data illustrate that erroneous intra- and inter-molecular disulfide bonds cause misfolding of human D1L3 under manufacturing conditions.
  • FIG. 13 shows an amino acid sequence alignment of human Dl (SEQ ID NO: 1) and human D1L3 (SEQ ID NO: 4).
  • the signal peptide, conserved amino acids, variable amino acids, non-conserved cysteine residues, and conserved cysteine residues are highlighted. Mutations in non-conserved cysteine residues will reduce the possibilities of intra- and inter-molecular disulfide bonds during protein expression.
  • Analysis of the amino acid sequence of D1L3 (SEQ ID NO: 4) showed the presence of five cysteine (C) residues: C24, C52, C68, Cl 94, and C231 (FIG. 14).
  • cysteine residues Cl 94 and C231 are conserved among all members of the DNASE 1 -protein family and form disulfide bonds that are required for enzymatic activity of DNASE1.
  • the function of cysteine residues in D1L3 were not known prior to the present disclosure. Accordingly, as disclosed herein, mutation of these cysteine residues reduces the cross-linking via disulfide bridges and thus increases the yield of protein production.
  • Cysteine residues can be substituted with other small amino acids, namely alanine (A), serine (S), and glycine (G), among others. Such substitutions cause the following amino acid mutations C24A/S/G, C52A/S/G, C68A/S/G, C194A/S/G, and C231A/S/G.
  • Building Blocks that comprise the conserved cysteine residues can be replaced by Building Blocks from a donor DNase of the DNASE1 -protein family (e.g. Dl and D1L3).
  • cysteine C68 either by conventional amino acid substitution [C68A, (SEQ ID NO: 13)] or by BB mutation (N64_I70delinsHLTAVGK), resulted in a D1L3 variant with chromatin degrading activity (FIG. 15). Amino acid sequence alignment showed that cysteine C68 is not conserved among other DNASE1 -protein family members, supporting the notion that C68 is not required for enzymatic activity.
  • cysteine C68 and Cl 94 can be mutated to reduce the risk of erroneous disulfide bonds during D1L3 production.
  • a similar approach can be applied to mutate the non-conserved cysteine residues in the other members of the DNasel protein family: Dl, DNasel-like 1 (D1L1) and DNasel-like 2 (D1L2).
  • Dl has two non-conserved cysteine: C123 and C126.
  • D1L1 shows two non-conserved cysteine residues (C22, C50) that correspond to C24 and C52 in D1L2 has only one non-conserved cysteine residues: C43. Mutation of non-conserved cysteine residues of members of the DNASE1 protein family will reduce cross-linking via erroneous disulfide bridges during protein expression and thus allow for manufacturing of Dl, D1L1, D1L2, and D1L3 for therapeutic applications.
  • D1L3 the N-terminus of D1L3 was led by the alpha-mating factor (aMF) pre-pro secretion leader from Saccharomyces cerevisiae (SEQ ID NO: 46), a common tool for heterologous protein expression in Pichia pastoris.
  • aMF alpha-mating factor
  • SEQ ID NO: 46 Saccharomyces cerevisiae
  • the combination of aMF with D1L3 caused the unexpected non processing of aMF due to glycosylation (FIG. 16B).
  • the glycosylation of the D1L3 protein prevents the use of P. pastoris for clinical manufacturing of D1L3.
  • D1L3 was properly processed, when N-terminus was led by native secretory signal peptide of D1L3 [FIG. 16B, (SEQ ID NO: 48)].
  • aMF increased D1L3 expression 3-5-fold, when compared to the native signal peptide of D1L3.
  • HSA human serum albumin
  • FIG. 17A Some variants contained linker peptide [e.g. (GSSSS)3] between HSA and D1L3.
  • FIG. 17B and FIG. 17C expression of the fusion protein in P.
  • pastoris generated a non- glycosylated and enzymatically active D1L3. Furthermore, the expression levels were 5- 10-fold increased, when compared to native secretory signal peptide-driven expression of D1L3. Collectively, the data illustrate that fusion of D1L3 to albumin enables manufacturing in Pichia pastoris.
