WO2020060156A1 - 세포 외막에 노출되는 라이실-tRNA 합성효소 N-말단 영역에 특이적으로 결합하는 항체 - Google Patents

세포 외막에 노출되는 라이실-tRNA 합성효소 N-말단 영역에 특이적으로 결합하는 항체 Download PDF

Info

Publication number
WO2020060156A1
WO2020060156A1 PCT/KR2019/011998 KR2019011998W WO2020060156A1 WO 2020060156 A1 WO2020060156 A1 WO 2020060156A1 KR 2019011998 W KR2019011998 W KR 2019011998W WO 2020060156 A1 WO2020060156 A1 WO 2020060156A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
acid sequence
antibody
sequence represented
Prior art date
Application number
PCT/KR2019/011998
Other languages
English (en)
French (fr)
Inventor
김성훈
권남훈
Original Assignee
재단법인 의약바이오컨버젼스연구단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 재단법인 의약바이오컨버젼스연구단 filed Critical 재단법인 의약바이오컨버젼스연구단
Priority to BR112021004982-7A priority Critical patent/BR112021004982A2/pt
Priority to AU2019341266A priority patent/AU2019341266B2/en
Priority to JP2021514393A priority patent/JP7453694B2/ja
Priority to CA3117001A priority patent/CA3117001C/en
Priority to US17/276,570 priority patent/US20220049016A1/en
Priority to EP19863201.0A priority patent/EP3882272A4/en
Priority to CN201980075543.0A priority patent/CN113195543A/zh
Publication of WO2020060156A1 publication Critical patent/WO2020060156A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407—Specifically defined cancers
    • G01N33/57415—Specifically defined cancers of breast
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407—Specifically defined cancers
    • G01N33/57423—Specifically defined cancers of lung
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
    • G01N33/57492—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites involving compounds localized on the membrane of tumor or cancer cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71—Decreased effector function due to an Fc-modification
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77—Internalization into the cell
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90—Enzymes; Proenzymes
    • G01N2333/9015—Ligases (6)
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00—Detection or diagnosis of diseases
    • G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Definitions

  • the present invention relates to an antibody that specifically binds to the lysyl-tRNA synthetase N-terminal region exposed to the outer cell membrane, and more specifically, the outer cell membrane having a specific CDR (complementarity determining region) sequence described herein.
  • Lysyl-tRNA synthetase KRS, Lysyl-tRNA synthetase
  • KRS Lysyl-tRNA synthetase
  • lysyl-tRNA synthetase which is generally present in the cytosol, is translocated to the plasma membrane (cell membrane), and 67LR (67-kDa laminin) is present in the plasma membrane. It has been demonstrated that it interacts with the receptor to promote the migration of tumor (or cancer) cells and affects metastasis (Dae Gyu Kim et al., Chemical inhibition of prometastatic lysyl-tRNA synthetase-laminin receptor) interaction, Nat Chem Biol.
  • Human KRS (Genbank Accession No. NP_005539.1, etc.) is an N-terminal extension (1-72), an anticodon-binding domain (73-209) and a catalytic domain (220-220). 597). Human KRS is an essential enzyme for protein synthesis and is usually present in the cytoplasm in a multi-tRNA synthetase complex (MSC).
  • MSC multi-tRNA synthetase complex
  • the KRS N-ext region moves to the cell membrane ( translocation). It has also been found that in relation to cancer metastasis, the KRS N-ext region is specifically involved in their binding in interaction with 67LR. In order to use this fact for therapeutic or diagnostic purposes, it is necessary to specifically target a specific target position (especially KRS N-ext) in a protein according to the characteristics of various domain regions constituting the KRS protein. Accordingly, the present inventors produced an antibody that specifically binds to the KRS N-terminal that does not exhibit a cross reaction that also binds to ARS (Korean Patent Application No .: 10-2018-0035446).
  • the affinity of the antibody targeting the existing KRS N-terminus is lower than that of various antibodies in the complete IgG form. Therefore, it is necessary to construct antibodies with higher affinity to the KRS N-terminus.
  • the inventors of the present invention in order to produce an antibody having a better binding affinity for the KRS N-terminal region than the antibody specifically binding to the KRS N-terminal region exposed to the outer cell membrane, the existing antibody light chain variable region and heavy chain The present invention was completed by modifying the variable region.
  • CDR1 heavy chain complementarity determining region 1 (CDR1) comprising the amino acid sequence SYDMS;
  • VH heavy chain variable region
  • CDR3 heavy chain complementarity determining region 3
  • VL light chain variable region
  • X 12 is A or S of light chain complementarity determining region 3 (CDR3)
  • KRS Lysyl-tRNA synthetase
  • Another object of the present invention is to provide a polynucleotide encoding an antibody or fragment thereof, a recombinant expression vector comprising the same, and a cell transformed with the vector.
  • Another object of the present invention is to provide a third object of the present invention.
  • an antibody that specifically binds to the N-terminus of Lysyl-tRNA synthetase (KRS), which is exposed to the outer membrane comprising the step of obtaining an antibody produced from a host cell or a fragment thereof, or It is to provide a method for producing the fragment.
  • KRS Lysyl-tRNA synthetase
  • Another object of the present invention is to provide a pharmaceutical composition for preventing or inhibiting cancer metastasis comprising the antibody or fragment thereof as an active ingredient.
  • Another object of the present invention is to provide a pharmaceutical composition for preventing or inhibiting cancer metastasis comprising the antibody or fragment thereof as an active ingredient.
  • Another object of the present invention is to provide a pharmaceutical composition for preventing or inhibiting cancer metastasis, which consists essentially of the antibody or fragment thereof as an active ingredient.
  • Another object of the present invention is to provide a composition for preventing or treating diseases related to immune cell migration, including the antibody or a fragment thereof as an active ingredient.
  • Another object of the present invention is to provide a composition for preventing or treating diseases related to immune cell migration, wherein the antibody or fragment thereof is composed of an active ingredient.
  • Another object of the present invention is to provide a composition for the prevention or treatment of immune cell migration-related diseases consisting essentially of the antibody or fragment thereof as an active ingredient.
  • Another object of the present invention is to provide a composition for the diagnosis of immune cell migration-related diseases comprising the antibody or fragment thereof as an active ingredient.
  • Another object of the present invention is to provide a composition for the diagnosis of diseases related to immune cell migration, wherein the antibody or fragment thereof is composed of an active ingredient.
  • Another object of the present invention is to provide a composition for diagnosis of diseases related to immune cell migration, which is essentially composed of the antibody or a fragment thereof as an active ingredient.
  • Another object of the present invention is to provide a use of the antibody or fragment thereof for preparing an agent for preventing or inhibiting cancer and cancer metastasis.
  • Another object of the present invention is to provide a method for preventing or inhibiting cancer and cancer metastasis, characterized in that an effective amount of a composition comprising the antibody or fragment thereof is administered to an individual in need thereof.
  • Another object of the present invention is to provide a use of the antibody or fragment thereof for preparing a cancer or cancer metastasis diagnostic agent.
  • Another object of the present invention is to provide a third object of the present invention.
  • Another object of the present invention is to provide the use of the antibody or fragment thereof for preparing an agent for the treatment of immune cell migration-related diseases.
  • Another object of the present invention is to provide a method for the treatment of diseases related to immune cell migration, comprising administering an effective amount of a composition comprising the antibody or fragment thereof to an individual in need thereof.
  • Another object of the present invention is to provide a use of the antibody or fragment thereof for preparing a preparation for diagnosis of diseases related to immune cell migration.
  • Another object of the present invention is to provide a third object of the present invention.
  • CDR1 heavy chain complementarity determining region 1 (CDR1) comprising the amino acid sequence SYDMS;
  • VH heavy chain variable region
  • CDR3 heavy chain complementarity determining region 3
  • VL light chain variable region
  • X 12 is A or S of light chain complementarity determining region 3 (CDR3)
  • KRS Lysyl-tRNA synthetase
  • the present invention provides a polynucleotide encoding an antibody or fragment thereof, a recombinant expression vector comprising the same, and a cell transformed with the vector.
  • an antibody that specifically binds to the N-terminus of Lysyl-tRNA synthetase (KRS), which is exposed to the outer membrane comprising the step of obtaining an antibody produced from a host cell or a fragment thereof, or It provides a method for producing the fragment.
  • KRS Lysyl-tRNA synthetase
  • the present invention provides a pharmaceutical composition for preventing or inhibiting cancer metastasis comprising the antibody or fragment thereof as an active ingredient.
  • the present invention provides a pharmaceutical composition for preventing or inhibiting cancer metastasis comprising the antibody or fragment thereof as an active ingredient.
  • the present invention provides a pharmaceutical composition for preventing or inhibiting cancer metastasis consisting essentially of the antibody or fragment thereof as an active ingredient.
  • the present invention provides a composition for preventing or treating diseases related to immune cell migration, including the antibody or a fragment thereof as an active ingredient.
  • the present invention provides a composition for preventing or treating diseases related to immune cell migration, wherein the antibody or fragment thereof is composed of an active ingredient.
  • the present invention provides a composition for preventing or treating diseases related to immune cell migration, which is essentially composed of the antibody or a fragment thereof as an active ingredient.
  • the present invention provides a composition for the diagnosis of immune cell migration-related diseases comprising the antibody or fragment thereof as an active ingredient.
  • the present invention provides a composition for the diagnosis of diseases related to immune cell migration, wherein the antibody or fragment thereof is composed of an active ingredient.
  • the present invention provides a composition for the diagnosis of diseases related to immune cell migration, which consists essentially of the antibody or fragment thereof as an active ingredient.
  • the present invention provides the use of the antibody or fragment thereof for preparing an agent for preventing or inhibiting cancer and cancer metastasis.
  • the present invention provides a method for preventing or inhibiting cancer and cancer metastasis, characterized in that an effective amount of a composition comprising the antibody or fragment thereof is administered to an individual in need thereof.
  • the present invention provides the use of the antibody or fragment thereof for producing a cancer or cancer metastasis diagnostic agent.
  • d) provides a method for diagnosing cancer or cancer metastasis, comprising diagnosing that cancer and cancer metastasis have occurred when the expression level of the KRS protein is increased compared to a normal control.
  • the present invention provides the use of the antibody or fragment thereof for preparing an agent for the treatment of diseases related to immune cell migration.
  • the present invention provides a method for treating immune cell migration-related diseases, characterized in that an effective amount of a composition comprising the antibody or a fragment thereof is administered to an individual in need thereof.
  • the present invention provides the use of the antibody or fragment thereof for preparing a preparation for diagnosis of diseases related to immune cell migration.
  • the "lysyl-tRNA synthetase (KRS) N-terminal region exposed to the outer cell membrane” is an extracellular region when the KRS generated in the cell moves and is located in the cell membrane (or plasma membrane). It refers to a specific sequence exposed on the surface of the cell membrane, and may usually mean a part or a full-length sequence of the 1 to 72 amino acid region of the KRS N-terminus.
  • the KRS N-terminal region has a sequence similarity between species, and may be characterized in particular comprising an amino acid sequence represented by SEQ ID NO: 117.
  • KRS refers to any KRS fragment sequence comprising a full-length polypeptide or an N-terminal extension known as lysyl R & A synthetase. Since the antibody or fragments according to the present invention specifically detect the KRS N-terminal region exposed to the outer cell membrane as described above, any KRS fragment sequence comprising the above-described KRS full-length polypeptide or N-terminal region also Can be detected.
  • the specific sequence of the KRS is not particularly limited as long as it includes the polypeptide represented by SEQ ID NO: 117 and is known in the art as a lysyl R & A synthetase, and for example, the KRS of the present invention is derived from human ( homo sapiens ).
  • NCBI Genetic Code Accession No. NP_005539.1 and the like, and derived from a mouse ( Mus musculus ) NCBI (Genbank) Accession No. NP_444322.1, etc., and is derived from rat ( Rattus norvegicus ), NCBI (Genbank) Accession No.
  • XP_006255692.1 may refer to the following sequence information in addition to, but is not limited to: XP_005004655.1 (guinea-pig: Cavia porcellus ), XP_021503253.1 (gerbil, Meriones unguiculatus ), XP_002711778.1 (rabbit, Oryctolagus cuniculus ), XP_536777.2 (dog, Canis lupus familiaris ), XP_003126904.2 (swine, Sus scrofa ), XP_011755768.1 (monkey, Macaca nemestrina ), XP_008984479.1 (marmoset, Callithrix jacchus ), XP_019834275.1 (cow, Bos indicus ), XP_511115.2 (chimpanzee, Pan troglodytes ). Most preferably, NCBI (Genbank) Genbank Accession No. It may
  • 'antibody' is also referred to as immunoglobulin (Ig), and is a generic term for proteins involved in bioimmunity by selectively acting on antigens.
  • Whole antibodies found in nature generally consist of two pairs of light chains (LC) and heavy chains (HCs), which are polypeptides of several domains, or two pairs of these HC / LCs
  • the basic structure is the basic unit.
  • There are two types of light chains constituting a mammalian antibody represented by ⁇ and ⁇ .
  • the heavy and light chains of an antibody are structurally divided into variable regions and constant regions according to the variability of amino acid sequences.
  • the constant region of the heavy chain is composed of 3 or 4 heavy chain constant regions such as CH1, CH2 and CH3 (IgA, IgD and IgG antibodies) and CH4 (IgE and IgM antibodies) depending on the type of antibody, and the light chain has one constant region It consists of CL.
  • the variable regions of the heavy and light chains each consist of one domain of the heavy chain variable region (VH) or light chain variable region (VL).
  • the light and heavy chains of each variable region and the constant region are aligned side by side and linked by one covalent disulfide bond, and the heavy chains of the two molecules bound by the light chain are linked by two covalent disulfide bonds to form the entire antibody.
  • the whole antibody specifically binds to the antigen through the variable regions of the heavy and light chains, and since the whole antibody is composed of two pairs of heavy and light chains (HC / LC), the whole antibody of one molecule has two variable regions. This results in a bivalent monospecific binding to the same two antigens.
  • variable region that contains the antibody-binding site is subdivided into a framework region (FR) with less sequence variability and a complementary determining region (CDR), a hypervariable region with high sequence variability. do.
  • FR framework region
  • CDR complementary determining region
  • three CDRs and four FRs are arranged in the order of FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 in the direction from N-terminal to C-terminal, respectively. It is a site in which the CDR having the highest sequence variability in the variable region of the antibody directly binds to the antigen, and is the most important for the antigen specificity of the antibody.
  • the present invention is a.
  • CDR1 heavy chain complementarity determining region 1 (CDR1) comprising the amino acid sequence SYDMS;
  • VH heavy chain variable region
  • CDR3 heavy chain complementarity determining region 3
  • VL light chain variable region
  • X 12 is A or S of light chain complementarity determining region 3 (CDR3)
  • KRS Lysyl-tRNA synthetase
  • the heavy chain variable region is a heavy chain complementarity determining region 1 (CDR1) comprising the amino acid sequence represented by SEQ ID NO: 1; Heavy chain complementarity determining region 2 (CDR2) comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 21, SEQ ID NO: 23 and SEQ ID NO: 118; Characterized in that it comprises a heavy chain complementarity determining region 3 (CDR3) comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO: 5 and SEQ ID NO: 25,
  • the light chain variable region comprises a light chain complementarity determining region 1 (CDR1) comprising the amino acid sequence represented by SEQ ID NO: 7;
  • Light chain complementarity determining region 2 comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO: 9, SEQ ID NO: 27 and SEQ ID NO: 29; Characterized in that it comprises a light chain complementarity determining region 3 (CDR3) comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO: 13 and SEQ ID NO: 15.
  • Antibodies composed of the CDR sequences have excellent ability to specifically bind to the KRS N-terminal region exposed to the outer cell membrane. This is well illustrated in the specification examples of the present invention.
  • a heavy chain variable region of an existing N3 antibody (Application No .: 10-2018-0035446) is specifically bound to the KRS N-terminal region exposed to the outer cell membrane to produce an antibody with high affinity.
  • the improved library was selected through yeast expression.
  • N3-1, N3-3, and N3-4 scFvs having high affinity and specificity in the KRS N-terminal region were selected, and their VH and VL were combined with each other.
  • N3-5 scFv was selected.
  • N3-8 IgG antibody having the highest affinity 7 types (N3-8-1, N3-8-) were introduced by introducing mutations into the heavy chain variable region and light chain region of N3-8. 2, N3-8-3, N3-8-4, N3-8-5, N3-8-6, N3-8-7) antibodies were obtained.
  • the 'antibody or fragment thereof that specifically binds to the KRS N-terminal region exposed to the outer cell membrane' according to the present invention is not limited thereto, but preferably includes the following CDR composition of the heavy chain variable region and the light chain variable region.