  • Example 7 Design of Cleavable Linker Sequences
  • D1L3 variants with C-terminal amino acid deletions which retain their enzymatic activity to degrade chromatin and/or NETs, as exemplified by SEQ ID NO: 9 to SEQ ID NO: 12, can be used for D1L3 therapy.
  • the site-specific alkylation of an unpaired cysteine thiol is commonly used to generate half-life extended biologies for therapeutic applications.
  • the non-essential cysteines C68 and C194 of D1L3 can be used for site specific PEGylation (PEG, polyethylene glycol).
  • D1L3 variants that are resistant to inactivation by plasmin due to mutations such as Kl 80_Al 81 delinsGL, Pl98_A20ldelinsRPSQ, K259A, and R285A, are expected to have an improved half-life and thus efficacy in therapeutic applications.
  • NETs have the capacity to activate blood clotting factors, in particular the clotting factor XII (FXII).
  • FXIIa clotting factor XI
  • PK prekallikrein
  • FXI the cleavage site is between arginine 387 and isoleucine 388.
  • PK the cleavage site is between arginine 390 and isoleucine 391.
  • FXI and PK are homologous proteins. As disclosed herein, we designed several linker peptides that contain all or parts of the FXI sequence position 380 to position 403 (SEQ ID NO: 42, SEQ ID NO: 43) or of the PK sequence position 383 to position 406 (SEQ ID NO: 44).
  • the FXIIa-cleavable linker can be used for manufacturing half-life extended version of other biologies (FIG. 24), including, but not limited to, variants of other extracellular DNASE, human coagulation factors (e.g. Factor VII, Factor VIII, and Factor IX), and complement factors (e.g. Factor H).
  • human coagulation factors e.g. Factor VII, Factor VIII, and Factor IX
  • complement factors e.g. Factor H.
  • DNASE1 (NP_0052l2.2): Signal Peptide. Mature Protein:
  • DNASE1-LIKE 1 (NP_00672l.l): Signal Peptide: Mature Protein:
  • DNASE1-LIKE 2 (NP_00l365.l): Signal Peptide. Mature Protein:
  • DNASE1-LIKE 3 Isoform 2 (NP_00l243489. l): Signal Peptide: Mature Protein:
  • DNASE2A (000115): Signal Peptide: Mature Protein:
  • DNASE2B (Q8WZ79): Signal Peptide: Mature Protein:
  • DNASE1-LIKE 3 Q101R (Signal Peptide; Mature Protein)
  • DNASE1L3, Q282_S305delinksK (Signal Peptide; Mature Protein):
  • DNASE1L3, S305delinsK (Signal Peptide: Mature Protein):
  • DNASE1L3, K292_S305del (Signal Peptide; Mature Protein):
  • DNASE1L3, S293_S305del (Signal Peptide: Mature Protein):
  • DNASE1L3, C68A (Signal Peptide: Mature Protein):
  • DNASE1L3, F275Y/F279_K280delinsVM/Q282_S305delinsK (Signal Peptide: Mature Protein): MSRELAPLLLLLLSIHSALAMRICS FNVRSFGESKQEDKNAMDVIVKVIKRCDIILVM
  • DNASE1L3, S283_S305del (Signal Peptide: Mature Protein):
  • DNASE1L3, R285_S305del (Signal Peptide: Mature Protein):
  • DNASE1L3 Variant - Albumin - Fusion Protein. (Albumin. DNASE1L3 Variant):
  • DNASE1L3 Variant - Albumin - Fusion Protein (Albumin. DNASE1L3 Variant): MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRN SRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFV VWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGC SYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSWPKSN SVFDFQKAYKLTEEEALDVSDHYPVEVMLKGGGGSGGGGSGGGGSDAHKSEVAHRFKD
  • Albumin - DNASE1L3 - Fusion Protein (Albumin. DNASE1L3): DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADES AENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLV RPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADK AACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVS KLVTDLTKVHTECCHGDI!ECADDRADLAKYICENQDS ISSKLKECCEKPLLEKSHCI AEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSWLLLR LAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQ

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biophysics (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Immunology (AREA)
  • Dermatology (AREA)
  • Nutrition Science (AREA)
  • Toxicology (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Enzymes And Modification Thereof (AREA)
PCT/US2019/055178 2018-10-08 2019-10-08 Engineering of dnase enzymes for manufacturing and therapy Ceased WO2020076817A1 (en)

Priority Applications (21)

Application Number Priority Date Filing Date Title
IL282058A IL282058B1 (en) 2018-10-08 2019-10-08 Engineering deoxyribonuclease enzymes for manufacturing and medicine
MX2021004022A MX2021004022A (es) 2018-10-08 2019-10-08 Modificacion genetica de enzimas dnasas para elaboracion y terapia.
JP2021518905A JP2022504400A (ja) 2018-10-08 2019-10-08 製造及び治療のためのdnase酵素の操作
SG11202103426XA SG11202103426XA (en) 2018-10-08 2019-10-08 Engineering of dnase enzymes for manufacturing and therapy
KR1020217013090A KR20210072790A (ko) 2018-10-08 2019-10-08 제조 및 치료를 위한 dnase 효소의 엔지니어링
EA202190940A EA202190940A1 (ru) 2019-05-13 2019-10-08 РАЗРАБОТКА ДНКаз ДЛЯ ПРОИЗВОДСТВА И ТЕРАПИИ
BR112021006737-0A BR112021006737A2 (pt) 2018-10-08 2019-10-08 engenharia de enzimas dnase para fabricação e terapia
CA3115766A CA3115766A1 (en) 2018-10-08 2019-10-08 Engineering of dnase enzymes for manufacturing and therapy
IL325846A IL325846A (en) 2018-10-08 2019-10-08 Engineering deoxyribonuclease enzymes for manufacturing and medicine
CN201980073970.5A CN112996911A (zh) 2018-10-08 2019-10-08 用于制造和疗法的脱氧核糖核酸酶的工程改造
AU2019358915A AU2019358915B2 (en) 2018-10-08 2019-10-08 Engineering of DNASE enzymes for manufacturing and therapy
EP19870853.9A EP3864147A4 (en) 2018-10-08 2019-10-08 MANIPULATION OF DNASE ENZYMES FOR MANUFACTURE AND THERAPY
US16/697,502 US10988746B2 (en) 2018-10-08 2019-11-27 Manufacturing and engineering of DNASE enzymes for therapy
US16/915,547 US11058724B2 (en) 2018-10-08 2020-06-29 Methods of using DNASE1-like 3 in therapy
US17/210,129 US11840712B2 (en) 2018-10-08 2021-03-23 Engineering of DNASE enzymes for manufacturing and therapy
US17/344,442 US20210299178A1 (en) 2018-10-08 2021-06-10 Methods of using dnase1-like 3 in therapy
US17/668,674 US11578314B2 (en) 2018-10-08 2022-02-10 Engineering of DNASE enzymes for manufacturing and therapy
US18/497,106 US12565642B2 (en) 2018-10-08 2023-10-30 Engineered DNASE enzymes for thrombosis therapy
US18/658,758 US20240374643A1 (en) 2018-10-08 2024-05-08 Dnase1-like 3 and its use in therapy
JP2024133817A JP7818850B2 (ja) 2018-10-08 2024-08-09 製造及び治療のためのdnase酵素の操作
AU2025283522A AU2025283522B2 (en) 2018-10-08 2025-12-17 Engineering of DNASE enzymes for manufacturing and therapy