  • the following i, ii, iii, iv, v, vi, vii, viii, ix, x, xi, xii, and xiii are N3-1, N3-3, N3-4, N3-5, N3 of Examples, respectively. -6, N3-7, N3-8, N3-9, N3-8-1, N3-8-2, N3-8-3, N3-8-4, N3-8-5, N3-8-6 And CDR combination of N3-8-7 antibody:
  • heavy chain complementarity determining region 1 comprising the amino acid sequence represented by SEQ ID NO: 1
  • heavy chain complementarity determining region 2 comprising the amino acid sequence represented by SEQ ID NO: 3
  • Antibody heavy chain variable region comprising heavy chain complementarity determining region 3 (CDR3) comprising and amino acid sequence represented by SEQ ID NO: 7 light chain complementarity determining region 1 (CDR1), amino acid sequence represented by SEQ ID NO: 9
  • An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 13 (CDR2), light chain complementarity determining region comprising;
  • heavy chain complementarity determining region 1 comprising the amino acid sequence represented by SEQ ID NO: 1
  • heavy chain complementarity determining region 2 comprising the amino acid sequence represented by SEQ ID NO: 3
  • Antibody heavy chain variable region comprising heavy chain complementarity determining region 3 (CDR3) comprising and amino acid sequence represented by SEQ ID NO: 7 light chain complementarity determining region 1 (CDR1), amino acid sequence represented by SEQ ID NO: 9
  • An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 15 (CDR2), light chain complementarity determining region comprising;
  • heavy chain complementarity determining region 1 comprising the amino acid sequence represented by SEQ ID NO: 1
  • heavy chain complementarity determining region 2 comprising the amino acid sequence represented by SEQ ID NO: 118, amino acid sequence represented by SEQ ID NO: 5
  • Antibody heavy chain variable region comprising heavy chain complementarity determining region 3 (CDR3) comprising and amino acid sequence represented by SEQ ID NO: 7 light chain complementarity determining region 1 (CDR1), amino acid sequence represented by SEQ ID NO: 9
  • An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 13 (CDR2), light chain complementarity determining region comprising;
  • heavy chain complementarity determining region 1 comprising the amino acid sequence represented by SEQ ID NO: 1
  • heavy chain complementarity determining region 2 comprising the amino acid sequence represented by SEQ ID NO: 118, amino acid sequence represented by SEQ ID NO: 5
  • Antibody heavy chain variable region comprising heavy chain complementarity determining region 3 (CDR3) comprising and amino acid sequence represented by SEQ ID NO: 7 light chain complementarity determining region 1 (CDR1), amino acid sequence represented by SEQ ID NO: 9
  • An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 15 (CDR2), light chain complementarity determining region comprising;
  • CDR1 heavy chain complementarity determining region 1
  • CDR2 heavy chain complementarity determining region 2
  • VH antibody heavy chain variable region
  • CDR3 amino acid sequence represented by SEQ ID NO: 7
  • SEQ ID NO: 9 An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 15 (CDR2), light chain complementarity determining region comprising;
  • CDR1 heavy chain complementarity determining region 1
  • CDR2 heavy chain complementarity determining region 2
  • VH antibody heavy chain variable region
  • CDR3 amino acid sequence represented by SEQ ID NO: 7
  • SEQ ID NO: 9 An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 15 (CDR2), light chain complementarity determining region comprising;
  • CDR1 heavy chain complementarity determining region 1
  • CDR2 heavy chain complementarity determining region 2
  • VH antibody heavy chain variable region
  • CDR3 amino acid sequence represented by SEQ ID NO: 7
  • SEQ ID NO: 9 An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 15 (CDR2), light chain complementarity determining region comprising;
  • heavy chain complementarity determining region 1 comprising the amino acid sequence represented by SEQ ID NO: 1
  • heavy chain complementarity determining region 2 comprising the amino acid sequence represented by SEQ ID NO: 23
  • amino acid sequence represented by SEQ ID NO: 5 Antibody heavy chain variable region (VH) comprising heavy chain complementarity determining region 3 (CDR3) comprising and amino acid sequence represented by SEQ ID NO: 7 light chain complementarity determining region 1 (CDR1), amino acid sequence represented by SEQ ID NO: 9
  • An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 15 (CDR2), light chain complementarity determining region comprising;
  • CDR1 heavy chain complementarity determining region 1
  • CDR2 heavy chain complementarity determining region 2
  • VH heavy chain complementarity determining region 3
  • SEQ ID NO: 7 light chain complementarity determining region 1 (CDR1), amino acid sequence represented by SEQ ID NO: 27
  • An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 15 (CDR2), light chain complementarity determining region comprising;
  • CDR1 heavy chain complementarity determining region 1
  • CDR2 heavy chain complementarity determining region 2
  • VH heavy chain complementarity determining region 3
  • SEQ ID NO: 7 light chain complementarity determining region 1 (CDR1), amino acid sequence represented by SEQ ID NO: 29
  • An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 15 (CDR2), light chain complementarity determining region comprising;
  • heavy chain complementarity determining region 1 comprising the amino acid sequence represented by SEQ ID NO: 1
  • heavy chain complementarity determining region 2 comprising the amino acid sequence represented by SEQ ID NO: 21, amino acid sequence represented by SEQ ID NO: 25
  • Antibody heavy chain variable region comprising heavy chain complementarity determining region 3 (CDR3) comprising and amino acid sequence represented by SEQ ID NO: 7 light chain complementarity determining region 1 (CDR1), amino acid sequence represented by SEQ ID NO: 9
  • An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 15 (CDR2), light chain complementarity determining region comprising;
  • heavy chain complementarity determining region 1 comprising the amino acid sequence represented by SEQ ID NO: 1
  • heavy chain complementarity determining region 2 comprising the amino acid sequence represented by SEQ ID NO: 21, amino acid sequence represented by SEQ ID NO: 25
  • Antibody heavy chain variable region comprising heavy chain complementarity determining region 3 (CDR3) and amino acid sequence represented by SEQ ID NO: 7 light chain complementarity determining region 1 (CDR1), amino acid sequence represented by SEQ ID NO: 27
  • An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 15 (CDR2), light chain complementarity determining region comprising;
  • CDR1 heavy chain complementarity determining region 1
  • CDR2 heavy chain complementarity determining region 2
  • VH heavy chain complementarity determining region 3
  • SEQ ID NO: 7 light chain complementarity determining region 1 (CDR1), amino acid sequence represented by SEQ ID NO: 29
  • An antibody comprising an antibody light chain variable region (VL) comprising a light chain complementarity determining region 3 (CDR3) comprising the amino acid sequence represented by SEQ ID NO: 15 (CDR2), light chain complementarity determining region comprising;
  • Antibody or a fragment thereof comprising a isoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-bindsethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
  • the antibody or fragment thereof according to the present invention is characterized by comprising the following heavy chain variable region (VH) and light chain variable region (VL):
  • the heavy chain variable region is one selected from the group consisting of SEQ ID NO: 31, SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 41, SEQ ID NO: 43, SEQ ID NO: 45 and SEQ ID NO: 47
  • the amino acid sequence above, and the light chain variable region comprises at least one amino acid sequence selected from the group consisting of SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 53 and SEQ ID NO: 55.
  • the heavy chain variable region comprising the amino acid sequence represented by SEQ ID NO: 31 and the light chain variable region comprising the amino acid sequence represented by SEQ ID NO: 49;
  • a heavy chain variable region comprising the amino acid sequence represented by SEQ ID NO: 31 and a light chain variable region comprising the amino acid sequence represented by SEQ ID NO: 51;
  • a heavy chain variable region comprising the amino acid sequence represented by SEQ ID NO: 35 and a light chain variable region comprising the amino acid sequence represented by SEQ ID NO: 49;
  • a heavy chain variable region comprising an amino acid sequence represented by SEQ ID NO: 35 and a light chain variable region comprising an amino acid sequence represented by SEQ ID NO: 51;
  • a heavy chain variable region comprising the amino acid sequence represented by SEQ ID NO: 37 and a light chain variable region comprising the amino acid sequence represented by SEQ ID NO: 51;
  • a heavy chain variable region comprising the amino acid sequence represented by SEQ ID NO: 39 and a light chain variable region comprising the amino acid sequence represented by SEQ ID NO: 51
  • the antibody of the IgG form comprising the heavy chain variable region (VH) and the light chain variable region (VL) is specifically SEQ ID NO: 89, SEQ ID NO: 93, SEQ ID NO: 95, SEQ ID NO: 97, SEQ ID NO: 99, SEQ ID NO: 101, the sequence Heavy chain comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO: 103 and SEQ ID NO: 105 and at least one amino acid sequence selected from the group consisting of SEQ ID NO: 107, SEQ ID NO: 109, SEQ ID NO: 111, SEQ ID NO: 113 and SEQ ID NO: 115 It may be an antibody characterized by consisting of a light chain.
  • the 'antibody that specifically binds to the KRS N-terminal region exposed to the outer cell membrane' according to the present invention is not limited in its kind as long as it has the above-described CDR combination or VH and VL combination.
  • the antibody may be selected from the group consisting of IgG, IgA, IgM, IgE and IgD, and may be preferably an IgG antibody.
  • the antibody of the present invention may be a monoclonal antibody or a polyclonal antibody as long as it has the above-described CDR combination or VH and VL combination that specifically binds to the KRS N-terminal region. It is preferred that the heavy chain and light chain of the amino acid sequence is a monoclonal antibody that is a population of antibodies that are substantially identical.
  • the antibody of the present invention may be derived from any animal, including mammals, birds, etc., including humans, preferably human-derived, or human-derived antibodies and animals of other species. It may be a chimeric antibody comprising a portion of an antibody. That is, the present invention includes all chimeric antibodies, humanized antibodies, and human antibodies, and may preferably be human antibodies.
  • the fragment of the antibody refers to a fragment of the antibody that maintains the antigen-specific binding capacity of the entire antibody, preferably the fragment is similar to the KRS N-terminal binding affinity of the parent antibody, or at least 20%, 50% , 70%, 80%, 90%, 95% or 100% or more.
  • it may be in the form of Fab, F (ab) 2, Fab ', F (ab') 2, Fv, diabody, scFv, and the like.
  • Fab fragment antigen-binding
  • F (ab ') 2 is a fragment produced by hydrolyzing an antibody with pepsin, and the two Fabs are linked by disulfide bonds in a heavy chain hinge.
  • F (ab ') is a monomeric antibody fragment in which heavy chain hinges are added to Fabs separated by reducing disulfide bonds of F (ab') 2 fragments.
  • Fv (variable fragment) is an antibody fragment composed of only the variable regions of the heavy and light chains.
  • the scFv is a recombinant antibody fragment in which the heavy chain variable region (VH) and the light chain variable region (VL) are linked by a flexible peptide linker.
  • Diabody refers to a fragment of a form that forms a dimer by binding to VL and VH of different scFvs of the same form, and cannot connect to each other because the VH and VL of scFv are connected by a very short linker.
  • the fragment of the antibody is not limited in structure or form as long as it maintains binding specificity to the KRS N-terminal region exposed to the outer cell membrane, but may be preferably scFv.
  • the scFv according to the present invention has a CDR configuration specific to the above-described KRS N-terminal region, or VH and VL, and the sequence is particularly limited if the C-terminal of VH and the N-terminal of VL are linked via a linker. Does not work. If the linker is known in the art as a linker applied to scFv, the type is not particularly limited, but may be a peptide comprising an amino acid sequence represented by SEQ ID NO: 57.
  • the scFv of the present invention is specifically SEQ ID NO: 61, SEQ ID NO: 63, SEQ ID NO: 65, SEQ ID NO: 67, SEQ ID NO: 69, SEQ ID NO: 71, SEQ ID NO: 73, SEQ ID NO: 75, SEQ ID NO: 77, SEQ ID NO: 79, SEQ ID NO: It may be to include an amino acid sequence selected from the group consisting of SEQ ID NO: 81, SEQ ID NO: 83, SEQ ID NO: 85 and SEQ ID NO: 87.
  • Antibodies of the invention or fragments thereof may contain conservative amino acid substitutions (referred to as conservative variants of antibodies) that do not substantially alter their biological activity.
  • the antibody or fragment thereof of the present invention described above may be conjugated with an enzyme, a fluorescent substance, a radioactive substance and a protein, but is not limited thereto.
  • methods for conjugating such substances to antibodies are well known in the art.
  • the present invention provides a polynucleotide encoding the antibody or fragment thereof.
  • Polynucleotides may be described herein as oligonucleotides or nucleic acids, and are generated using DNA molecules (eg, cDNA or genomic DNA), RNA molecules (eg, mRNA), and nucleotide analogs. Analogs of the DNA or RNA (eg, peptide nucleic acids and non-naturally occurring nucleotide analogs) and hybrids thereof The polynucleotide is single-stranded or double-stranded (double stranded).
  • the polynucleotide refers to a base sequence encoding an antibody consisting of a heavy chain and a light chain having a CDR configuration specific to the KRS N-terminal region described above, or VH and VL. If the polynucleotide of the present invention encodes an antibody or a fragment thereof of the present invention, the sequence is not particularly limited, and the sequence of the polynucleotide encoding the CDR sequence described above in the antibody according to the present invention described above is particularly limited.
  • SEQ ID NO: 2 SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: Number 24, SEQ ID NO: 26, SEQ ID NO: 28, it may be to include a nucleotide sequence represented by SEQ ID NO: 30 or SEQ ID NO: 119.
  • polynucleotide encoding the above-mentioned VH and VL in the antibody according to the present invention is not particularly limited in sequence, but preferably SEQ ID NO: 32 (VH), SEQ ID NO: 34 (VL), SEQ ID NO: 36 (VH), sequence SEQ ID NO: 38 (VH), SEQ ID NO: 40 (VH), SEQ ID NO: 42 (VH), SEQ ID NO: 44 (VH), SEQ ID NO: 46 (VH), SEQ ID NO: 48 (VH), SEQ ID NO: 50 (VL), SEQ ID NO: 52 (VL), SEQ ID NO: 54 (VL) or may be to include a nucleotide sequence represented by SEQ ID NO: 56 (VL).
  • polynucleotide encoding the fragment of the antibody preferably SEQ ID NO: 62, SEQ ID NO: 64, SEQ ID NO: 66, SEQ ID NO: 68 encoding the scFv according to the present invention, SEQ ID NO: 70, SEQ ID NO: 72, SEQ ID NO: 74, It may be to include any one nucleotide sequence selected from the group consisting of SEQ ID NO: 76, SEQ ID NO: 78, SEQ ID NO: 80, SEQ ID NO: 82, SEQ ID NO: 84, SEQ ID NO: 86 and SEQ ID NO: 88.
  • the polynucleotide encoding the antibody or fragment thereof of the present invention can be obtained by methods well known in the art. For example, based on a DNA sequence or a corresponding amino acid sequence encoding part or all of the heavy and light chains of the antibody, oligonucleotide synthesis techniques well known in the art, such as polymerase chain reaction (PCR), etc. Can be synthesized.
  • PCR polymerase chain reaction
  • the present invention provides a recombinant expression vector comprising a polynucleotide encoding an antibody or fragment thereof according to the present invention.
  • 'recombinant' may be used interchangeably with 'genetic manipulation', and in a state of nature using molecular cloning experiment techniques such as modification, cutting, and linking of genes. It means producing a gene that does not exist.
  • 'expression' means that a protein or nucleic acid is produced in a cell.
  • the 'recombinant expression vector' is a vector capable of expressing a desired protein or nucleic acid (RNA) in a suitable host cell, and is an essential regulation operably linked to allow expression of a polynucleotide (gene) insert.
  • RNA nucleic acid
  • gene polynucleotide
  • 'Operably linked' is a functional linkage between a nucleic acid expression control sequence and a nucleic acid sequence encoding a desired protein or RNA to perform a general function. As it is, it means that the gene is linked to be expressed by the expression control sequence.
  • the 'expression control sequence' refers to a DNA sequence that controls the expression of a polynucleotide sequence operably linked in a specific host cell.
  • Such regulatory sequences include promoters for conducting transcription, any operator sequence for regulating transcription, sequences encoding suitable mRNA ribosomal binding sites, sequences regulating the termination of transcription and translation, initiation codons, termination codons, polyadenylation Signals and enhancers.
  • the recombinant expression vector of the present invention is not particularly limited as long as it is a vector commonly used in the cloning field, and examples include, but are not limited to, mammalian expression vector, plasmid vector, cosmid vector, bacteriophage vector and virus vector. Does not work.
  • the plasmids include E. coli-derived plasmids (pBR322, pBR325, pUC118 and pUC119, pET-22b (+)), Bacillus subtilis-derived plasmids (pUB110 and pTP5), and yeast-derived plasmids (YEp13, YEp24 and YCp50).
  • virus animal viruses such as retrovirus, adenovirus or vaccinia virus, insect viruses such as baculovirus, and the like can be used.
  • a polynucleotide encoding an antibody or a fragment thereof composed of heavy chains and light chains having the above-described CDRs capable of specifically binding to the KRS N-terminal region, or VH and VL, or fragments thereof is suitable.
  • a gene construct operably linked to be expressed in a host cell is suitable.
  • polynucleotides encoding the heavy and light chains of the antibody according to the present invention may be included in separate recombinant expression vectors or may be included in one recombinant expression vector.
  • the present invention provides cells transformed with the recombinant expression vector.
  • the cell of the present invention is not particularly limited as long as it can be used to express a polynucleotide encoding an antibody or fragment thereof included in the recombinant expression vector of the present invention.
  • Cells (host cells) transformed with the recombinant expression vector according to the present invention include prokaryotes (eg, E. coli), eukaryotes (eg, yeast or other fungi), plant cells (eg, tobacco or tomato). Plant cells), animal cells (eg, human cells, monkey cells, hamster cells, rat cells, mouse cells, insect cells, or hybridomas derived therefrom).
  • it may be a cell derived from a mammal, including a human.
  • Suitable prokaryotes for this purpose is a Gram-negative or Gram-positive organisms, for example bacteria, Enterococcus new (Enterobacteriaceae), for example, Escherichia (Escherichia), for example. Coli (E. coli), Enterobacter (Enterobacter), El Winiah (Erwinia), keulrep when Ella (Klebsiella), Proteus (Proteus), Salmonella (Salmonella), e.g., Salmonella typhimurium (S almonella typhimurium), Serra Serratia , for example, Serratia marcescans) and Shigella (Shigella), and Bashile (Bacilli), for example, rain.
  • Enterococcus new Enterococcus new (Enterobacteriaceae)
  • Escherichia Escherichia
  • Coli E. coli
  • Enterobacter Enterobacter
  • El Winiah Erwinia
  • subtilis and B. subtilis . Lee and Kenny formate miss include (B. licheniformis), Pseudomonas (Pseudomonas), for example, blood. Rugi her labor (P. aeruginosa), and Streptomyces (Streptomyces).
  • the cell of the present invention is not particularly limited as long as it can express the vector of the present invention, preferably. It can be coli.
  • Saccharomyces Saccharomyces
  • Saccharomyces cerevisiae
  • many other genera, species and strains but are not limited to, for example, Schizosaccharomyces pombe , Kluyveromyces host, eg K. K. lactis , K. K. fragilis (ATCC 12,424), K. K. bulgaricus (ATCC 16,045), K. Wicker lamina (K. wickeramii) (ATCC 24,178) , K. Walt ( K. waltii ) (ATCC 56,500), K. Drosophila room ( K.
  • Schizosaccharomyces pombe Kluyveromyces host, eg K. K. lactis , K. K. fragilis (ATCC 12,424), K. K. bulgaricus (ATCC 16,045), K. Wicker lamina (K. wickeramii) (ATCC 24,178) , K. Walt ( K. waltii )
  • the term 'transformation' refers to the modification of the host cell's genotype by introduction of the foreign polynucleotide, and refers to the introduction of the foreign polynucleotide into the host cell regardless of the method used for the transformation.
  • Exogenous polynucleotides introduced into a host cell may remain integrated or unintegrated into the genome of the host cell, and the present invention includes both.
  • a recombinant expression vector capable of expressing an antibody or fragment thereof that specifically binds to the KRS N-terminal region according to the present invention is a method known in the art, for example, but not limited to, transient transfection (transient transfection) ), Microinjection, transduction, cell fusion, calcium phosphate precipitation, liposome-mediated transfection, DEAE dextran-mediated transfection, polybrene- Introduced into cells to produce antibodies or fragments thereof by known methods for introducing nucleic acids into cells, such as mediated transfection (polybrene-mediated transfection), electroporation, gene guns, etc. Can be transformed.
  • the present invention is a.
  • an antibody that specifically binds to the N-terminus of Lysyl-tRNA synthetase (KRS), which is exposed to the outer membrane comprising the step of obtaining an antibody produced from a host cell or a fragment thereof, or It provides a method for producing the fragment.
  • KRS Lysyl-tRNA synthetase
  • Step (a) is a step of transforming a host cell into a recombinant expression vector operably linked to a polynucleotide encoding the antibody or a fragment thereof to produce an antibody or fragment thereof according to the present invention.
  • Recombinant expression vectors containing the heavy chain and light chain base sequences can be co-transformed into the same host cell so that the heavy and light chains can be expressed in one cell, and separate recombinant expression vectors containing the heavy chain and light chain base sequences, respectively. It can be transformed into a host cell of the heavy chain and light chain can be expressed separately.
  • Step (b) is a step of culturing the transformed host cell to produce a polypeptide of the heavy chain, light chain or antibody fragment of the antibody according to the present invention from a recombinant expression vector introduced into the host cell.
  • the medium composition for culturing the host cell, culture conditions, culture time, etc. can be appropriately selected according to methods commonly used in the art.