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US201862742682P 2018-10-08 2018-10-08
US62/742,682 2018-10-08
US201862775563P 2018-12-05 2018-12-05
US62/775,563 2018-12-05
US201862779104P 2018-12-13 2018-12-13
US62/779,104 2018-12-13
US201962808601P 2019-02-21 2019-02-21
US62/808,601 2019-02-21
US201962846904P 2019-05-13 2019-05-13
US62/846,904 2019-05-13

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/697,502 Continuation US10988746B2 (en) 2018-10-08 2019-11-27 Manufacturing and engineering of DNASE enzymes for therapy

Publications (1)

Publication Number Publication Date
WO2020076817A1 true WO2020076817A1 (en) 2020-04-16

Family

ID=70164727

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/055178 Ceased WO2020076817A1 (en) 2018-10-08 2019-10-08 Engineering of dnase enzymes for manufacturing and therapy

Country Status (12)

Country Link
US (2) US11578314B2 (cg-RX-API-DMAC7.html)
EP (1) EP3864147A4 (cg-RX-API-DMAC7.html)
JP (2) JP2022504400A (cg-RX-API-DMAC7.html)
KR (1) KR20210072790A (cg-RX-API-DMAC7.html)
CN (1) CN112996911A (cg-RX-API-DMAC7.html)
AU (2) AU2019358915B2 (cg-RX-API-DMAC7.html)
BR (1) BR112021006737A2 (cg-RX-API-DMAC7.html)
CA (1) CA3115766A1 (cg-RX-API-DMAC7.html)
IL (2) IL325846A (cg-RX-API-DMAC7.html)
MX (1) MX2021004022A (cg-RX-API-DMAC7.html)
SG (1) SG11202103426XA (cg-RX-API-DMAC7.html)
WO (1) WO2020076817A1 (cg-RX-API-DMAC7.html)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021252470A3 (en) * 2020-06-08 2022-01-20 Yale University Compositions and methods for treating and/or preventing coagulopathy and/or sepsis in patients suffering from bacterial and/or viral infections
WO2022178110A3 (en) * 2021-02-17 2022-10-27 Neutrolis, Inc. Dnase 1-like 2 engineered for manufacturing and use in therapy
WO2022246139A1 (en) * 2021-05-21 2022-11-24 Genkin Dmitry Dmitrievich Immunomodulation of tumor microenvironment
US11905522B2 (en) 2018-01-16 2024-02-20 Cls Therapeutics Limited Treatment of diseases by liver expression of an enzyme which has a deoxyribonuclease (DNase) activity
EP4448743A4 (en) * 2021-12-15 2026-01-14 Univ Texas Tech System IMPROVEMENT IN THE SERUM HALF-LIFE OF DNASE1L3

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025076525A1 (en) * 2023-10-06 2025-04-10 Neutrolis, Inc. Biomarker and precision therapy for inflammatory disease
WO2026037276A1 (zh) * 2024-08-12 2026-02-19 上海交通大学医学院 一种减少线粒体dna泄露的方法
CN120424194A (zh) * 2025-04-30 2025-08-05 苏州泓迅生物科技股份有限公司 一种重组人源纤连蛋白的制备方法及其应用

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6656685B2 (en) * 2001-01-29 2003-12-02 Ventana Medical Systems, Inc. Hybridization buffers using low molecular weight dextran sulfate and methods for their use
US20040138156A1 (en) * 2002-02-26 2004-07-15 Schneider Michael C Therapeutic regulation of deoxyribonuclease-1-like-3 activity
WO2011053982A2 (en) * 2009-11-02 2011-05-05 University Of Washington Therapeutic nuclease compositions and methods
WO2011124718A1 (en) 2010-04-09 2011-10-13 Novozymes A/S Albumin derivatives and variants
WO2014028429A2 (en) 2012-08-14 2014-02-20 Moderna Therapeutics, Inc. Enzymes and polymerases for the synthesis of rna
WO2015066550A1 (en) 2013-10-31 2015-05-07 Resolve Therapeutics, Llc Therapeutic nuclease-albumin fusions and methods
US9221896B2 (en) 2001-12-21 2015-12-29 Human Genome Sciences, Inc. Albumin fusion proteins
US9458218B2 (en) 2005-12-20 2016-10-04 Duke University Therapeutic agents comprising fusions of insulin and elastic peptides
WO2018134419A1 (en) * 2017-01-20 2018-07-26 Universitätsklinikum Hamburg-Eppendorf Animal model for drug development