  • the antibody molecule produced in the host cell may be accumulated in the cytoplasm of the cell, secreted into the cell or culture medium by an appropriate signal sequence, or targeted by periplasm.
  • the antibody according to the present invention refolds the protein using a method known in the art so as to maintain the binding specificity to the KRS N-terminus and has a functional conformation.
  • the heavy and light chains can be expressed in separate cells, and in separate steps, the heavy and light chains can be contacted to form a complete antibody, and the heavy and light chains are expressed in the same cell. It is also possible to form a complete antibody inside the cell.
  • Step (c) is a step of obtaining an antibody or a fragment produced in a host cell.
  • the antibody secreted into the culture medium or a fragment thereof can be recovered by obtaining a medium in which the host cell is cultured, and centrifuging to remove impurities. If necessary, cells may be lysed within a range that does not affect the functional structure of the antibody or fragment thereof in order to release and recover the antibody present in a specific organelle or cytoplasm in the cell outside the cell.
  • the obtained antibody may be further subjected to a process of further removing and concentrating impurities through methods such as chromatography, filtration by a filter, and dialysis.
  • the polypeptide of the production (production) method of the present invention may be an antibody of the present invention or a fragment itself, and may be an amino acid sequence other than the antibody of the present invention or a fragment thereof, which is additionally bound. In this case, it can be removed from the antibody or fragment thereof of the present invention using methods well known to those skilled in the art.
  • the antibody or fragment thereof of the present invention specifically binds to the KRS N-terminus, and thus is useful for diagnostic analysis to detect and quantify, for example, KRS protein in a specific cell, tissue, or serum.
  • the detection method of the present invention is the presence or absence of KRS (or KRS N-terminal peptide exposed to the outer cell membrane) using the antibody or fragment thereof according to the present invention, before contacting the antibody or fragment thereof according to the present invention with a sample. It may include the step of preparing a sample for measuring the concentration (step (1)).
  • the skilled person can appropriately select a known method for detecting a protein using an antibody, and prepare a sample suitable for the selected method.
  • the sample may be a cell or tissue, blood, whole blood, serum, plasma, saliva, cerebrospinal fluid, etc. obtained from a biopsy taken from a subject wishing to diagnose cancer (particularly breast cancer or lung cancer), and whether or not the stage is metastatic.
  • the method for detecting a protein using the antibody is not limited thereto, for example, Western blot, immunoblot, dot blot, immunohistochemistry, immunocytochemistry, enzyme immunoassay (ELISA) , Radioimmunoassay, competitive binding assay, and immunoprecipitation.
  • a buffer suitable for electrophoresis may be added to a sample or a cell lysate to prepare it for boiling.
  • a buffer suitable for electrophoresis may be added to a sample or a cell lysate to prepare it for boiling.
  • cells or tissue sections are fixed and blocked. Pre-treatment such as blocking can be performed.
  • step (2) The step of contacting the antibody or a fragment thereof with the sample prepared in the aforementioned step (step (2)) is performed.
  • the antibody according to the present invention is an antibody or a fragment thereof that specifically binds to the KRS N-terminus having the above-described CDR, or VH and VL configurations, and the specific types and sequence configurations are as described above.
  • the antibody or fragment thereof can be generally labeled with a detectable moiety for its 'detection'.
  • a detectable moiety for its 'detection'.
  • it may be labeled with radioactive isotopes or fluorescent labels, using techniques known in the art.
  • various enzyme-substrate labels are available, examples of such enzymatic labels are luciferases, luciferin, 2,3-dihydrophthala, such as Drosophila luciferase and bacterial luciferase (US Pat. No. 4,737,456).
  • Peroxidase such as gindiones, malate dehydrogenase, urase, horseradish peroxidase (HRPO), alkaline phosphatase, ⁇ -galactosidase, glucoamylase, lysozyme, saccharide oxy Multidrugs (e.g. glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase), heterocyclic oxidase (e.g. uricase and xanthine oxidase), lactoperoxidase, microperoxy And multidose. Techniques for conjugating enzymes to antibodies are known in the art.
  • Labels can be conjugated to antibodies directly or indirectly using a variety of known techniques.
  • the antibody can be conjugated to biotin and any markers falling within the three broad categories mentioned above can be conjugated to avidin, or vice versa. Biotin binds selectively to avidin, so this label can be conjugated to the antibody in this indirect manner.
  • the antibody can be conjugated with a small hapten (eg, digoxin) and one of the different types of labels mentioned above is anti- Can be conjugated to hapten antibodies (eg, anti-dioxine antibodies).
  • hapten antibodies eg, anti-dioxine antibodies
  • contacting in its general sense, and means that two or more substances are mixed, bonded, or brought into contact with each other.
  • the contacting can be performed in vitro or on another container, and can also be performed in situ, in vivo, in an individual, in tissue, in cells.
  • a step ((3) step) of detecting an antibody or a fragment thereof according to the present invention is performed on a sample after the step (2).
  • the 'detection' targets the complex of the antibody or fragment and antigen according to the present invention formed in a sample, and the presence or absence of a peptide (or a protein containing the same, for example, KRS) of the KRS N-terminal region It means detecting or measuring the level of the peptide (including both qualitative and quantitative measurements). Therefore, after performing the step (2), before the detection step (step (3)) described later, the step of removing the extra antibody or fragments not forming a complex with the KRS N-terminal region may be further included.
  • the antibody or fragment used in step (2) described above contains a detectable moiety such as fluorescently, radioactive isotope, enzyme, or the like, it is known in the art to detect the moiety. Accordingly, detection can be performed.
  • radioactivity may be measured, for example, by scintillation counting, and fluorescence may be quantified using a fluorimeter.
  • step (2) described above or a fragment thereof does not contain the above-described detection moiety as such, using a secondary antibody labeled with fluorescence, radioactivity, enzymes, etc., as is known in the art. It can be detected indirectly.
  • the secondary antibody binds to an antibody or fragment thereof (primary antibody) according to the present invention.
  • the present invention provides a pharmaceutical composition for preventing or inhibiting cancer metastasis and a composition for diagnosing cancer, comprising the antibody of the present invention or a fragment thereof as an active ingredient.
  • the type is not particularly limited, but breast cancer, colorectal cancer, lung cancer, small cell lung cancer, stomach cancer, liver cancer, blood cancer, bone cancer, pancreatic cancer, skin cancer, head or neck cancer, skin or intraocular Melanoma, uterine cancer, ovarian cancer, rectal cancer, anal cancer, colon cancer, fallopian tube carcinoma, endometrial carcinoma, cervical cancer, vaginal cancer, vulvar carcinoma, Hodgkin's disease, esophageal cancer, small intestine cancer, endocrine adenocarcinoma, thyroid cancer, parathyroid cancer, adrenal cancer, Soft tissue sarcoma, urethral cancer, penile cancer, prostate cancer, chronic or acute leukemia, lymphocytic lymphoma, bladder cancer, kidney or urinary tract cancer, renal cell carcinoma, renal pelvic carcinoma, CNS tumor, primary CNS lymphoma, spinal cord tumor, brainstem glioma and It may be selected from the
  • the pharmaceutical composition according to the present invention may include the antibody of the present invention or a fragment thereof alone or may further include one or more pharmaceutically acceptable carriers.
  • “Pharmaceutically acceptable” in the above refers to a composition that is physiologically acceptable and does not inhibit the action of the active ingredient when administered to humans and usually does not cause serious side effects.
  • the antibody or fragment thereof may be administered in various dosage forms, oral and parenteral, during clinical administration.
  • a filler, a bulking agent, a binder, a wetting agent, a disintegrant, which are usually used It may be prepared using a diluent or excipient, such as a surfactant.
  • Solid preparations for oral administration include tablets, patients, powders, granules, capsules, troches, etc., such solid preparations comprising at least one excipient in one or more aryl derivatives, or pharmaceutically acceptable salts thereof.
  • lubricants such as magnesium stearate, talc, etc. may be used in addition to simple excipients.
  • Liquid preparations for oral administration include suspending agents, intravenous solutions, emulsions or syrups, etc.
  • various excipients such as wetting agents, sweeteners, fragrances, and preservatives, are included. You can.
  • Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solutions, suspension solutions, emulsions, lyophilized preparations, and suppositories.
  • the therapeutic composition of the present invention can be prepared in the form of a lyophilized cake or aqueous solution for storage by mixing any physiologically acceptable carrier, excipient or stabilizer with an antibody of the desired purity.
  • Acceptable carriers, excipients or stabilizers are non-toxic to recipients at the dosages and concentrations used, and buffer solutions such as phosphoric acid, citric acid and other organic acids; Antioxidants including ascorbic acid; Low molecular weight (less than about 10 residues) polypeptides; Proteins such as serum albumin, gelatin or immunoglobulins; Hydrophilic polymers such as polyvinylpyrrolidone; Amino acids such as glycine, glutamine, asparagine, arginine or lysine; Monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; Chelating agents, such as EDTA; Sugar alcohols such as mannitol or sorbitol; Salt-forming counterions such as sodium; And / or nonionic surfactants such as tween, pluronics or polyethylene glycol (PEG).
  • buffer solutions such as phosphoric acid, citric acid and other organic acids; Antioxidants including ascor
  • the antibody of the present invention can be administered in a pharmaceutically effective amount to an individual suffering from cancer.
  • a pharmaceutically effective amount refers to an amount that responds more than a negative control group, and preferably refers to an amount sufficient to treat cancer or an amount sufficient to prevent or inhibit cancer metastasis.
  • the total effective amount of the antibody or fragment thereof of the present invention can be administered to a patient in a single dose, and can be administered by a fractionated treatment protocol that is administered for a long time in multiple doses. have.
  • the dose of the antibody or fragment of the present invention to the human body is generally 0.01-100 mg / kg / week, preferably 0.1-20 mg / kg / week, more preferably 5-10 mg / kg / It can be week.
  • the dose of the antibody or fragment thereof of the present invention is considered to the patient considering various factors such as the patient's age, weight, health status, sex, disease severity, diet and excretion rate, as well as the route and frequency of administration of the pharmaceutical composition. Since the effective dosage for a patient is determined, a person having ordinary skill in the art in consideration of this point can determine the appropriate effective dosage according to the specific use of the antibody or fragment thereof of the present invention as a cancer treatment or cancer metastasis prevention or inhibitor. Will be able to decide.
  • the pharmaceutical composition according to the present invention is not particularly limited in its formulation, route of administration and method of administration as long as it shows the effect of the present invention.
  • compositions of the invention can be administered or injected by known methods of antibody administration, e.g., by intravenous, intraperitoneal, intracranial, subcutaneous, intramuscular, intraocular, intraarterial, intrathecal, or intralesional routes, or Injection or infusion by the described sustained release system.
  • the antibodies of the invention can be administered systemically or locally.
  • the pharmaceutical composition of the present invention can be used alone or in combination with methods using surgery, hormone therapy, chemotherapy, and biological response modifiers for the prevention or treatment of cancer or cancer metastasis.
  • Diagnosis and prognostic evaluation of cancer and cancer metastasis according to the present invention can be performed by detecting KRS protein (in particular, the KRS N-terminal region exposed to the outer membrane) in a biological sample.
  • diagnosis means to identify the presence or characteristics of a pathological condition.
  • diagnosis is to confirm whether cancer or cancer metastasis has occurred, the likelihood (risk), and the stage of progression of the disease.
  • the biological sample includes blood or other liquid samples of biological origin, biopsy sample, solid tissue sample such as tissue culture, or cells derived therefrom. More specifically, for example, but not limited to, tissue, extract, cell lysate, whole blood, plasma, serum, saliva, ocular fluid, cerebrospinal fluid, sweat, urine, milk, ascites fluid, synovial fluid, peritoneal fluid, and the like.
  • the sample can be obtained from an animal, preferably a mammal, most preferably a human.
  • the sample can be pretreated prior to use for detection. For example, it may include filtration, distillation, extraction, concentration, inactivation of interfering components, addition of reagents, and the like.
  • nucleic acids and proteins can be separated from the sample and used for detection.
  • the antibody or fragment thereof according to the present invention may be provided as a diagnostic kit, and the kit is not particularly limited as long as it is known in the art as an analysis kit for providing an antibody or a peptide having a specific binding domain as a component.
  • an analysis kit for providing an antibody or a peptide having a specific binding domain as a component For example, Western blot, ELISA, radioimmunoassay, radioimmunoassay, Oukteroni immunodiffusion method, locate immunoelectrophoresis, tissue immunostaining, cell immunostaining, immunoprecipitation assay, complement fixation assay, FACS or protein chip kit, etc. It includes.
  • the antibody or fragment thereof of the present invention can be used in a packaged combination of reagents in a predetermined amount with instructions for use in the kit, that is, a diagnostic kit for performing diagnostic analysis.
  • the kit may contain a cofactor required by the enzyme as a substrate precursor providing a substrate and a chromophore or fluorophore.
  • other additives may be included, such as stabilizers, buffers (eg, blocking buffer or lysis buffer), and the like.
  • the relative amounts of various reagents can be varied widely to provide concentrations in solution of the reagents that fully optimize the sensitivity of the assay.
  • Reagents can be provided as generally lyophilized, dry powders that contain excipients that, upon dissolution, will provide a reagent solution with an appropriate concentration.
  • the antibody is a polypeptide comprising an Fc variant of the wild-type human IgG Fc region, wherein the Fc variant is represented by L117A, L118A, T182A, P212G or SEQ ID NO: 138 of the wild-type human IgG1 Fc region represented by SEQ ID NO: 126 It comprises one or more additional amino acid substitutions T179A of the human IgG4 Fc region, the polypeptide is characterized in that it comprises a polypeptide having a reduced ADCC / CDC function compared to a polypeptide comprising a wild-type IgG Fc region.
  • the Fc region refers to the C-terminal region of an immunoglobulin heavy chain containing at least a portion of the constant region, and includes a wild-type sequence Fc region and a variant Fc region.
  • Fc variant refers to a polypeptide comprising a modification to an Fc domain.
  • the Fc variant of the present invention is defined according to the amino acid modification constituting it.
  • L118A is an Fc variant in which leucine is substituted with alanine at position 118 compared to the parent Fc polypeptide
  • T182A is an Fc variant in which threonine is substituted by alanine at position 182
  • P212G is proline at position 212 with glycine Fc variant.
  • the amino acid modification can be amino acid addition, amino acid deletion or amino acid substitution. Amino acid substitutions can include naturally occurring amino acids and non-naturally occurring amino acids. Variants can include non-natural amino acids.
  • amino acid substitution refers to the substitution of one or more existing amino acid residues with another different “replacement” amino acid residue within a given amino acid sequence.
  • the replacement residue or residues can be “naturally occurring amino acid residues” (ie encoded by the genetic code), alanine (Ala); Arginine (Arg); Asparagine (Asn); Aspartic acid (Asp); Cysteine (Cys); Glutamine (Gln); Glutamic acid (Glu); Glycine (Gly); Histidine (His); Isoleucine (Ile): leucine (Leu); Lysine (Lys); Methionine (Met); Phenylalanine (Phe); Proline (Pro); Serine; Threonine (Thr); Tryptophan (Trp); Tyrosine (Tyr); And valine (Val).
  • ADCC antibody-dependent cellular cytotoxicity
  • CDC complement-dependent cytotoxicity
  • ADCC antibody-dependent cytotoxicity
  • FcRs Fc receptors
  • NK natural killer cells
  • macrophages a cell-mediated reaction that recognizes and thus lyses the target cells.
  • CDC and ADCC can be measured using methods well known in the art and available. (Reference examples: U.S.
  • the constant region of an antibody is important in its ability to immobilize complement and mediate cell-dependent cytotoxicity.
  • the isotype of the antibody can be selected based on whether it is desirable for the antibody to mediate cytotoxicity.
  • the antibody of the present invention is specifically represented by SEQ ID NO: 140, 142, 144, 146, 148, 150, 152 of the amino acid sequence represented by a heavy chain comprising at least one amino acid sequence and SEQ ID NO: 91 A light chain comprising an amino acid sequence;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 140, 142, 144, 146, 148, 150, 152 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 107;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 140, 142, 144, 146, 148, 150, 152 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 109;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 154, 156, 158, 160, 162, 164, 166 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 107;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 154, 156, 158, 160, 162, 164, 166 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 109;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 168, 170, 172, 174, 176, 178, 180 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 109;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 182, 184, 186, 188, 190, 192, 194 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 109;
  • a heavy chain comprising one or more amino acid sequences selected from amino acid sequences represented by SEQ ID NOs: 224, 226, 228, 230, 232, 234, 236; and a light chain comprising an amino acid sequence represented by SEQ ID NO: 109;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 210, 212, 214, 216, 218, 220, 222 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 109;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 224, 226, 228, 230, 232, 234, 236 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 111;
  • a heavy chain comprising at least one amino acid sequence selected from among amino acid sequences represented by SEQ ID NOs: 224, 226, 228, 230, 232, 234, 236 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 113;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 224, 226, 228, 230, 232, 234, and 236; and a light chain comprising an amino acid sequence represented by SEQ ID NO: 115;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 238, 240, 242, 244, 246, 248, 250 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 111;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 238, 240, 242, 244, 246, 248, 250 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 113;
  • a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 238, 240, 242, 244, 246, 248, 250 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 115; or
  • An antibody comprising a heavy chain comprising at least one amino acid sequence selected from amino acid sequences represented by SEQ ID NOs: 196, 198, 200, 202, 204, 206, 208 and a light chain comprising an amino acid sequence represented by SEQ ID NO: 111.
  • the present invention provides a composition for preventing or treating diseases related to immune cell migration, including the antibody or a fragment thereof as an active ingredient, and a composition for diagnosis of diseases related to immune cell migration.
  • the term 'immune cell migration-related diseases' in the present invention is not particularly limited in its specific type, as long as it is known in the art that excessive immune cell migration (or / and infiltration) is a major pathogenesis mechanism, for example, cardiovascular disease, It may be selected from the group consisting of fibrotic disease, inflammatory disease and Alport syndrome.
  • the specific type of the cardiovascular disease is not particularly limited, but includes, for example, hypertension (including inflammatory complications caused by hypertension), pulmonary arterial hypertension, atherosclerosis, angina, myocardial infarction, ischemic cerebrovascular disease, atherosclerosis, and mesenteric sclerosis. It may be selected from the group.