Family Cites Families (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6270989B1 (en) 1991-11-05 2001-08-07 Transkaryotic Therapies, Inc. Protein production and delivery
US6482626B2 (en) 1996-02-05 2002-11-19 Genentech, Inc. Human DNase
EP1440981A3 (en) * 2003-01-21 2005-11-23 Research Association for Biotechnology Full-length human cdna
US8431123B2 (en) 2003-07-14 2013-04-30 Cls Therapeutics Limited Method for treating systemic bacterial, fungal and protozoan infection
US9248166B2 (en) 2003-07-14 2016-02-02 Cls Therapeutics Limited Method for treating oncological diseases
WO2006130034A1 (fr) 2005-04-25 2006-12-07 Dmitry Dmitrievich Genkin Procede pour prolonger la duree de vie d'animaux ou de l'humain
US8388951B2 (en) 2003-07-14 2013-03-05 Cls Therapeutics Limited Method for treating systemic DNA mutation disease
RU2269356C2 (ru) 2003-07-14 2006-02-10 Дмитрий Дмитриевич Генкин Способ лечения онкологических заболеваний
EP2416156B1 (en) 2006-10-18 2015-12-30 Periness Ltd. Method for determining a male fertility status
US20090305345A1 (en) 2006-10-23 2009-12-10 Medical Research Council Polymerase
AU2008279550B2 (en) 2007-06-21 2012-08-09 Angelica Therapeutics, Inc. Modified toxins
EP2561367A1 (en) 2010-04-22 2013-02-27 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Means and methods for identifying an increased risk of systemic lupus erythematosus (sle) patients for developing renal manifestations
CN107188970A (zh) 2010-06-04 2017-09-22 株式会社蒂奥姆生物 具有因子vii活性的融合蛋白质
WO2012106264A2 (en) 2011-01-31 2012-08-09 The Trustees Of Columbia University In The City Of New York Treatment and prevention of bacterial vaginosis and gardnerella vaginalis infections
AU2012222833B2 (en) * 2011-03-03 2017-03-16 Zymeworks Inc. Multivalent heteromultimer scaffold design and constructs
ES2666303T3 (es) * 2011-04-29 2018-05-03 University Of Washington Composiciones terapéuticas de nucleasa y métodos
WO2012166611A2 (en) 2011-05-27 2012-12-06 Immune Disease Institute, Inc. Methods for treating and preventing neutrophil-derived net toxicity and thrombosis
ES2666856T3 (es) * 2011-11-04 2018-05-08 Novartis Ag Proteína 6 relacionada con lipoproteínas de baja densidad (LRP6) - constructos extensores de la vida media
US9867871B2 (en) 2011-12-12 2018-01-16 The Board Of Trustees Of The University Of Illinois Composition and method for treating nucleic acid-related eye disease
GB201208879D0 (en) 2012-05-21 2012-07-04 London School Hygiene & Tropical Medicine Therapeutic for treating Clostridium difficile infection
CA2935748A1 (en) 2014-02-25 2015-09-03 Immunomedics, Inc. Humanized rfb4 anti-cd22 antibody
US10617743B2 (en) 2014-06-19 2020-04-14 Cls Therapeutics Limited Method to improve safety and efficacy of anti-cancer therapy
CN107249621A (zh) 2014-09-08 2017-10-13 哥谭生物制药股份有限公司 用于治疗肺结节病的粘液溶解剂
EP3265814B1 (en) 2015-03-01 2020-11-18 Immunarray Ltd. Diagnosis of systemic lupus erythematosus using protein, peptide and oligonucleotide antigens
EP3273238A1 (en) 2016-07-22 2018-01-24 Universitätsklinikum Hamburg-Eppendorf Immunodiagnostic detection of anti-neutrophil antibodies
CA3036926C (en) 2016-09-30 2022-05-31 Poseida Therapeutics, Inc. Modified stem cell memory t cells, methods of making and methods of using same
EP3351263A1 (en) 2017-01-20 2018-07-25 Universitätsklinikum Hamburg-Eppendorf Pharmaceutical preparation for treating or preventing tissue adhesion
DK3668972T3 (da) * 2017-08-18 2025-01-13 Neutrolis Inc Konstruerede dnase-enzymer og anvendelse i terapi
US10988746B2 (en) * 2018-10-08 2021-04-27 Neutrolis, Inc. Manufacturing and engineering of DNASE enzymes for therapy
WO2020163264A1 (en) * 2019-02-04 2020-08-13 Neutrolis, Inc. Engineered human extracellular dnase enzymes for drug candidate selection
EA202190940A1 (ru) * 2019-05-13 2021-10-15 Ньютролис Инк. РАЗРАБОТКА ДНКаз ДЛЯ ПРОИЗВОДСТВА И ТЕРАПИИ
EP4294824A4 (en) * 2021-02-17 2025-01-01 Neutrolis Inc. DNASE 1-LIKE 2 MANIPULATED FOR PRODUCTION AND USE IN THERAPY