  • the specific type of the fibrosis disease is not particularly limited, for example, scleroderma, rheumatoid arthritis, Crohn's disease, ulcerative colitis, myelofibrosis, lung Pulmonary fibrosis, hepathic fibrosis, liver cirrhosis, kidney fibrosis, glomerulosclerosis, myofibrosis, cardiac fibrosis, interstitial fibrosis, pancreatic fibrosis, splenic fibrosis , Mesenteric fibrosis, vascular fibrosis, skin fibrosis, eye fibrosis, macular degeneration, joint fibrosis, thyroid fibrosis, endocardial myocardial fibrosis, peritoneal fibrosis, post-peritoneal fibrosis, progressive mass fibrosis, Systemic lupus erythematosu, hereditary fibrosis, infectious fibrosis, irritating fibrosis, chronic autoimmune fibrosis
  • the type of the inflammatory disease is not particularly limited, but preferably, autoimmune disease, inflammatory bowel disease, dermatitis (for example, atopic dermatitis, eczema, psoriasis, etc.), diabetic eye disease (diabetic) Retinopathy, etc.), peritonitis, osteomyelitis, vesitis, meningitis, encephalitis, pancreatitis, traumatic shock, bronchial asthma, rhinitis, sinusitis, otitis media, pneumonia, gastritis, enteritis, cystic fibrosis, stroke (bronchial, stroke, etc.), bronchitis, bronchiolitis , Hepatitis (cirrhosis, non-alcoholic steatohepatitis), nephritis (diabetic renal failure, etc.), proteinuria, arthritis (psoriatic arthritis, osteoarthritis, etc.), neuritis (diabetic),
  • Autoimmune diseases in the present invention Rheumatoid arthritis, systemic scleroderma, systemic lupus erythematosus, psoriasis, asthma, ulcerative colitis, Behcet's disease, Crohn's disease, multiple sclerosis, dermatomyositis, collagen disease, vasculitis, arthritis, granulomatosis, organ specific autoimmune lesions, ulcerative colitis And GvHD (graft-versus-host disease).
  • the chronic inflammatory diseases are meant to include a chronic (chronic) state with reference to the above-mentioned types of inflammatory diseases, preferred examples of these are asthma, atopic dermatitis, eczema, psoriasis, osteoarthritis, gout, Psoriatic arthritis, cirrhosis, non-alcoholic steatohepatitis, chronic obstructive pulmonary disease, rhinitis, diabetic retinopathy, diabetic renal failure, diabetic neuropathy and multiple sclerosis, but are not limited thereto.
  • the antibody of the present invention can be administered in a pharmaceutically effective amount to individuals suffering from immune cell migration-related diseases.
  • a pharmaceutically effective amount' refers to an amount that exhibits a higher response than a negative control, and preferably refers to an amount sufficient to treat diseases related to immune cell migration.
  • the total effective amount of the antibody or fragment thereof of the present invention, the formulation of the composition, method of administration and route of administration are described above.
  • the pharmaceutical composition of the present invention can be used alone or in combination with methods using surgery, hormone therapy, chemotherapy, and biological response modifiers for the prevention or treatment of immune cell migration-related diseases.
  • Diagnosis and prognostic evaluation of diseases related to immune cell migration can be performed by detecting a KRS protein (in particular, a KRS N-terminal region exposed to the outer membrane) in a biological sample.
  • a KRS protein in particular, a KRS N-terminal region exposed to the outer membrane
  • the present invention provides the use of the antibody or fragment thereof for preparing an agent for preventing or inhibiting cancer and cancer metastasis.
  • the present invention provides a method for preventing or inhibiting cancer and cancer metastasis, characterized in that an effective amount of a composition comprising the antibody or fragment thereof is administered to an individual in need thereof.
  • the present invention provides the use of the antibody or fragment thereof for preparing a preparation for diagnosis of cancer or cancer metastasis.
  • the present invention is a.
  • d) provides a method for diagnosing cancer or cancer metastasis, comprising diagnosing that cancer and cancer metastasis have occurred when the expression level of the KRS protein is increased compared to a normal control.
  • the present invention provides the use of the antibody or fragment thereof for preparing an agent for the treatment of diseases related to immune cell migration.
  • the present invention provides the use of the antibody or fragment thereof for preparing a preparation for the diagnosis of diseases related to immune cell migration.
  • the present invention provides a method for the treatment of diseases related to immune cell migration, characterized in that an effective amount of a composition comprising the antibody or fragment thereof is administered to an individual in need thereof.
  • the present invention is a.
  • the present invention provides a method for diagnosing and treating cancer and cancer metastasis comprising the following steps:
  • the present invention provides a method of diagnosing and treating immune cell migration related diseases comprising the following steps:
  • the step e) is a step of performing treatment of the disease through means, such as administration of a therapeutic drug or surgery, to the individual diagnosed with the disease in step d).
  • the 'treatment' of the present invention broadly refers to improving the symptoms of cancer and cancer metastasis or immune cell migration related diseases, which heal, substantially prevent, or substantially prevent cancer and cancer metastasis or immune cell migration related diseases, or It may include improving the condition, including, but not limited to, alleviating, healing or preventing one symptom or most symptoms resulting from the disease.
  • the therapeutic drug is not particularly limited as long as it is a type of drug that is commonly used for the treatment of cancer, cancer metastasis, or immune cell migration-related diseases, and in one embodiment, an anti-cancer agent, an anti-inflammatory agent (a steroid, for example), and Pulmonary arterial hypertension may be one or more drugs selected from the group consisting of therapeutic agents, but is not limited thereto.
  • the therapeutic drug is administered to an individual in a 'therapeutically effective amount', and the therapeutically effective amount is determined by the person skilled in the art as well as the patient's age, weight, health status, sex, and disease
  • the effective dosage for a patient can be determined by considering various factors such as severity, diet and excretion rate.
  • the route of administration of the therapeutic drug is not particularly limited, and may be administered orally or parenterally, and includes both local and systemic routes.
  • the parenteral administration is not limited thereto, but may be, for example, intranasal drug application, subcutaneous injection, etc., and as another example, intramuscular injection or intravenous injection.
  • the term 'comprising' of the present invention is used in the same way as 'containing' or 'as a feature', and does not exclude additional component elements or method steps not mentioned in the composition or method. .
  • the term 'consisting of' means excluding additional elements, steps or ingredients, which are not described separately.
  • the term 'consisting essentially of' means that in the scope of the composition or method, it includes the component elements or steps described, as well as component elements or steps that do not materially affect its basic properties.
  • the present invention provides an antibody that has a specific CDR (complementarity determining region) sequence described herein and specifically binds to the KRS N-terminal region exposed to the outer cell membrane.
  • the method of the present invention can be usefully used to prepare antibodies having a higher affinity for the KRS N-terminus than conventional antibodies.
  • VH heavy chain variable region
  • VL light chain variable region
  • Figure 2a is a flow cytometry (FACS) of the binding ability analyzed with the KRS (1-72) peptide bound with 10 nM, 1 nM or 0.1 nM GST for each step-expressing library-expressing yeast selected using FACS (Fluorescence Activated Cell Sorting) ).
  • FACS Fluorescence Activated Cell Sorting
  • Figure 2b shows the results of analyzing the binding ability of the KRS (1-72) peptide and 0.1 nM GST bound to yeast expressing 47 individual clones of each of the final selected library with a flow cytometer.
  • 3A and 3B show the affinity of the NRS-1 antibody, N3-3 antibody, N3-4 antibody and N3-5 antibody to the N-terminus of the KRS, selected as having high affinity and specificity for the KRS (1-72) peptide. It shows the results of ELISA for measuring the degree.
  • Figure 4 shows the results confirming the cell migration inhibitory effect of the N3 antibody and N3-1 antibody.
  • Figure 5 shows the results of comparing the KRS affinity of N3 antibody and N3-1 antibody by SPR (surface plasmon resonance) method.
  • FIG. 6 is a flow cytometer analyzing the binding ability analyzed with KRS (1-72) peptide bound with 10 nM, 1 nM or 0.1 nM GST for each step-expressing yeast expressed by MACS and FACS (Fluorescence Activated Cell Sorting). (FACS) shows the results of the analysis.
  • Figure 7 shows the ELISA results for measuring the affinity of the NRS-1 antibody, N3-6 antibody, N3-7 antibody, N3-8 antibody, and N3-9 antibody for the N-terminus of KRS.
  • Figure 8 shows the results of comparing the KRS affinity of the N3-6 antibody, N3-7 antibody, N3-8 antibody, and N3-9 antibody by SPR (surface plasmon resonance) method.
  • Figure 9 shows the results confirming the N3 antibody, N3-1 antibody, N3-6 antibody, N3-7 antibody, N3-8 antibody, N3-9 antibody cell migration inhibitory effect.
  • Figure 10 shows the results of confirming the endocytosis (endocytosis) in breast cancer cells by N3 antibody and N3-8 antibody by IMM (immunohistochemistry) method.
  • RVESP right ventricular end-systolic pressure
  • PAH pulmonary arterial hypertension
  • FIG. 13 shows the results confirming that the increased total immune cell number in BALF (Bronchoalveolar lavage fluid) of the acute lung injury mouse model is decreased depending on the treatment concentration of the N3 antibody (KRS N-terminal binding antibody).
  • Figure 14 shows the results confirming that the concentration of neutrophils (neutrophils), which is particularly high in BALF (Bronchoalveolar lavage fluid), in the acute lung injury mouse model, is decreased depending on the treatment concentration of the N3 antibody (KRS N-terminal binding antibody).
  • FIG. 15 shows by FACS that increased macrophage (IM, CD11b + / F4 / 80 +) migration and infiltration in the lung tissue of the acute lung injury mouse model is reduced in a concentration-dependent manner of the N3 antibody (KRS N-terminal binding antibody). It shows the confirmed result.
  • FIG. 16 is a graph showing the results obtained by quantifying the results of FIG. 15.
  • FIG. 17 is a tissue image showing that tissue fibrosis progressed in the lung tissue of the acute lung injury mouse model is inhibited by the treatment of the N3 antibody (KRS N-terminal binding antibody).
  • the tissues of each experimental group and control group were observed under a microscope after Masson's trichrome staining treatment.
  • the affinity of the antibody N3 (Application No. 10-2018-0035446) targeting the N-terminus of the existing KRS to the N-terminus is about 150 nM, which is lower than that of various antibodies in the complete IgG form.
  • the light chain variable region and the heavy chain variable region of the N3 antibody were improved to increase the affinity to produce an antibody with better effect.
  • N3 The rough structure of N3 was predicted using the Homology model, and through this, a random mutation was introduced into the CDR region predicted to play an important role in antigen binding.
  • NNK which is a degenerated codon that can contain all 20 amino acid sequences
  • NNK a degenerated codon capable of containing all 20 amino acid sequences
  • the DNA encoding the designed library was amplified using a PCR technique and then concentrated using an ethanol precipitation method.
  • the yeast surface expression vector (C-aga2) in which aga2 protein is expressed at the C-terminus for homologous recombination is treated with NheI and MluI restriction enzymes, and purified using ethanol precipitation and agarose gel extraction. And concentrated.
  • Restriction enzyme-treated 4 ⁇ g vector for 12 ⁇ g of each library-coding DNA was transformed by electroporation into yeast EBY100 for yeast surface expression, and selective medium SD-CAA (20 g / L Glucose) through serial dilution , 6.7 g / L Yeast nitrogen base without amino acids, 5.4 g / L Na 2 HPO 4 , 8.6 g / L NaH 2 PO 4 , 5 g / L casamino acids), and the library size was measured. .
  • Example 2 Two types of N3-based affinity improvement libraries constructed in Example 1 were selected using GST-coupled KRS (1-72) peptide as an antigen.
  • KRS (1-72) peptide coupled with purified GST at a level of 10 nM was SG-CAA (20 g / L Galactose, 6.7 g / L Yeast nitrogen base without amino acids, 5.4 g) / L Na 2 HPO 4 , 8.6 g / L NaH 2 PO 4 , 5 g / L casamino acids) at room temperature and yeast inducing single chain Fab (scFab) type light chain variable region library expression on the cell surface The reaction was carried out for 1 hour.
  • the CDR sequences of the light chain variable region and the heavy chain variable region of four individual clones showing high binding capacity to the KRS (1-72) peptide bound to GST are shown in Table 1, and the heavy chain variable region sequences and light chain variable region sequences are shown in Table 2 It is shown in.
  • the N-terminal portion of the KRS (1-72) was bound to a 96-well EIA / RIA plate (COSTAR Corning) at 25 ° C. for 1 hour, followed by PBS (pH 7.4, 137 mM NaCl, 12 mM phosphate, 2.7 mM) KCl) (SIGMA) and wash 3 times for 10 minutes. Then, 4% BSA PBS (4% Bovine Serum Albumin, pH7.4, 137 mM NaCl, 12 mM phosphate, 2.7 mM KCl) (SIGMA) was combined for 1 hour, and then washed 3 times with PBS for 10 minutes.
  • PBS pH 7.4, 137 mM NaCl, 12 mM phosphate, 2.7 mM KCl
  • SIGMA Bovine Serum Albumin
  • the cells are washed three times with 0.1% PBST for 10 minutes.
  • HRP-conjugated anti-human antibody Horseradish peroxidase-conjugated anti-human mAb
  • TMB 3,3 ', 5,5'-Tetramethylbenzidine
  • the N3-1 antibody was converted to an IgG antibody using a conventional method.
  • the following experiment was conducted using the converted IgG antibody.
  • the SPR experiment was conducted using a Biacore T200 (GE Healthcare) equipped with a Series S sensor chip CM5 (GE Healthcare) at 25 ° C. After the antibody was immobilized on a chip using an amine coupling kit (GE Healthcare), the antigen was diluted 4 times in PBS solution in the range of 4.8 nM-1250 nM and flowed for 60 seconds. Thereafter, PBS was flowed for 300 seconds. The obtained data was analyzed with Biacore T200 Evaluation software v2.0 (GE Healthcare).
  • the KD value of the N3-1 antibody was measured to be 31 nM, it was confirmed that the binding force to the KRS protein is increased than the N3 antibody.
  • N3-1, N3-3, N3-4, and N3-5 antibodies targeting the N-terminus of KRS derived in Example 2 have similar affinity to KRS, as shown in the results of N3-1 antibody , It is believed to have an affinity of about 31 nM level. This is still low compared to the affinity of the various antibodies in full IgG form. In order to increase this and obtain a more effective antibody, the heavy chain variable region of the antibody was intensively improved.
  • the light chain variable region sequence was fixed with N3-3 and homology modeling was used to predict the approximate modeling structure of N3-3, and through this, a random mutation was introduced into the CDR predicted to play an important role in antigen binding.
  • NNK a degenerated codon capable of containing all 20 amino acid sequences, was used for the residues of CDR2 and CDR3 of the heavy chain variable region, and a library was constructed in the same manner as in Example 1.
  • N3-3 based affinity improvement libraries constructed in Example 4 Two types of N3-3 based affinity improvement libraries constructed in Example 4 were selected using GST-coupled KRS (1-72) peptide as an antigen. Since the affinity of N3-3 and N3-1 was judged to be almost the same and the sequence was almost similar, the antibody comparison experiment was conducted with N3-1.
  • yeast expressing the library bound with the GTP-coupled KRS (1-72) peptide was reacted with Streptavidin Microbead TM (Miltenyi Biotec) at 4 ° C. for 20 minutes, and then MACS (magnetic activated cell sorting) ) was used to float yeast expressing a heavy chain variable region with high affinity to GTP-coupled KRS (1-72) peptide.
  • Streptavidin Microbead TM Miltenyi Biotec
  • the yeast expressing the selected library was SG-CAA (20 g / L Galactose, 6.7 g / L Yeast nitrogen base without amino acids, 5.4 g / L Na 2 HPO 4 , 8.6 g / L NaH 2 PO 4 , 5 g / L casamino acids) medium to induce library expression. next. It was screened by FACS in the same manner as in Example 2.
  • the CDR sequences of the light chain variable region and the heavy chain variable region of four individual clones showing high binding capacity to the KRS (1-72) peptide bound to GST are shown in Table 3, and the heavy chain variable region sequence and light chain variable region sequence are shown in Table 4 It is shown in.
  • ELISA was performed in the same manner as in Example 2 to measure the affinity of KRS for the N-terminus to confirm that the affinity for the N-terminus of KRS was increased.
  • the N-terminal portion of the KRS (1-72) was bound to a 96-well EIA / RIA plate (COSTAR Corning) at 25 ° C for 1 hour, and then washed 3 times with PBS for 10 minutes. Thereafter, the mixture was bound with 4% BSA PBS for 1 hour, and then washed 3 times with PBS for 10 minutes. Then, after binding the KRS N-terminal target antibodies N3-1, N3-6, N3-7, N3-8, and N3-9 in the form of IgG, washed three times for 10 minutes with 0.1% PBST. HRP-conjugated anti-human antibody was used, reacted with TMB (3,3 ', 5,5'-Tetramethylbenzidine), and measured at 450 nm absorbance.
  • TMB 3,3 ', 5,5'-Tetramethylbenzidine
  • KRS epitope peptide F4 (EPKLSKNELKRRLKAEKKVAEKEAKQKE: SEQ ID NO: 117) as an antigen epitope
  • the binding ability of N3, N3-6, N3-7, N3-8, and N3-9 antibodies was analyzed through Surface Plasmon Resonance (SPR) .
  • SPR Surface Plasmon Resonance
  • the SPR experiment was carried out in the same manner as in 3-2 in the above embodiment, and the epitope was diluted in PBS solution, diluted twice in the range of 15.7 nM-4000 nM, and flowed for 90 seconds. Thereafter, PBS was flowed for 2400 seconds.
  • the obtained data was analyzed with Biacore T200 Evaluation software v2.0 (GE Healthcare).
  • the KD of the N3-8 antibody was the best, and the N3-9 and N3-6 antibodies showed similar KD values, and the KD value of the N3-7 antibody was the largest. .
  • N3-6 antibody dissociation was longer than N3-7 and N3-9, and showed a sensorgram with longer binding.
  • ELISA was performed to identify residues that are important for antibody epitope binding using peptides in which a single amino acid of KRS epitope peptide F4 (SEQ ID NO: 117) was substituted with alanine (A), respectively. Did. As a result, residues that are important in binding to each antibody can be identified in KRS epitope peptide F4.
  • Example 3-1 The experiment was conducted in the same manner as in Example 3-1.
  • N3-6 prepared in the above Example.
  • N3-7, N3-8, and N3-9 antibodies were converted to IgG by conventional methods.
  • the following experiment was conducted using the converted IgG antibody.
  • N3 IgG was treated with 100 nM, N3-1, N3-6, N3-7, N3-8 and N3-9 IgG, human mock IgG ( Control) were treated in the chamber at 10 nM, respectively, and cultured for 24 hours.
  • Non-migrating cells present above the membrane were removed with a cotton swab.
  • the Hematoxylin solution was treated for 30 minutes.
  • the chamber was washed with DW, and the membrane in the chamber was mounted on a slide glass and observed.
  • N3-6, N3-7, N3-8, and N3-9 antibodies significantly inhibit cell migration compared to the N3-1 antibody.
  • the N3-6, N3-7, N3-8, and N3-9 antibodies there was no significant difference in cell migration inhibitory effect.
  • N3-8 antibody sequence mutations were induced in sequences predicted to affect stability.
  • two additional heavy chain sequences in which mutations were introduced into the heavy chain sequence (HC) of the N3-8 antibody were obtained.
  • three additional light chain sequences into which mutations were introduced could be obtained. Accordingly, the seven antibody sequences (N3-8 derivatives) of which the sequence of N3-8 has been changed are shown in Tables 5 and 6 below.
  • the vector expressing the N3-8 antibody derivative obtained in Example 7-1 was expressed and purified using transient transfection.
  • HEK293-F cells Invitrogen
  • serum-free FreeStyle 293 expression medium Invitrogen
  • PEI Polyethylenimine
  • HEK293-F cells Upon 200 mL transfection in a shake flask (Corning), HEK293-F cells were seeded in 100 ml of medium at a density of 2 X 10 6 cells / ml, and cultured at 150 rpm, 8% CO 2, 37 ° C.
  • suitable heavy and light chain plasmids were transfected in a ratio of heavy chain: light chain DNA 1: 1 or 1: 2 in 10ml FreeStyle 293 expression medium (Invitrogen).
  • 1: 1 1, 125 ⁇ g of heavy chain and 125 ⁇ g of light chain were diluted to a total of 250 ⁇ g (2.5 ⁇ g / ml), 750 ⁇ g (7.5 ⁇ g / ml) of PEI was mixed with 10 ml of diluted medium and reacted at room temperature for 10 minutes.
  • the concentration of the light chain DNA was doubled.
  • the reacted mixed medium was put into cells seeded with 100 ml before, 150 rpm for 4 hours, 8% CO 2 , After incubation at 37 ° C, the remaining 100 ml of FreeStyle 293 expression medium was added and cultured for 6 days.
  • the cell culture solution was transferred to 50 ml tubes and centrifuged for 5 minutes at 3000 rpm. Protein was then purified from the collected cell culture supernatant. Antibodies were applied to Protein A Sepharose column and washed with PBS (pH 7.4). After eluting the antibody at pH 3.0 with 0.1 M glycine buffer, the sample was immediately neutralized with 1 M Tris buffer. The eluted antibody fraction was concentrated by exchanging buffer with PBS (pH 7.4) through a dialysis method. The purified protein was quantified using absorbance and absorption coefficient at a wavelength of 280 nm.
  • the thermal stability of the antibody was measured using 100 ⁇ l of the purified antibody at a concentration of 1 mg / ml.
  • Protein thermal shift Dye kit (Thermofisher) was performed 4 times with Quant Studio 3 Real-time PCR equipment (Thermofisher).
  • the N3-8 antibody derivatives had higher yield and improved thermal stability than the N3-8 antibody.
  • Table 8 shows the heavy chain (HC) and light chain (LC) sequence of the entire IgG antibodies used in the above examples.
  • the N3-8-1 antibody showed the best KD.
  • Anti-KRS antibodies (N3, N3-8) labeled with Alexa fluor 488 (Thermofisher) fluorescent probe and 1 ⁇ M of control Mock IgG (Thermofisher) as a control group were treated, and the movement of the antibody was monitored after 4 hours.
  • Lysotracker (Thermofisher) was used as a lysosome marker to confirm whether or not endocytosis, and DAPI indicates cell nuclear staining. Unlike Mock, it can be confirmed that N3 and N3-8 antibodies were present in the cells at 4 hours.
  • the anti-KRS antibody recognizes the cell membrane KRS and is rapidly endocytosed, thereby lowering the cell membrane KRS level.
  • the vector expressing the mutant antibody having the ADCC / CDC function of the N3-8-1 antibody removed was subjected to transient transfection. Proteins were expressed and purified.
  • HEK293-F cells Invitrogen were transfected. Then, HEK293-F cells were seeded in a medium at a density of 2 X 10 6 cells / ml, and cultured at 150 rpm, 8% CO 2, 37 ° C.
  • suitable heavy and light chain plasmids were transfected in a ratio of heavy chain: light chain DNA 1: 1 or 1: 2 in 10ml FreeStyle 293 expression medium (Invitrogen).
  • 1: 1 1, 125 ⁇ g of heavy chain and 125 ⁇ g of light chain were diluted to a total of 250 ⁇ g (2.5 ⁇ g / ml), 750 ⁇ g (7.5 ⁇ g / ml) of PEI was mixed with 10 ml of diluted medium and reacted at room temperature for 10 minutes.
  • the concentration of the light chain DNA was doubled.
  • the reacted mixed medium was put in cells seeded with 100 ml before, 150 rpm for 4 hours, 8% CO 2 , After incubation at 37 ° C, the remaining 100 ml of FreeStyle 293 expression medium was added and cultured for 6 days.
  • the cell culture solution was transferred to 50 ml tubes and centrifuged for 5 minutes at 3000 rpm. Protein was then purified from the collected cell culture supernatant. Antibodies were applied to Protein A Sepharose column and washed with PBS (pH 7.4). After eluting the antibody at pH 3.0 with 0.1 M glycine buffer, the sample was immediately neutralized with 1 M Tris buffer. The eluted antibody fraction was concentrated by exchanging buffer with PBS (pH 7.4) through a dialysis method. The purified protein was quantified using absorbance and absorption coefficient at a wavelength of 280 nm.
  • the Purity of the purified antibody was measured and repeated 4 times with a Quant Studio 3 Real-time PCR instrument (Thermofisher) using a Protein thermal shift Dye kit (Thermofisher).
  • Example 10 KRS Immune cell migration-related disease of -N term specific binding antibody in vivo Efficacy check in model_ in vivo Pulmonary arterial hypertension model
  • the KRS N-term specific antibody of the present invention (typically N3 antibody) will show a therapeutic effect on immune cell migration-related diseases, which was further proved through the examples described below.
  • PAH Pulmonary arterial hypertension
  • MCT monocrotaline
  • N3 IgG antibody 1mpk N3 IgG antibody 10mpk
  • sildenafil positive control 25 mpk administered for 3 weeks
  • All antibodies were injected iv twice a week and sildenafil was orally administered daily.
  • rats were anesthetized with isoflurane, and blood flow and pressure were measured using an animal ultra-precision pneumatic measurement system (MPVS Cardiovascular Pressure and Volume system, Model: MPVS Ultra, Manufacturer: Millar Instruments).
  • RVESP Right ventricular systolic pressure
  • diastolic pressure left ventricular systolic and diastolic pressure are dedicated catheter (Mikro-Tip) rat pressure catheter, manufacturer: Millar Instruments).
  • Cardiac output is perivascular blood flow probe (Transonic) Flowprobes, manufactured by: Millar Instruments), and the experimental technique for this was performed in the same manner as described in the following documents: Pacher P, Nagayama T, Mukhopadhyay P, Batkai S, Kass DA. Measurement of cardiac function using pressure-volume conductance catheter technique in mice and rats. Nat Protoc 2008; 3 (9): 1422-34.
  • the collected lungs were fixed in paraformaldehyde (PFA) according to a conventional procedure, and then washed with water, dehydrated, and transparently infiltrated and paraffin penetrated.
  • the paraffin block of rat tissue was sliced to a thickness of 3 ⁇ m and a slide was prepared. Then, staining was performed as follows. First, after treating xylene 3 times for 5 minutes, 100% ethanol, 95% ethanol, 90% ethanol, 70% ethanol, and DW were treated for 2 minutes, followed by washing with PBS for 5 minutes. After treatment with 0.3% H 2 O 2 , the samples were washed twice with PBS for 5 minutes.
  • the stained tissue was treated with Mayer's hematoxylin (Sigma) for 1 minute, and then treated twice in each order of 70% ethanol, 90% ethanol, 95% ethanol, and 100% ethanol for 2 minutes. Finally, after xylene treatment 3 times for 5 minutes, it was observed with an optical microscope.
  • RVESP right ventricular end-systolic pressure
  • RVVEDP right ventricular end-diastolic pressure
  • LVESP left ventricular end-systolic pressure
  • CO cardiac output
  • Pulmonary arterial hypertension increases the right ventricular pressure due to the narrowing of the pulmonary artery, resulting in right ventricular failure.
  • the compensatory mechanism is destroyed by persistent hypertension, right ventricular hypertrophy and right ventricular dilatation occur. This is led to the left ventricular pressure due to movement of the ventricular septum is led to a reduction in the expansion end volume and cardiac output of the left ventricle (yiwooseok et al., Clinical characteristics and outcome prediction in severe pulmonary hypertension factor, Korean Circulation J 2007; 37 : 265-270 ). Consequently, pulmonary arterial hypertension is primarily associated with the right ventricle, but also with the function of the left ventricle.
  • RVESP is increased in PAH patients, which has also been confirmed in the PAH animal model of this experiment.
  • N3 antibody KRS-N term specific binding antibody
  • LVESP left ventricular systolic pressure
  • the N3 antibody of the present invention shows a low tendency to have an effect on systemic artery pressure compared to Sildenafil, and this effect has a situation in which the risk of hypotension occurs when Sildenafil is administered in a clinical field.
  • severe pulmonary arterial hypertension may be accompanied by low cardiac output and systemic hypotension, as systolic RV failure occurs.
  • the cardiac output and systemic blood pressure are increased by the treatment of improving pulmonary arterial hypertension by the N3 antibody of the present invention, and the effect of normalizing blood pressure is expected.
  • Example 11 KRS Immune cell migration-related disease of -N term specific binding antibody in vivo Efficacy check in model _ Acute lung injury model
  • the acute lung injury model was constructed by injecting 2.5 mg / kg of LPS (Sigma) into the trachea in a 7-week-old male C57BL / 6 mouse (Dooyeol Bio).
  • the BALF obtained by washing the lungs with PBS was collected and centrifuged at 4 ° C for 10 minutes at 800 x g to collect pellets. After floating the cells, red blood cells were removed using RBC lysis buffer (eBioscience cat.no.00-4333-57). Thereafter, the reaction was stopped with PBS, washed twice, and suspended in 400 ⁇ l PBS to measure the cell number with a hemocytometer and neutrophil number through Hema3 staining.
  • the lung tissue was collected and crushed by rotating it at 37 ° C for 45 minutes using gentleMACS Octo Dissociator (MACS Miltenyi Biotec, Order no.130-095-937) equipment. After filtering using a cell strainer (40 ⁇ m), centrifugation was performed at 1500 rpm for 5 minutes at room temperature. Pellet was collected and red blood cells were removed using RBC lysis buffer (eBioscience cat.no.00-4333-57). The cells were collected, suspended in FACS buffer (PBS containing 1% NaN3 and 3% FBS), and then put 50 ⁇ l in a tube, mixed well with the same amount of antibody mxiture, and stained by blocking light for 1 hour at 4 ° C.
  • FACS buffer PBS containing 1% NaN3 and 3% FBS
  • FITC Rat Anti-CD11b (BD Pharmingen) and PE Rat Anti-Mouse F4 / 80 (BD Pharmingen) antibodies were used. After washing twice at 400 x g for 5 minutes using FACS buffer, it was analyzed with a Navios Flow Cytometer (Beckman) instrument.
  • the lung tissue was paraffin-embedded in a conventional manner, and then cut off. After that, the tissue slide from which paraffin was removed using xylene was washed with DW, and then treated with Bouin Fluid at 56-60 ° C for 1 hour. It was dyed for 10 minutes with Weigert's iron hematoxylin solution, then washed, and then stained with Biebrich scarlet-acid fuchsin solution for 10-15 minutes and then washed. Phosphomolybdic-phosphotungstic acid solution was treated for 10-15 minutes, transferred to an aniline blue solution, and stained for 5-10 minutes. After washing, treated with 1% acetic acid solution for 2-5 minutes. After washing and dehydration, xylene treatment was performed to mount.
  • Interstitial macrophage is a CD11b + / F4 / 80 + cell that is not resident in the lung and migrates to the lung in certain situations (migrating macrophages).
  • LPS treatment increased the infiltration of IM into the lungs, but N3 antibody treatment decreased concentration-dependent migration of IM into the lungs.
  • N3 antibody treatment decreased concentration-dependent migration of IM into the lungs.
  • the migration and infiltration of immune cells such as macrophages / monocytes into the lung tissue is an important pathological phenomenon in tissue fibrotic diseases.
  • tissue fibrotic diseases As a result of observing the lung tissue by Masson's trichrome staining for the acute lung injury model (FIG. 17), it was confirmed that fibrosis in the lung tissue progressed significantly, and for this, an N3 antibody (an antibody that specifically binds to KRS N-term) The treatment confirmed that this fibrosis was suppressed.
  • Example 12 Analysis of immune cell migration of mutant antibodies without ADCC / CDC function
  • a transwell chamber with a polycarbonate membrane (5.0 ⁇ m pore size, Costar).
  • LN421 was added to a lower chamber at a concentration of 2.5 ⁇ g / ml.
  • RAW264.7 cells were then placed in the upper chamber at a concentration of 5 x 10 4 cells per well.
  • each antibody was put in the chamber at a concentration of 10M, and then cultured for 24 hours.
  • the cells were washed twice with PBS, and the transferred cells were stained with crystal violet (Sigma) and dried.
  • the upper chamber was placed in 33% acetic acid (Merck) and stirred for 10 minutes.
  • the acetic acid solution in which the crystal violet was dissolved was transferred to a 96-well plate and absorbance was measured at 590 nm in a microplate reader (Tecan).
  • N3-8, N3-8-1, N3-8-1 mutant LALA, N3-8-1 mutant LALATA, N3-8-1 mutant LALAPG, N3-8-1 mutant LALAPGTA It was shown that the antibodies inhibited cell migration by LN421 to a level similar to that of the control (Control, C), which did not process anything.
  • N3-8, N3-8-1, N3-8-1 mutant LALA, N3-8-1 mutant LALATA, N3-8-1 mutant LALAPG, and N3-8-1 mutant LALAPGTA antibodies were each 10 nM in the chamber. And cultured for 7 hours. The non-migrating cells present on the membrane were removed with a cotton swab, washed twice with PBS, and treated with 70% MeOH (in PBS) for 30 minutes. Again washed twice with PBS, stained with crystal violet (SIgma), and dried. Then, the upper chamber was stirred in 33% acetic acid (Merck) and stirred. The acetic acid solution in which the crystal violet was dissolved was transferred to a 96-well plate and absorbance was measured at 590 nm in a microplate reader (Tecan).
  • N3-8, N3-8-1, N3-8-1 mutant LALA, N3-8-1 mutant LALATA, N3-8-1 mutant LALAPG, N3-8-1 mutant LALAPGTA It has been shown that all antibodies inhibit cancer cell migration by laminin.
  • the antibodies or fragments of the present invention have a specific CDR (complementarity determining region) sequence described herein, and have a very good specific binding ability and affinity to the KRS N-terminal region exposed to the outer cell membrane. Therefore, it is available for diagnosis of diseases involving specific behaviors of KRS, such as cancer or immune cell migration-related diseases, and is excellent in productivity and stability, and has excellent cancer metastasis suppression effect, so it is a cancer treatment, cancer metastasis prevention or inhibitor As it can be usefully used, it can be very useful in the prevention, improvement and treatment of diseases related to immune cell migration.
  • CDR complementarity determining region

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Organic Chemistry (AREA)
  • Cell Biology (AREA)
  • Biochemistry (AREA)
  • Oncology (AREA)
  • Food Science & Technology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Biotechnology (AREA)
  • Hospice & Palliative Care (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

본 발명은 세포 외막에 노출되는 라이실-tRNA 합성효소 N-말단 영역에 특이적으로 결합하는 항체에 관한 것으로, 보다 상세하게는 본 명세서에서 기재하는 특정 CDR(상보성 결정부위) 서열을 가지는 세포 외막에 노출되는 라이실-tRNA 합성효소(KRS, Lysyl-tRNA synthetase) N-말단 영역에 특이적으로 결합하는 항체 또는 그 단편 및 상기 항체 또는 그 단편을 유효성분으로 포함하는 조성물의 암, 암전이 또는 면역세포 이동 관련 질환의 예방, 치료 또는 진단의 용도에 관한 것이다. 본 발명의 방법은 기존의 항체보다 KRS N-말단에 친화도가 높은 항체를 제조하는 데에 유용하게 이용될 수 있다.

Description

세포 외막에 노출되는 라이실-tRNA 합성효소 N-말단 영역에 특이적으로 결합하는 항체
본 출원은 2018년 9월 17일에 출원된 대한민국 특허출원 제10-2018-0111046호를 우선권으로 주장하고, 상기 명세서 전체는 본 출원의 참고문헌이다.
본 발명은 세포 외막에 노출되는 라이실-tRNA 합성효소 N-말단 영역에 특이적으로 결합하는 항체에 관한 것으로, 보다 상세하게는 본 명세서에서 기재하는 특정 CDR(상보성 결정부위) 서열을 가지는 세포 외막에 노출되는 라이실-tRNA 합성효소(KRS, Lysyl-tRNA synthetase) N-말단 영역에 특이적으로 결합하며, 친화도 및 안정성이 높은 항체 또는 그 단편 및 상기 항체 또는 그 단편을 유효성분으로 포함하는 조성물의 암, 암전이 또는 면역세포 이동 관련 질환의 예방, 치료 또는 진단의 용도에 관한 것이다.
최근 연구를 통해 일반적으로 세포질(cytosol)에 존재하는 인간 KRS(라이실-tRNA 합성효소, lysyl-tRNA synthetase)가 원형질막(세포막)으로 이동(translocation)되어 원형질 막에 존재하는 67LR(67-kDa 라미닌 수용체)과 상호작용함으로써 종양(또는 암) 세포의 이동을 촉진하여 암의 전이(metastasis)에 영향을 미친다는 것이 규명되었다(Dae Gyu Kim et al., Chemical inhibition of prometastatic lysyl-tRNA synthetase-laminin receptor interaction, Nat Chem Biol. 2014 Jan; 10(1): 29-34, Dae Gye Kim et. al. Interaction of two translational components, lysyl-tRNA synthetase and p40/37LRP, in plasma membrane promotes laminin-dependent cell migration, FASEB J. (2012)26, 4142-4159). 인간 KRS(Genbank Accession No . NP_005539.1 등)는 N-말단 연장 (N-terminal extension, 1-72), 안티코돈 결합 도메인(anticodon-binding domain, 73-209) 및 촉매 도메인 (catalytic domain, 220-597)을 포함한다. 인간 KRS는 단백질 합성에 필수적인 효소이며 일반적으로 세포질에서 다중 tRNA 합성효소 복합체 (multi-tRNA synthetase complex, MSC) 내에 존재한다. 그러나 라미닌(laminin) 신호 후, p38 MAPK는 T52 잔기에서 KRS를 인산화시키고, KRS는 세포막으로 이동하여 유비퀴틴 매개 분해로부터 67LR을 보호한다. 또한 세포막으로 이동된 KRS 는 암전이와 관련된 67LR을 안정화시키고 이와 상호작용을 함으로서 암전이(cancer metastasis)를 촉진한다고 보고되었다.
이때, N-terminal extension(N-ext)의 말단 잔기 40개가 결실 된 Myc-KRS41-597(ΔN)이 원형질막에 위치(localize)되지 않는 다는 사실은 KRS N-ext 영역이 KRS가 세포막으로 이동(translocation) 하는데 있어서 필수적인 영역임을 나타낸다. 또한 암 전이와 관련하여, 67LR과의 상호작용에 있어서 구체적으로 KRS N-ext 영역이 이들의 결합에 관여함이 알려졌다. 이러한 사실을 치료 또는 진단 목적으로 이용하기 위해서는, KRS 단백질을 이루는 여러 도메인 영역의 특성에 따라서 단백질 내의 목적하는 특정 위치(특히 KRS N-ext)를 특이적으로 타겟팅(targeting)하는 것이 필요한 실정이다. 이에 본 발명자들은 ARS에도 결합하는 교차 반응을 보이지 않는 KRS N-말단에 특이적으로 결합하는 항체(대한민국 특허 출원번호: 10-2018-0035446)를 제작하였다.