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6656685B2 (en) * 2001-01-29 2003-12-02 Ventana Medical Systems, Inc. Hybridization buffers using low molecular weight dextran sulfate and methods for their use
US9221896B2 (en) 2001-12-21 2015-12-29 Human Genome Sciences, Inc. Albumin fusion proteins
US20040138156A1 (en) * 2002-02-26 2004-07-15 Schneider Michael C Therapeutic regulation of deoxyribonuclease-1-like-3 activity
US9458218B2 (en) 2005-12-20 2016-10-04 Duke University Therapeutic agents comprising fusions of insulin and elastic peptides
WO2011053982A2 (en) * 2009-11-02 2011-05-05 University Of Washington Therapeutic nuclease compositions and methods
WO2011124718A1 (en) 2010-04-09 2011-10-13 Novozymes A/S Albumin derivatives and variants
WO2014028429A2 (en) 2012-08-14 2014-02-20 Moderna Therapeutics, Inc. Enzymes and polymerases for the synthesis of rna
WO2015066550A1 (en) 2013-10-31 2015-05-07 Resolve Therapeutics, Llc Therapeutic nuclease-albumin fusions and methods
WO2018134419A1 (en) * 2017-01-20 2018-07-26 Universitätsklinikum Hamburg-Eppendorf Animal model for drug development

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
JIMENEZ-ALCAZAR, M ET AL.: "Host DNases Prevent Vascular Occlusion by Neutrophil Extracellular Traps", SCIENCE, vol. 358, 1 December 2017 (2017-12-01), pages 1202 - 1206, XP055703919, Retrieved from the Internet <URL:http://science.sciencemag.org> *
KEYEL, DEVELOPMENTAL BIOLOGY, 2017
SISIRAK ET AL., CELL, 2016

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11905522B2 (en) 2018-01-16 2024-02-20 Cls Therapeutics Limited Treatment of diseases by liver expression of an enzyme which has a deoxyribonuclease (DNase) activity
WO2021252470A3 (en) * 2020-06-08 2022-01-20 Yale University Compositions and methods for treating and/or preventing coagulopathy and/or sepsis in patients suffering from bacterial and/or viral infections
WO2022178110A3 (en) * 2021-02-17 2022-10-27 Neutrolis, Inc. Dnase 1-like 2 engineered for manufacturing and use in therapy
EP4294824A4 (en) * 2021-02-17 2025-01-01 Neutrolis Inc. DNASE 1-LIKE 2 MANIPULATED FOR PRODUCTION AND USE IN THERAPY
WO2022246139A1 (en) * 2021-05-21 2022-11-24 Genkin Dmitry Dmitrievich Immunomodulation of tumor microenvironment
EP4448743A4 (en) * 2021-12-15 2026-01-14 Univ Texas Tech System IMPROVEMENT IN THE SERUM HALF-LIFE OF DNASE1L3