그러나 기존의 KRS N-말단을 표적으로 하는 항체의 친화도가 완전한 IgG 형태의 다양한 항체들의 친화도에 비해 낮은 수준이다. 따라서, KRS N-말단에 더 높은 친화도를 갖는 항체를 제작할 필요가 있다.
이에 본 발명자들은 기존의 세포 외막에 노출되는 KRS N-말단 영역에 특이적으로 결합하는 항체보다 KRS N-말단 영역에 대한 결합친화력이 더 좋은 항체를 제작하기 위하여, 기존의 항체 경쇄가변영역과 중쇄가변영역을 변형하여 본 발명을 완성하였다.
따라서 본 발명의 목적은
(a) (i) 아미노산 서열 SYDMS를 포함하는 중쇄 상보성 결정부위 1(CDR1);
(ii) 아미노산 서열 X 1IX 2X 3X 4X 5GX 6X 7YYADSVKG를 포함하고, 여기서 X 1은 A 또는 V이고, X 2은 S, D 또는 G이고, X 3는 Y, P, S 또는 A 이고, X 4는 D, Q, L 또는 Y이고, X 5는 N, M, S, 또는 G이고, X 6는 N, R 또는 P이고, X 7는 T, V, I 또는 S인 중쇄 상보성 결정부위 2(CDR2); 및
(iii) 아미노산 서열 X 8ALDFDY를 포함하고, 여기서 X 8은 M 또는 L인 중쇄 상보성 결정부위 3(CDR3)를 포함하는 중쇄가변영역(VH) 및
(b) (i) 아미노산 서열 TGSSSNIGSNYVT를 포함하는 경쇄 상보성 결정부위 1(CDR1);
(ii) 아미노산 서열 X 9NX 10X 11RPS를 포함하고, 여기서 X 9는 D, S 또는 R이고, X 10은 S 또는 N이고, X 11은 N 또는 Q인 경쇄 상보성 결정부위 2(CDR2); 및
(iii) 아미노산 서열 X 12SFSDELGAYV를 포함하고, 여기서 X 12은 A 또는 S인 경쇄 상보성 결정부위 3(CDR3)를 포함하는 경쇄가변영역(VL)
을 포함하는, 세포 외막에 노출되는 라이실-tRNA 합성효소(KRS, Lysyl-tRNA synthetase) N-말단 영역에 특이적으로 결합하는 항체 또는 그 단편을 제공하는 것이다.
본 발명의 다른 목적은 항체 또는 그 단편을 암호화 하는 폴리뉴클레오티드, 이를 포함하는 재조합 발현 벡터, 상기 벡터로 형질전환된 세포를 제공하는 것이다.
본 발명의 또 다른 목적은
(a) 상기 재조합 발현 벡터로 숙주 세포를 형질전환하는 단계;
(b) 형질전환된 숙주 세포를 배양하여 항체 또는 그 단편을 생산하는 단계; 및
(c) 숙주 세포에서 생산된 항체 또는 그 단편을 수득하는 단계를 포함하는, 세포 외막에 노출되는 라이실-tRNA 합성효소(KRS, Lysyl-tRNA synthetase) N-말단에 특이적으로 결합하는 항체 또는 그 단편을 제조하는 방법을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 항체 또는 그 단편을 유효성분으로 포함하는 암전이 예방 또는 억제용 약학적 조성물을 제공하는 것이다.
또한, 본 발명의 또 다른 목적은 상기 항체 또는 그 단편을 유효성분으로 구성되는 암전이 예방 또는 억제용 약학적 조성물을 제공하는 것이다.
또한, 본 발명의 또 다른 목적은 상기 항체 또는 그 단편을 유효성분으로 필수적으로 구성되는 암전이 예방 또는 억제용 약학적 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 항체 또는 그 단편을 유효성분으로 포함하는 면역세포 이동 관련 질환의 예방 또는 치료용 조성물을 제공하는 것이다.
또한 본 발명의 또 다른 목적은 상기 항체 또는 그 단편을 유효성분으로 구성되는 면역세포 이동 관련 질환의 예방 또는 치료용 조성물을 제공하는 것이다.
또한, 본 발명의 또 다른 목적은 상기 항체 또는 그 단편을 유효성분으로 필수적으로 구성되는 면역세포 이동 관련 질환의 예방 또는 치료용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 항체 또는 그 단편을 유효성분으로 포함하는 면역세포 이동 관련 질환의 진단용 조성물을 제공하는 것이다.
또한, 본 발명의 또 다른 목적은 상기 항체 또는 그 단편을 유효성분으로 구성되는 면역세포 이동 관련 질환의 진단용 조성물을 제공하는 것이다.
또한, 본 발명의 또 다른 목적은 상기 항체 또는 그 단편을 유효성분으로 필수적으로 구성되는 면역세포 이동 관련 질환의 진단용 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 암 및 암 전이 예방 또는 억제용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 항체 또는 그 단편을 포함하는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 암 및 암 전이 예방 또는 억제 방법을 제공하는 것이다.
본 발명의 또 다른 목적은 암 또는 암 전이 진단용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공하는 것이다.
본 발명의 또 다른 목적은
a) 암 전이가 의심되는 개체(피검체)로부터 생물학적 시료를 수득하는 단계;
b) 상기 시료 또는 개체에 상기 항체 또는 그 단편을 포함하는 조성물을 투여하는 단계;
c) 상기 b) 단계의 시료 또는 개체에서 KRS 단백질의 발현 수준을 검출하는 단계; 및
d) 상기 KRS 단백질의 발현 수준이 정상 대조군과 비교하여, KRS 단백질의 발현 수준이 증가하는 경우에 암 및 암 전이가 발생한 것으로 진단하는 단계를 포함하는, 암 또는 암 전이 진단 방법을 제공하는 것이다.
본 발명의 또 다른 목적은 면역세포 이동 관련 질환의 치료용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공하는 것이다.
본 발병의 또 다른 목적은 상기 항체 또는 그 단편을 포함하는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 면역세포 이동 관련 질환의 치료 방법을 제공하는 것이다.
본 발명의 또 다른 목적은 면역세포 이동 관련 질환의 진단용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공하는 것이다.
본 발명의 또 다른 목적은
a) 면역세포 이동 관련 질환이 의심되는 개체로부터 생물학적 시료를 수득하는 단계;
b) 상기 시료 또는 개체에 상기 항체 또는 그 단편을 포함하는 조성물을 투여하는 단계;
c) 상기 b) 단계의 시료 또는 개체에서 KRS 단백질의 발현 수준을 검출하는 단계; 및
d) 상기 KRS 단백질의 발현 수준을 정상 대조군과 비교하여, KRS 단백질의 발현 수준이 증가하는 경우에 면역세포 이동 관련 질환인 것으로 진단하는 단계를 포함하는, 면역세포 이동 관련 질환 진단 방법을 제공하는 것이다.
상기와 같은 목적을 달성하기 위하여, 본 발명은
(a) (i) 아미노산 서열 SYDMS를 포함하는 중쇄 상보성 결정부위 1(CDR1);
(ii) 아미노산 서열 X 1IX 2X 3X 4X 5GX 6X 7YYADSVKG를 포함하고, 여기서 X 1은 A 또는 V이고, X 2은 S, D 또는 G이고, X 3는 Y, P, S 또는 A 이고, X 4는 D, Q, L 또는 Y이고, X 5는 N, M, S, 또는 G이고, X 6는 N, R 또는 P이고, X 7는 T, V, I 또는 S인 중쇄 상보성 결정부위 2(CDR2); 및
(iii) 아미노산 서열 X 8ALDFDY를 포함하고, 여기서 X 8은 M 또는 L인 중쇄 상보성 결정부위 3(CDR3)를 포함하는 중쇄가변영역(VH) 및
(b) (i) 아미노산 서열 TGSSSNIGSNYVT를 포함하는 경쇄 상보성 결정부위 1(CDR1);
(ii) 아미노산 서열 X 9NX 10X 11RPS를 포함하고, 여기서 X 9는 D, S 또는 R이고, X 10은 S 또는 N이고, X 11은 N 또는 Q인 경쇄 상보성 결정부위 2(CDR2); 및
(iii) 아미노산 서열 X 12SFSDELGAYV를 포함하고, 여기서 X 12은 A 또는 S인 경쇄 상보성 결정부위 3(CDR3)를 포함하는 경쇄가변영역(VL)
을 포함하는, 세포 외막에 노출되는 라이실-tRNA 합성효소(KRS, Lysyl-tRNA synthetase) N-말단 영역에 특이적으로 결합하는 항체 또는 그 단편을 제공한다.
본 발명의 다른 목적을 달성하기 위하여, 본 발명은 항체 또는 그 단편을 암호화 하는 폴리뉴클레오티드, 이를 포함하는 재조합 발현 벡터, 상기 벡터로 형질전환된 세포를 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은
(a) 상기 재조합 발현 벡터로 숙주 세포를 형질전환하는 단계;
(b) 형질전환된 숙주 세포를 배양하여 항체 또는 그 단편을 생산하는 단계; 및
(c) 숙주 세포에서 생산된 항체 또는 그 단편을 수득하는 단계를 포함하는, 세포 외막에 노출되는 라이실-tRNA 합성효소(KRS, Lysyl-tRNA synthetase) N-말단에 특이적으로 결합하는 항체 또는 그 단편을 제조하는 방법을 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 상기 항체 또는 그 단편을 유효성분으로 포함하는 암전이 예방 또는 억제용 약학적 조성물을 제공한다.
또한, 본 발명은 상기 항체 또는 그 단편을 유효성분으로 구성되는 암전이 예방 또는 억제용 약학적 조성물을 제공한다.
또한, 본 발명은 상기 항체 또는 그 단편을 유효성분으로 필수적으로 구성되는 암전이 예방 또는 억제용 약학적 조성물을 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 상기 항체 또는 그 단편을 유효성분으로 포함하는 면역세포 이동 관련 질환의 예방 또는 치료용 조성물을 제공한다.
또한, 본 발명은 상기 항체 또는 그 단편을 유효성분으로 구성되는 면역세포 이동 관련 질환의 예방 또는 치료용 조성물을 제공한다.
또한, 본 발명은 상기 항체 또는 그 단편을 유효성분으로 필수적으로 구성되는 면역세포 이동 관련 질환의 예방 또는 치료용 조성물을 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 상기 항체 또는 그 단편을 유효성분으로 포함하는 면역세포 이동 관련 질환의 진단용 조성물을 제공한다.
또한, 본 발명은 상기 항체 또는 그 단편을 유효성분으로 구성되는 면역세포 이동 관련 질환의 진단용 조성물을 제공한다.
또한, 본 발명은 상기 항체 또는 그 단편을 유효성분으로 필수적으로 구성되는 면역세포 이동 관련 질환의 진단용 조성물을 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 암 및 암 전이 예방 또는 억제용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 상기 항체 또는 그 단편을 포함하는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 암 및 암 전이 예방 또는 억제 방법을 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 암 또는 암 전이 진단용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은
a) 암 전이가 의심되는 개체(피검체)로부터 생물학적 시료를 수득하는 단계;
b) 상기 시료 또는 개체에 상기 항체 또는 그 단편을 포함하는 조성물을 투여하는 단계;
c) 상기 b) 단계의 시료 또는 개체에서 KRS 단백질의 발현 수준을 검출하는 단계; 및
d) 상기 KRS 단백질의 발현 수준이 정상 대조군과 비교하여, KRS 단백질의 발현 수준이 증가하는 경우에 암 및 암 전이가 발생한 것으로 진단하는 단계를 포함하는, 암 또는 암 전이 진단 방법을 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 면역세포 이동 관련 질환의 치료용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 상기 항체 또는 그 단편을 포함하는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 면역세포 이동 관련 질환의 치료 방법을 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은 면역세포 이동 관련 질환의 진단용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공한다.
본 발명의 또 다른 목적을 달성하기 위하여, 본 발명은
a) 면역세포 이동 관련 질환이 의심되는 개체로부터 생물학적 시료를 수득하는 단계;
b) 상기 시료 또는 개체에 상기 항체 또는 그 단편을 포함하는 조성물을 투여하는 단계;
c) 상기 b) 단계의 시료 또는 개체에서 KRS 단백질의 발현 수준을 검출하는 단계; 및
d) 상기 KRS 단백질의 발현 수준을 정상 대조군과 비교하여, KRS 단백질의 발현 수준이 증가하는 경우에 면역세포 이동 관련 질환인 것으로 진단하는 단계를 포함하는, 면역세포 이동 관련 질환 진단 방법을 제공한다.
이하 본 발명을 상세히 설명한다.
본 발명에서 "세포 외막에 노출되는 라이실-tRNA 합성효소(KRS) N-말단 영역" 은 세포 내에서 생성된 KRS가 이동하여 세포막(또는 원형질막)에 위치될 때 세포 외(extracellular) 영역으로 또는 세포막 표면에 노출되는 특정 서열을 의미하는 것으로서, 통상 KRS N-말단의 1 내지 72개의 아미노산 영역의 일부 또는 전장 서열을 의미하는 것일 수 있다. 또한 KRS N-말단 영역은 종간 서열유사성이 존재하며 특히 서열번호 117로 표시되는 아미노산 서열을 포함하는 것을 특징으로 할 수 있다.
본 발명에서 "KRS"는 라이실 티알엔에이 합성효소로 알려져 있는 전장(全長) 폴리펩티드 또는 N-말단 영역(N-terminal extension)을 포함하는 임의의 KRS 단편서열을 의미한다. 본 발명에 따른 항체 또는 그 단편들은 전술한 바와 같이 세포 외막에 노출되는 KRS N-말단 영역을 특이적으로 검출하므로, 전술한 KRS 전장 폴리펩타이드 또는 N-말단 영역을 포함하는 임의의 KRS 단편 서열 또한 검출할 수 있다. 상기 KRS의 구체적 서열은, 서열번호 117로 표시되는 폴리펩타이드를 포함하는 것으로서 당업계에 라이실 티알엔에이 합성 효소로서 알려진 것이라면 특별히 제한되지 않으며, 일례로 본 발명의 KRS는 인간( homo sapiens) 유래의 것으로서 NCBI(Genbank) Accession No. NP_005539.1 등으로 공지된 것을 포함하고, 마우스( Mus musculus) 유래의 것으로서 NCBI(Genbank) Accession No. NP_444322.1 등으로 공지된 것을 포함하며, 랫( Rattus norvegicus) 유래의 것으로서 NCBI(Genbank) Accession No. XP_006255692.1 등으로 공지된 것을 포함하며, 이외 에도 하기의 서열정보를 참조로 할 수 있으나 이에 제한되지 않는다: XP_005004655.1(guinea-pig: Cavia porcellus), XP_021503253.1(gerbil, Meriones unguiculatus), XP_002711778.1(rabbit, Oryctolagus cuniculus), XP_536777.2(dog, Canis lupus familiaris), XP_003126904.2(swine, Sus scrofa), XP_011755768.1(monkey, Macaca nemestrina), XP_008984479.1 (marmoset, Callithrix jacchus), XP_019834275.1 (cow, Bos indicus), XP_511115.2 (chimpanzee, Pan troglodytes). 가장 바람직하게는 NCBI(Genbank) Genbank Accession No . NP_005539.1로 공지된 것일 수 있다.
본 발명에서 '항체(antibody)'는 면역 글로불린(immunoglobulin, Ig)이라고도 불리며, 항원에 선택적으로 작용하여 생체 면역에 관여하는 단백질의 총칭이다. 자연에서 발견되는 전체 항체(whole antibody)는 일반적으로 여러 도메인으로 이루어진 폴리펩티드인 경쇄(light chain, LC) 및 중쇄(heavy chain, HC)의 2개 쌍으로 이루어지거나, 이들 HC/LC의 2개의 쌍으로 된 구조를 기본 단위로 한다. 포유류의 항체를 구성하는 중쇄의 종류는 그리스 문자 α, δ, ε, γ 및 μ로 표시되는 5가지 유형이 있으며, 중쇄의 종류에 따라 각각 IgA, IgD, IgE, IgG 및 IgM 등 다른 종류의 항체를 구성하게 된다. 포유류의 항체를 구성하는 경쇄의 종류는λ 및 κ로 표시되는 2가지 종류가 존재한다.
항체의 중쇄와 경쇄는 구조적으로 아미노산 서열의 가변성에 따라 가변영역과 불변영역으로 구분된다. 중쇄의 불변영역은 항체의 종류에 따라 CH1, CH2 및 CH3(IgA, IgD 및 IgG 항체) 및 CH4(IgE 및 IgM 항체) 등 3 또는 4개의 중쇄불변영역으로 구성되어 있으며, 경쇄는 1개의 불변영역인 CL로 구성되어 있다. 중쇄와 경쇄의 가변영역은 각각 중쇄가변영역(VH) 또는 경쇄가변영역(VL)의 하나의 도메인으로 이루어져 있다. 경쇄와 중쇄는 각각의 가변영역과 불변영역이 나란히 정렬되어 1개의 공유 이황결합(disulfide bond)에 의해 연결되고, 경쇄와 결합한 두 분자의 중쇄는 2개의 공유 이황결합을 통해 연결되어 전체 항체의 형태를 형성한다. 전체 항체는 중쇄 및 경쇄의 가변영역을 통해 항원에 특이적으로 결합하며, 전체 항체는 2개의 중쇄 및 경쇄의 쌍(HC/LC)으로 구성되어 있으므로, 한 분자의 전체 항체는 두 개의 가변영역을 통해 동일한 두 개의 항원에 결합하는 2가의 단일특이성을 갖게 된다.
항체가 항원에 결합하는 부위를 포함하는 가변영역은 서열 가변성이 적은 골격 부위(framework region, FR)와 서열 가변성이 높은 과가변성 부위(hypervariable region)인 상보성 결정부위(complementary determining region, CDR)로 세분된다. VH와 VL은 각각 3개의 CDR 및 4개의 FR이 N-말단부터 C-말단의 방향으로 FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4의 순서로 배열되어 있다. 항체의 가변영역 안에서도 서열 가변성이 가장 높은 CDR이 항원과 직접 결합하는 부위로, 항체의 항원 특이성에 가장 중요하다.
본 발명은
(a) (i) 아미노산 서열 SYDMS를 포함하는 중쇄 상보성 결정부위 1(CDR1);
(ii) 아미노산 서열 X 1IX 2X 3X 4X 5GX 6X 7YYADSVKG를 포함하고, 여기서 X 1은 A 또는 V이고, X 2은 S, D 또는 G이고, X 3는 Y, P, S 또는 A 이고, X 4는 D, Q, L 또는 Y이고, X 5는 N, M, S, 또는 G이고, X 6는 N, R 또는 P이고, X 7는 T, V, I 또는 S인 중쇄 상보성 결정부위 2(CDR2); 및
(iii) 아미노산 서열 X 8ALDFDY를 포함하고, 여기서 X 8은 M 또는 L인 중쇄 상보성 결정부위 3(CDR3)를 포함하는 중쇄가변영역(VH) 및
(b) (i) 아미노산 서열 TGSSSNIGSNYVT를 포함하는 경쇄 상보성 결정부위 1(CDR1);
(ii) 아미노산 서열 X 9NX 10X 11RPS를 포함하고, 여기서 X 9는 D, S 또는 R이고, X 10은 S 또는 N이고, X 11은 N 또는 Q인 경쇄 상보성 결정부위 2(CDR2); 및
(iii) 아미노산 서열 X 12SFSDELGAYV를 포함하고, 여기서 X 12은 A 또는 S인 경쇄 상보성 결정부위 3(CDR3)를 포함하는 경쇄가변영역(VL)
을 포함하는, 세포 외막에 노출되는 라이실-tRNA 합성효소(KRS, Lysyl-tRNA synthetase) N-말단 영역에 특이적으로 결합하는 항체 또는 그 단편을 제공한다.