Also Published As

Publication number Publication date
SG11202103426XA (en) 2021-05-28
US11578314B2 (en) 2023-02-14
EP3864147A4 (en) 2022-07-06
US12565642B2 (en) 2026-03-03
US20240191218A1 (en) 2024-06-13
IL325846A (en) 2026-03-01
IL282058B1 (en) 2026-02-01
EP3864147A1 (en) 2021-08-18
AU2019358915B2 (en) 2025-09-18
CA3115766A1 (en) 2020-04-16
JP7818850B2 (ja) 2026-02-24
MX2021004022A (es) 2021-09-10
AU2025283522A1 (en) 2026-01-15
US20220162575A1 (en) 2022-05-26
JP2024160327A (ja) 2024-11-13
AU2025283522B2 (en) 2026-03-19
AU2019358915A1 (en) 2021-05-20
JP2022504400A (ja) 2022-01-13
IL282058A (en) 2021-05-31
BR112021006737A2 (pt) 2021-07-13
CN112996911A (zh) 2021-06-18
KR20210072790A (ko) 2021-06-17

Similar Documents

Publication Publication Date Title
US12565642B2 (en) Engineered DNASE enzymes for thrombosis therapy
US11840712B2 (en) Engineering of DNASE enzymes for manufacturing and therapy
US6468731B1 (en) Enzyme-mediated modification of fibrin for tissue engineering: incorporation of proteins
US20240374643A1 (en) Dnase1-like 3 and its use in therapy
CZ305602B6 (cs) Polypeptidická proteáza štěpící von Willebrandův faktor (vWF), nukleová kyselina kódující tento polypeptid a použití tohoto polypeptidu
JPS63503275A (ja) ファクター8:cの製造方法
JP2738428B2 (ja) トロンビンによるプロテインcの活性化を促進する作用を有するペプチド
NZ237244A (en) Cloning and production of human von willebrand factor analogues and compositions thereof
US20240401015A1 (en) Dnase enzymes engineered for improved stability
JPH04505554A (ja) 可溶性トロンボモジュリン類似体
US20250129347A1 (en) Engineered human extracellular dnase enzymes
KR20250109224A (ko) 개선된 발현 및 치료법에 사용을 위해 조작된 DNase 1 유사 3
EA046216B1 (ru) РАЗРАБОТКА ДНКаз ДЛЯ ПРОИЗВОДСТВА И ТЕРАПИИ
EA052450B1 (ru) РАЗРАБОТКА ДНКаз ДЛЯ ПРОИЗВОДСТВА И ТЕРАПИИ
CA2247998C (en) Fragments of cr1 and their use
CA2042399A1 (en) Isolated physiologically active human thrombomodulin polypeptide
AU645077C (en) Cloning and production of human von willebrand factor GPIb binding domain polypeptides and methods of using same
JPH02268689A (ja) プロテアーゼ発現ベクターおよびそれを用いたプロテアーゼの生産方法
JPWO1997042319A1 (ja) 新規Fas抗原誘導体

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19870853

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2021518905

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3115766

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021006737

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20217013090

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019870853

Country of ref document: EP

Effective date: 20210510

ENP Entry into the national phase

Ref document number: 2019358915

Country of ref document: AU

Date of ref document: 20191008

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112021006737

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210408

WWD Wipo information: divisional of initial pct application

Ref document number: 325846

Country of ref document: IL

WWP Wipo information: published in national office

Ref document number: 325846

Country of ref document: IL