구체적으로는, 상기 (a) 중쇄가변영역(VH)은 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1); 서열번호 3, 서열번호 17, 서열번호 19, 서열번호 21, 서열번호 23 및 서열번호 118로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2); 서열번호 5 및 서열번호 25로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 것을 특징으로 하고,
(b) 경쇄가변영역(VL)은 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1); 서열번호 9, 서열번호 27 및 서열번호 29로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2); 서열번호 13 및 서열번호 15로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 것을 특징으로 한다.
상기 CDR 서열로 구성된 항체들은 세포 외막에 노출되는 KRS N-말단 영역에 특이적으로 결합하는 능력이 뛰어나다. 이는 본 발명의 명세서 실시예에 잘 나타나 있다.
본 발명의 실시예에서는 세포 외막에 노출되는 KRS N-말단 영역에 특이적으로 결합하며, 친화도가 높은 항체를 제작하기 위하여 기존의 N3 항체(출원번호: 10-2018-0035446)의 중쇄가변영역과 경쇄가변영역을 개량한 뒤, 효모 발현을 통해 개량된 라이브러리를 선별하였다. 1차, 2차, 3차 FACS 스크리닝을 통해, KRS N-말단 영역에 고친화도 및 특이성을 갖는 N3-1, N3-3, N3-4 scFv를 선별하였으며, 이의 VH 및 VL을 서로 조합한 새로운 N3-5 scFv를 선별하였다.
그 다음 GST가 결합된 KRS N-말단에 특이적으로 결합하며, 친화도가 높은 개량 라이브러리를 선별하기 위하여, N3-3 scFv의 중쇄가변영역을 개량한 라이브러리를 선별하였다. 1차, 2차, 3차, 4차 FACS 스크리닝을 통해, KRS N-말단 영역에 고친화도 및 특이성을 갖는 N3-6, N3-7, N3-8, N3-9 scFv를 선별하였다.
이 중 가장 높은 친화도를 갖는 N3-8 IgG 항체의 생산성, 안정성 등을 개선하기 위하여 N3-8의 중쇄가변영역 및 경쇄 부위에 돌연변이를 도입하여 7종(N3-8-1, N3-8-2, N3-8-3, N3-8-4, N3-8-5, N3-8-6, N3-8-7) 의 항체를 얻었다.
그 결과 N3-1 IgG, N3-3 IgG, N3-4 IgG, N3-5 IgG, N3-6 IgG, N3-7 IgG, N3-8 IgG, N3-9 IgG, N3-8-1 IgG, N3-8-2 IgG, N3-8-3 IgG, N3-8-4 IgG, N3-8-5 IgG, N3-8-6 IgG, N3-8-7 IgG의 항체를 제작하였으며, 상기 항체 또한 KRS N-말단에 높은 친화도를 보이는 것을 확인하였다.
본 발명에 따른 ‘세포 외막에 노출되는 KRS N-말단 영역에 특이적으로 결합하는 항체 또는 그 단편’은, 이에 제한되지는 않으나, 바람직하게 아래와 같은 중쇄가변영역 및 경쇄가변영역의 CDR 구성을 포함하는 항체로서 하기 i, ii, iii, iv, v, vi, vii, viii, ix, x, xi, xii 및 xiii는 각각 실시예의 N3-1, N3-3, N3-4, N3-5, N3-6, N3-7, N3-8, N3-9, N3-8-1, N3-8-2, N3-8-3, N3-8-4, N3-8-5, N3-8-6 및 N3-8-7 항체의 CDR 조합을 나타낸다:
i) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 3으로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 13으로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
ii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 3으로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
iii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 118로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 13으로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
iv) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 118로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
v) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 17로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
vi) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 19로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
vii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체; 및
viii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 23으로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
ix) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 27로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
x) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 29로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
xi) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 25로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
xii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 25로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 27로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
xiii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 25로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 29로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
를 포함하는 것을 특징으로 하는 항체 또는 그 단편.
가장 바람직하게 본 발명에 따른 상기 항체 또는 그 단편은, 아래와 같은 중쇄가변영역(VH) 및 경쇄가변영역(VL)을 포함하는 것을 특징으로 한다:
상기 항체 또는 그 단편에 있어서, 상기 중쇄가변영역은 서열번호 31, 서열번호 35, 서열번호 37, 서열번호 39, 서열번호 41, 서열번호 43, 서열번호 45 및 서열번호 47로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하고, 상기 경쇄가변영역은 서열번호 49, 서열번호 51, 서열번호 53 및 서열번호 55로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함한다.
바람직하게는, 서열번호 31로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 49로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 31로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 51으로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 35로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 49로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 35로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 51으로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 37로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 51으로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 39로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 51로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 41으로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 51로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 43로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 51로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 45로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 51로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 45로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 53으로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 45로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 55로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 47로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 51로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 47로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 53으로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 서열번호 47로 표시되는 아미노산 서열을 포함하는 중쇄가변영역 및 서열번호 55로 표시되는 아미노산 서열을 포함하는 경쇄가변영역; 을 포함하는 항체이다.
상기 중쇄가변영역(VH)과 경쇄가변영역(VL)을 포함하는 IgG 형태의 항체는 구체적으로는 서열번호 89, 서열번호 93, 서열번호 95, 서열번호 97, 서열번호 99, 서열번호 101, 서열번호 103 및 서열번호 105 로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 107, 서열번호 109, 서열번호 111, 서열번호 113 및 서열번호 115로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 경쇄로 이루어진 것을 특징으로 하는 항체일 수 있다.
가장 바람직하게는 서열번호 89로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 107로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 89로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 93으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 107로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 93으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 95로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 97로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 99로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 101로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 103으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 111로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 103으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 113으로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 103으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 115로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 105로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 111로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 105로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 113으로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 105로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 115로 표시되는 아미노산 서열을 포함하는 경쇄; 서열번호 99로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 111로 표시되는 아미노산 서열을 포함하는 경쇄;를 포함하는 항체이다.
본 발명에 따른‘세포 외막에 노출되는 KRS N-말단 영역에 특이적으로 결합하는 항체’는 상기한 CDR 조합이나, VH 및 VL 조합을 갖는 것이라면 그 종류가 제한되지 않는다. 구체적 일례로 상기 항체는 IgG, IgA, IgM, IgE 및 IgD로 이루어진 군에서 선택되는 것일 수 있으며, 바람직하게는 IgG 항체일 수 있다.
본 발명의 항체는 KRS N-말단 영역에 특이적으로 결합하는 상기한 CDR 조합이나, VH 및 VL 조합을 갖는 것이라면 단일클론(monoclonal) 항체일 수도 있고, 다클론(polyclonal) 항체일 수도 있지만, 항체의 중쇄와 경쇄의 아미노산 서열이 실질적으로 동일한 항체의 집단인 단일클론 항체인 것이 바람직하다.
본 발명의 항체는 인간을 포함하는 포유동물, 조류 등을 포함한 임의의 동물에서 유래한 것일 수 있으며, 바람직하게는 인간에서 유래한 것이거나, 인간에서 유래한 항체의 부분과 다른 종의 동물에서 유래한 항체의 부분을 포함하는 키메릭(chimeric) 항체일 수 있다. 즉, 본 발명은 키메라 항체, 인간화된 항체, 인간항체를 모두 포함하며 바람직하게는 인간항체일 수 있다.
또한 본 발명에서 항체의 단편은 전체 항체의 항원 특이적 결합력을 유지하고 있는 항체의 단편을 의미하며, 바람직하게 상기 단편은 모항체의 KRS N-말단 결합 친화도와 유사하거나, 적어도 20%, 50%, 70%, 80%, 90%, 95% 또는 100% 또는 그 이상을 보유한다. 구체적으로는 Fab, F(ab)2, Fab', F(ab')2, Fv, 디아바디(diabody), scFv 등의 형태일 수 있다.
Fab(fragment antigen-binding)는 항체의 항원 결합 단편으로, 중쇄와 경쇄 각각의 하나의 가변 도메인과 불변 도메인으로 구성되어 있다. F(ab')2는 항체를 펩신으로 가수분해시켜서 생성되는 단편으로, 두 개의 Fab가 중쇄 경첩(hinge)에서 이황결합(disulfide bond)으로 연결된 형태를 하고 있다. F(ab')는 F(ab')2 단편의 이황결합을 환원하여 분리시킨 Fab에 중쇄 경첩이 부가된 형태의 단량체 항체 단편이다. Fv(variable fragment)는 중쇄와 경쇄 각각의 가변영역으로만 구성된 항체 단편이다. scFv(single chain variable fragment)는 중쇄가변영역(VH)과 경쇄가변영역(VL)이 유연한 펩티드 링커로 연결되어 있는 재조합 항체 단편이다. 디아바디(diabody)는 scFv의 VH와 VL가 매우 짧은 링커로 연결되어 서로 결합하지 못하고, 동일한 형태의 다른 scFv의 VL와 VH와 각각 결합하여 이량체를 형성하고 있는 형태의 단편을 의미한다.
본 발명의 목적상 항체의 단편은 세포 외막에 노출되는 KRS N-말단 영역에 대한 결합특이성을 유지하고 있는 것이라면 구조나 형태의 제한을 받지 않지만, 바람직하게 scFv일 수 있다. 본 발명에 따른 scFv는 상기한 KRS N-말단 영역에 특이적인 CDR 구성, 또는 VH와 VL의 구성을 갖는 것으로서 VH의 C-말단과 VL의 N-말단이 링커를 통해 연결된 것이라면 그 서열이 특별히 제한되지 않는다. 상기 링커는 당업계에 scFv에 적용되는 링커로서 알려진 것이라면 그 종류가 특별히 제한되지 않으나 바람직하게 서열번호 57로 표시되는 아미노산 서열을 포함하는 펩타이드 일 수 있다. 이에 따라 본 발명의 scFv는 구체적으로 서열번호 61, 서열번호 63,서열번호 65, 서열번호 67, 서열번호 69, 서열번호 71, 서열번호 73, 서열번호 75, 서열번호 77, 서열번호 79, 서열번호 81, 서열번호 83, 서열번호 85 및 서열번호 87로 이루어진 군에서 선택된 아미노산 서열을 포함하는 것일 수 있다.
본 발명의 항체 또는 그 단편은 이의 생물학적 활성을 실질적으로 변경하지 않는 보존적 아미노산 치환(항체의 보존적 변이체라고 함)을 포함할 수 있다.
또한 전술한 본 발명의 항체 또는 그 단편은 효소, 형광 물질, 방사선 물질 및 단백질 등과 접합된 것일 수 있으나, 이에 한정되지는 않는다. 또한, 항체에 상기 물질을 접합하는 방법은 당업계에 잘 알려져 있다.
또한 본 발명은 상기 항체 또는 그 단편을 암호화 하는 폴리뉴클레오티드를 제공한다.
본 명세서에서 폴리뉴클레오티드는 올리고뉴클레오티드 또는 핵산으로 기재될 수도 있으며, DNA분자들(예를 들어, cDNA 또는 유전체(genomic DNA), RNA 분자들(예를 들어, mRNA), 뉴클레오티드 유사체들을 사용하여 생성된 상기 DNA 또는 RNA의 유사체들(예를 들어, 펩티드 핵산들 및 비-자연적으로 발생하는 뉴클레오티드 유사체들) 및 이들의 하이브리드들이 포함된다. 상기 폴리뉴클레오티드는 단일-가닥(single-stranded) 또는 이중-가닥(double stranded)이 될 수 있다.
상기 폴리뉴클레오티드는 상기한 KRS N-말단 영역에 특이적인 CDR 구성, 또는 VH와 VL의 구성을 갖는 중쇄 및 경쇄로 이루어지는 항체를 암호화하는 염기서열을 의미한다. 본 발명의 폴리뉴클레오티드는 본 발명의 항체 또는 그 단편을 암호화하는 것이면 그 서열이 특별히 제한되지 아니하는 것으로서, 앞서 설명한 본 발명에 따른 항체에서 전술한 CDR 서열을 암호화하는 폴리뉴클레오티드는 그 서열이 특별히 제한되지 않으나, 바람직하게 서열번호 2, 서열번호 4, 서열번호 6, 서열번호 8, 서열번호 10, 서열번호 12, 서열번호 14, 서열번호 16, 서열번호 18, 서열번호 20, 서열번호 22, 서열번호 24, 서열번호 26, 서열번호 28, 서열번호 30 또는 서열번호 119로 표시되는 염기서열을 포함하는 것일 수 있다.
또한 본 발명에 따른 항체에서 전술한 VH와 VL을 암호화하는 폴리뉴클레오티드는 그 서열이 특별히 제한되지 않으나, 바람직하게 서열번호 32(VH), 서열번호 34(VL), 서열번호 36(VH), 서열번호 38(VH), 서열번호 40(VH), 서열번호 42(VH), 서열번호 44(VH), 서열번호 46(VH), 서열번호 48(VH), 서열번호 50(VL), 서열번호 52(VL), 서열번호 54(VL) 또는 서열번호 56(VL)으로 표시되는 염기서열을 포함하는 것일 수 있다.
또한 상기 항체의 단편을 암호화하는 폴리뉴클레오티드는 바람직하게는 본 발명에 따른 scFv를 암호화하는 서열번호 62, 서열번호 64, 서열번호 66, 서열번호 68, 서열번호 70, 서열번호 72, 서열번호 74, 서열번호 76, 서열번호 78, 서열번호 80, 서열번호 82, 서열번호 84, 서열번호 86 및 서열번호 88로 이루어지는 군에서 선택되는 어느 하나의 염기서열을 포함하는 것일 수 있다.
본 발명의 항체 또는 그 단편을 암호화하는 폴리뉴클레오티드는 당업계에 잘 알려진 방법에 의하여 얻어질 수 있다. 예를 들어, 상기 항체의 중쇄 및 경쇄의 일부분 또는 전부를 코딩하는 DNA 서열 또는 해당 아미노산 서열에 근거하여, 당분야에 잘 알려진 올리고뉴클레오타이드 합성기법, 예를 들어 중합효소 연쇄 반응 (PCR)법 등을 사용하여 합성할 수 있다.
또한 본 발명은 본 발명에 따른 항체 또는 그 단편을 암호화하는 폴리뉴클레오티드를 포함하는 재조합 발현 벡터를 제공한다.
본 발명에서 '재조합(recombinant)'은 '유전자 조작(genetic manipulation)'과 호환하여 사용될 수 있으며, 유전자에 변형을 가하고 자르고 연결하는 등 분자적 클로닝(molecular cloning) 실험 기법을 이용하여 자연의 상태에는 존재하지 않는 형태의 유전자를 제조하는 것을 의미한다.
본 발명에서 '발현(expression)'은 세포에서 단백질 또는 핵산이 생성되는 것을 의미한다.
본 발명에서 '재조합 발현 벡터'란 적합한 숙주세포(host cell)에서 목적하는 단백질 또는 핵산(RNA)을 발현할 수 있는 벡터로서, 폴리뉴클레오티드(유전자) 삽입물이 발현될 수 있도록 작동가능하게 연결된 필수적인 조절 요소를 포함하는 유전자 작제물을 말한다.'작동가능하게 연결된(operably linked)'이란 일반적 기능을 수행하도록 핵산 발현조절서열과 목적하는 단백질 또는 RNA를 코딩하는 핵산 서열이 기능적으로 연결(functional linkage)되어 있는 것으로, 발현조절서열에 의해 유전자가 발현될 수 있도록 연결된 것을 의미한다. 상기 '발현조절서열(expression control sequence)'이란 특정한 숙주세포에서 작동가능하게 연결된 폴리뉴클레오티드 서열의 발현을 조절하는 DNA 서열을 의미한다. 그러한 조절 서열은 전사를 실시하기 위한 프로모터, 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열, 전사 및 해독의 종결을 조절하는 서열, 개시 코돈, 종결 코돈, 폴리아데닐화 시그널 및 인핸서 등을 포함한다.
본 발명의 재조합 발현 벡터는 클로닝 분야에서 통상적으로 사용되는 벡터라면 그 종류가 특별히 제한되지 않으며, 그 예로는 mammalian expression vector,플라스미드 벡터, 코즈미드 벡터, 박테리오파아지 벡터 및 바이러스 벡터 등을 포함하나 이에 제한되지 않는다. 상기 플라스미드에는 대장균 유래 플라스미드(pBR322, pBR325, pUC118 및 pUC119, pET-22b(+)), 바실러스 서브틸리스 유래 플라스미드(pUB110 및 pTP5) 및 효모 유래 플라스미드(YEp13, YEp24 및 YCp50) 등이 있으며, 상기 바이러스는 레트로바이러스, 아데노바이러스 또는 백시니아 바이러스와 같은 동물 바이러스, 배큘로 바이러스와 같은 곤충 바이러스 등이 사용될 수 있다.
따라서 본 발명에 따른 재조합 발현 벡터는 KRS N-말단 영역에 특이적으로 결합할 수 있는 전술한 CDR, 또는 VH와 VL의 구성을 갖는 중쇄 및 경쇄로 이루어지는 항체 또는 그 단편을 암호화하는 폴리뉴클레오티드가 적절한 숙주세포에서 발현될 수 있도록 작동가능하게 연결된 유전자 작제물을 의미한다.
본 발명에 따른 항체의 중쇄와 경쇄를 암호화하는 폴리뉴클레오티드는 각각 별개의 재조합 발현 벡터에 포함되어 있을 수도 있고, 하나의 재조합 발현 벡터에 포함되어 있을 수도 있다.
본 발명은 상기 재조합 발현 벡터로 형질전환된 세포를 제공한다.
본 발명의 세포는 본 발명의 재조합 발현 벡터에 포함된 항체 또는 그 단편을 암호화하는 폴리뉴클레오티드를 발현하는데 사용될 수 있는 세포라면 그 종류는 특별히 제한되지 아니한다. 본 발명에 따른 재조합 발현 벡터로 형질전환된 세포(숙주세포)는 원핵생물(예를 들어, 대장균), 진핵생물(예를 들어, 효모 또는 다른 균류), 식물 세포(예를 들어, 담배 또는 토마토 식물 세포), 동물 세포(예를 들어, 인간 세포, 원숭이 세포, 햄스터(hamster) 세포, 랫 세포(rat cell), 마우스 세포(mouse cell), 곤충 세포 또는 이들에서 유래한 하이브리도마일 수도 있다. 바람직하게는 인간을 포함하는 포유류에서 유래한 세포일 수 있다.
본 목적에 적합한 원핵생물은 그람 음성 또는 그람 양성 유기체, 예를 들어 엔테로박테리아새( Enterobacteriaceae), 예를 들어 에스케리치아 ( Escherichia), 예를 들어 이. 콜라이( E. coli), 엔테로박터( Enterobacter), 에르위니아 ( Erwinia), 클렙시엘라 ( Klebsiella), 프로테우스 ( Proteus), 살모넬라( Salmonella), 예를 들어, 살모넬라 티피무륨 (S almonella typhimurium), 세라티아 ( Serratia), 예를 들어, 세라티아 마르세스칸스 ( Serratia marcescans) 및 시겔라 ( Shigella), 및 바실리 ( Bacilli), 예를 들어, 비. 섭틸리스 ( B. subtilis) 및 비. 리케니포르미스 ( B. licheniformis), 슈도모나스 ( Pseudomonas), 예를 들어 피.애루기노사 ( P. aeruginosa) 및 스트렙토마이세스 ( Streptomyces)를 포함한다. 본 발명의 세포는 본 발명의 벡터를 발현가능 한 것이면, 특별히 제한되지 아니하나, 바람직하게는 이. 콜라이일 수 있다.
본 발명의 세포로서 진핵생물은 사카로마이세스 세레비지아에 ( Saccharomyces cerevisiae)가 가장 흔히 사용된다. 그러나, 많은 다른 속, 종 및 균주, 이에 한정되지 아니하나, 예를 들어 쉬조사카로마이세스폼베( Schizosaccharomyces pombe), 클루이베로마이세스 숙주, 예를 들어 케이. 락티스( K. lactis), 케이. 프라길리스 ( K. fragilis) (ATCC 12,424), 케이. 불가리쿠스 ( K. bulgaricus) (ATCC 16,045), 케이. 위커라미 ( K. wickeramii) (ATCC 24,178), 케이. 왈티 ( K. waltii) (ATCC 56,500), 케이. 드로소필라룸 ( K. drosophilarum) (ATCC 36,906), 케이. 테르모톨레란스 ( K. thermotolerans) 및 케이. 마르시아누스 ( K. marxianus); 야로위아( yarrowia) (EP 402,226); 피키아 파스토리스 ( Pichia pastoris) (EP 183,070); 칸디다 ( Candida); 트리코데르마 레에시아 ( Trichoderma reesia (EP 244,234)); 뉴로스포라 크라사( Neurospora crassa); 쉬바니오마이세스 ( Schwanniomyces), 예를 들어 쉬바니오마이세스 옥시덴탈리스( occidentalis); 및 필라멘트성 진균, 예를 들어 뉴로스포라, 페니실리움 ( Penicillium), 톨리포클라디움( Tolypocladium) 및 아스퍼질러스 ( Aspergillus) 숙주, 예를 들어 에이. 니둘란스 ( A. nidulans) 및 에이. 니거 ( A.niger)가 사용가능 하다.
상기 용어 '형질전환(transformation)'은 외래성 폴리뉴클레오티드가 도입됨에 의한 숙주 세포의 유전자형의 변형을 의미하며, 그 형질전환에 사용된 방법과 상관없이 외래성 폴리뉴클레오티드가 숙주 세포 내로 도입된 것을 의미한다. 숙주 세포 내로 도입된 외래성 폴리뉴클레오티드는 숙주 세포의 게놈 내로 통합되어 유지되거나 통합되지 않고 유지될 수 있는데, 본 발명은 양자 모두 포함한다.
본 발명에 따른 KRS N-말단 영역에 특이적으로 결합하는 항체 또는 그 단편을 발현할 수 있는 재조합 발현 벡터는 당업계에 공지된 방법, 예를 들어 이에 한정되지는 않으나, 일시적 형질감염(transient transfection), 미세주사, 형질도입(transduction), 세포융합, 칼슘 포스페이트 침전법, 리포좀 매개된 형질감염(liposome-mediated transfection), DEAE 덱스트란-매개된 형질감염(DEAE dextran- mediated transfection), 폴리브렌-매개된 형질감염(polybrene-mediated transfection), 전기천공법(electroporation), 유전자 총(gene gun) 및 세포 내로 핵산을 유입시키기 위한 공지의 방법에 의해 항체 또는 그 단편을 생산하기 위한 세포 내부로 도입하여 형질전환할 수 있다.
본 발명은
(a) 상기 재조합 발현 벡터로 숙주 세포를 형질전환하는 단계;
(b) 형질전환된 숙주 세포를 배양하여 항체 또는 그 단편을 생산하는 단계; 및
(c) 숙주 세포에서 생산된 항체 또는 그 단편을 수득하는 단계를 포함하는, 세포 외막에 노출되는 라이실-tRNA 합성효소(KRS, Lysyl-tRNA synthetase) N-말단에 특이적으로 결합하는 항체 또는 그 단편을 제조하는 방법을 제공한다.
(a) 단계는 본 발명에 따른 항체 또는 그 단편을 생산하기 위하여 숙주세포를 상기 항체 또는 그 단편을 암호화하는 폴리뉴클레오티드가 작동가능하게 연결된 재조합 발현 벡터로 형질전환하는 단계이다.
통상의 기술자는 선택된 숙주세포와 재조합 발현 벡터에 따라 앞서 서술한 바와 같이 적절한 형질전환 방법을 선택하여 본 단계를 실시할 수 있다. 중쇄와 경쇄의 염기서열을 포함하는 재조합 발현 벡터는 동일한 숙주세포에 공동형질전환하여 중쇄와 경쇄가 하나의 세포에서 발현되도록 할 수도 있고, 중쇄와 경쇄의 염기서열을 포함하는 재조합 발현 벡터를 각각 별개의 숙주세포에 형질전환하여 중쇄와 경쇄가 따로 발현되도록 할 수도 있다.
(b) 단계는 상기 형질전환된 숙주세포를 배양하여 숙주세포에 도입된 재조합 발현 벡터로부터 본 발명에 따른 항체의 중쇄, 경쇄 또는 항체 단편의 폴리펩티드가 생산되도록 하는 단계이다.
상기 숙주세포를 배양하기 위한 배지 조성과 배양 조건, 배양 시간 등은 당업계에서 통상 사용되는 방법에 따라 적절하게 선택할 수 있다. 숙주세포에서 생산되는 항체 분자는 세포의 세포질 내에 축적되거나, 적절한 신호 서열에 의하여 세포 외부 또는 배양 배지로 분비되거나, 페리플라즘 등으로 표적화(targeted)되도록 할 수 있다. 또한 본 발명에 따른 항체가 KRS N-말단에 대한 결합특이성을 유지하도록 당업계에 공지되어 있는 방법을 이용하여 단백질 리폴딩(refolding)시키고 기능성 구조(conformation)를 갖도록 하는 것이 바람직하다. 또한 IgG 형태의 항체를 생산하는 경우, 중쇄와 경쇄는 별개의 세포에서 발현시키고 별도의 단계에서 중쇄와 경쇄를 접촉시켜 완전한 항체를 구성하도록 제조할 수도 있고, 중쇄와 경쇄를 동일한 세포에서 발현되도록 하여 세포 내부에서 완전한 항체를 형성하도록 할 수도 있다.
(c) 단계는 숙주세포에서 생산된 항체 또는 그 단편을 수득하는 단계이다.
숙주세포에서 생산된 항체 또는 그 단편 폴리펩타이드의 특성, 숙주세포의 특성, 발현 방식 또는 폴리펩티드의 표적화 여부 등을 고려하여 통상의 기술자는 수득 방법을 적절히 선택 및 조절할 수 있다. 예를 들어, 배양 배지로 분비된 항체 또는 그 단편은 숙주세포를 배양한 배지를 수득하고, 원심분리하여 불순물을 제거하는 등의 방법으로 항체를 회수할 수 있다. 필요에 따라 세포 내 특정 소기관이나 세포질에 존재하는 항체를 세포 외부로 방출하여 회수하기 위하여 항체 또는 그 단편의 기능적 구조에 영향을 미치지 않는 범위에서 세포를 용해시킬 수도 있다. 또한 수득한 항체는 크로마토그래피, 필터 등에 의한 여과, 투석 등의 방법을 통해 불순물을 더욱 제거하고 농축하는 과정을 추가로 거칠 수 있다.
본 발명 제조(생산) 방법의 폴리펩타이드는 본 발명의 항체 또는 그 단편 그 자체일 수 있으며, 본 발명의 항체 또는 그 단편 외 다른 아미노산서열이 추가로 결합된 것일 수 있다. 이 경우 본 기술 분야의 통상의 기술자에게 잘 알려져 있는 방법을 이용하여 본 발명의 항체 또는 그 단편으로부터 제거할 수 있다.
본 발명의 항체 또는 그 단편은 KRS N-말단과 특이적으로 결합하므로 예를 들어, 특정 세포, 조직, 또는 혈청 내 KRS 단백질을 검출하고 정량하기 위한 진단 분석에 유용하다. 특히 세포를 용해시키지 않고도 세포 외막으로 노출된 KRS N-말단을 특이적으로 검출 가능하다.
본 발명의 상기 검출 방법은 본 발명에 따른 항체 또는 그 단편을 시료와 접촉시키기 전에, 본 발명에 따른 항체 또는 그 단편을 이용하여 KRS(또는 세포 외막으로 노출된 KRS N-말단 펩타이드)의 유무와 농도를 측정하기 위한 시료를 준비하는 단계((1) 단계)를 포함할 수 있다.
통상의 기술자는 항체를 이용하여 단백질을 검출하는 공지의 방법을 적절하게 선택하고, 선택된 방법에 적합하게 시료를 준비할 수 있다. 또한 시료는 암(특히 유방암 또는 폐암), 암전이의 여부 및 단계를 진단하고자 하는 피검체에서 채취된 생검 등으로 얻어진 세포나 조직, 혈액, 전혈, 혈청, 혈장, 타액, 뇌척수액 등일 수도 있다. 상기 항체를 이용하여 단백질을 검출하는 방법이란 여기 제한되는 것은 아니나, 예를 들어 웨스턴 블랏, 면역 블랏, 닷 블랏, 면역조직화학염색(immunohistochemistry), 면역세포염색(Immunocytochemistry), 효소면역분석(ELISA), 방사능면역검정법(radioimmunoassay), 경쟁적 결합 분석, 면역침전 등이 있다. 예를 들어 웨스턴 블랏을 실시하기 위하여서는 시료 또는 세포의 용해물에 전기영동에 적합한 버퍼를 첨가하여 끓이는 등의 방법으로 준비할 수 있으며, 면역조직화학염색을 위해서는 세포나 조직의 절편을 고정하고 블락킹(blocking)하는 등의 전처리를 할 수 있다.
다음으로 본 발명에 따른 항체 또는 그 단편을 전술한 단계에서 준비한 시료와 접촉시키는 단계((2) 단계)를 수행한다.
본 발명에 따른 항체는 앞서 서술한 CDR, 또는 VH와 VL의 구성을 가지며 KRS N-말단에 특이적으로 결합하는 항체 또는 그 단편으로서, 그 구체적 종류와 서열 구성에 대해서는 전술한 바와 같다.
상기 항체 또는 그 단편은 이의 '검출'을 위하여, 일반적으로 검출가능 모이어티(moiety)로 표지될 수 있다. 예를 들어, 당업계에 공지된 기술을 이용하여, 방사성 동위원소 또는 형광표지로 표지될 수 있다. 또는 다양한 효소-기질 표지가 이용가능하며, 상기 효소적 표지의 예는 초파리 루시퍼라제 및 세균 루시퍼라제(미국 특허 제4,737,456호)와 같은 루시퍼라제, 루시페린 (luciferin), 2,3-다이하이드로프탈라진디오네스, 말레이트 디하이드로게나제, 유라제 (urase), 호스래디쉬 퍼옥시다제 (HRPO)와 같은 퍼옥시다제, 알칼라인 포스파타제, β-갈락토시다제, 글루코아밀라제, 라이소자임, 사카라이드 옥시다제 (예를 들어 글루코스옥시다제, 갈락토스 옥시다제, 및 글루코스-6-포스페이트 디하이드로게나제), 헤테로사이클릭 옥시다제 (예를 들어 유리카제 및 잔틴 옥시다제), 락토퍼옥시다제, 마이크로퍼옥시다제 등을 포함한다. 항체에 효소를 접합시키는 기술은 당업계에 공지되어 있다. 표지는 다양한 공지된 기술을 이용하여 항체에 직접 또는 간접적으로 접합될 수 있다. 예를 들어, 항체는 바이오틴(biotin)에 접합될 수 있고 상기에 언급된 3종의 광범위한 카테고리에 속하는 임의의 표지들이 아비딘과, 또는 그 반대로 접합될 수 있다. 바이오틴은 아비딘(avidin)에 선택적으로 결합하고, 따라서 이 표지는 이러한 간접적 방식으로 항체에 접합될 수 있다. 또는, 항체에 표지의 간접적 접합을 달성하기 위하여, 항체는 작은 합텐 (hapten) (예를 들어, 딕옥신 [digoxin])과 접합될 수 있고 상기에 언급된 서로 다른 유형의 표지들의 하나가 항-합텐 항체에 접합될 수 있다 (예컨대, 항-딕옥신 항체). 따라서, 항체에 대한 표지의 간접적 접합이 달성될 수 있다.
본 발명에서 "접촉(contacting)"이라 함은 이의 일반적인 의미로 사용되는 것으로서, 2개 이상의 물질을 혼합, 결합, 또는 서로 맞닿게 하는 것을 의미한다. 상기 접촉은 시험관 내(in vitro) 또는 다른 컨테이너(container) 상에서 수행될 수 있고, 또한 인 시투(in situ), 생체 내, 개체 내, 조직 내, 세포 내에서 수행 될 수 있다.
다음으로는 상기(2) 단계 수행 후의 시료에서 본 발명에 따른 항체 또는 그 단편을 검출하는 단계((3) 단계)를 수행한다.
상기 ‘검출’은 시료 내에서 형성된 본 발명에 따른 항체 또는 그 단편과 항원의 복합체를 대상으로 하는 것으로서, KRS N-말단 영역의 펩타이드(또는 이를 포함하는 단백질, 예를 들어 KRS)의 존재 유무의 감지 또는 상기 펩타이드의 수준을 측정(정성적 또는 정량적 측정을 모두 포함)하는 것을 의미한다. 따라서 상기 (2) 단계 수행 후 후술하는 검출 단계((3) 단계) 전에, KRS N-말단 영역과 복합체를 형성하지 않은 여분의 항체 또는 그 단편들을 제거하는 단계가 추가로 포함될 수 있다.
전술한 (2) 단계에서 사용된 항체 또는 그 단편이 형광, 방사성 동위원소, 효소 등으로 직접 표지되는 등의 검출가능한 모이어티를 포함하는 경우에는 해당 모이어티를 검출하는 당업계에 공지된 방법에 따라 검출을 수행할 수 있다. 일례로 방사능은, 예를 들어, 신틸레이션 계수(scintillation counting)에 의해 측정될 수 있으며, 형광은 형광계를 이용하여 정량될 수 있다.
또한 전술한 (2) 단계에서 사용된 항체 또는 그 단편이 자체로서 전술한 검출 모이어티를 포함하지 않는 경우에는, 당업계에 알려진 바와 같이 형광, 방사능, 효소 등으로 표지된 2차 항체를 이용하여 간접적으로 감지할 수 있다. 상기 2차 항체는 본 발명에 따른 항체 또는 그 단편(1차 항체)에 결합한다.
본 발명은 상기 본 발명의 항체 또는 그 단편을 유효성분으로 포함하는 암 전이 예방 또는 억제용 약학적 조성물 및 암 진단용 조성물을 제공한다.
상기 암은 당업계에 악성 종양으로 알려진 것이라면 그 종류가 특별히 제한되지 않으나, 유방암, 대장암, 폐암, 소세포폐암, 위암, 간암, 혈액암, 골암, 췌장암, 피부암, 두부 또는 경부암, 피부 또는 안구내 흑색종, 자궁암, 난소암, 직장암, 항문암, 결장암, 나팔관암종, 자궁내막암종, 자궁경부암, 질암, 음문암종, 호지킨병, 식도암, 소장암, 내분비선암, 갑상선암, 부갑상선암, 부신암, 연조직 육종, 요도암, 음경암, 전립선암, 만성 또는 급성 백혈병, 림프구 림프종, 방광암, 신장 또는 수뇨관 암, 신장세포 암종, 신장골반 암종, CNS 종양, 1차 CNS 림프종, 척수 종양, 뇌간신경교종 및 뇌하수체 선종으로 이루어지는 군에서 선택되는 것일 수 있다. 바람직하게는 유방암 또는 폐암일 수 있다.
본 발명에 따른 약학적 조성물은 본 발명의 항체 또는 그 단편을 단독으로 포함하거나 하나 이상의 약학적으로 허용되는 담체를 추가로 포함할 수 있다. 상기에서 “약학적으로 허용되는”이란 생리학적으로 허용되고 인간에게 투여될 때, 활성성분의 작용을 저해하지 않으며 통상적으로 심각한 부작용을 일으키지 않는 조성물을 말한다.
본 발명에 따른 약학적 조성물에 있어서, 상기 항체 또는 그 단편은 임상 투여시에 경구 및 비경구의 여러 가지 제형으로 투여될 수 있는데, 제제화할 경우에는 보통 사용하는 충전제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 제조될 수 있다. 경구투여를 위한 고형 제제에는 정제, 환자, 산제, 과립제, 캡슐제, 트로키제 등이 포함되며, 이러한 고형 제제는 하나 이상의 아릴 유도체, 또는 이의 약학적으로 허용가능한 염에 적어도 하나 이상의 부형제 예를 들어, 전분, 탄산칼슘, 수크로오스(sucrose) 또는 락토오스(lactose) 또는 젤라틴 등을 섞어 조제될 수 있다. 또한, 단순한 부형제 외에 스테아린산 마그네슘, 탈크 등과 같은 윤활제들도 사용될 수 있다. 경구 투여를 위한 액상 제제로는 현탁제, 내용액제, 유제 또는 시럽제 등이 해당되는데, 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들어 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다.
비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁용제, 유제, 동결건조제제, 좌제가 포함된다. 본 발명의 치료용 조성물을 임의의 생리학적으로 허용가능한 담체, 부형제 또는 안정화제와 바람직한 순도를 갖는 항체를 혼합하여 저장하기 위해 동결건조된 케이크 또는 수용액의 형태로 제조할 수 있다. 허용가능한 담체, 부형제 또는 안정화제는 사용된 투여량 및 농도에서 수용자에게 비독성이고, 완충용액, 예를 들어 인산, 시트르산 및 다른 유기산; 아스코르브산을 비롯한 항산화제; 저분자량 (약 10개 미만의 잔기) 폴리펩티드; 단백질, 예를 들어 혈청 알부민, 젤라틴 또는 면역글로불린; 친수성 중합체, 예를 들어 폴리비닐피롤리돈; 아미노산, 예를 들어 글리신, 글루타민, 아스파라긴, 아르기닌 또는 리신; 단당류, 이당류, 및 글루코스, 만노스 또는 덱스트린을 비롯한 다른 탄수화물; 킬레이트제, 예를 들어 EDTA; 당 알콜, 예를 들어 만니톨 또는 소르비톨; 염-형성 반대이온, 예를 들어 나트륨; 및(또는) 비이온성 계면활성제, 예를 들어 트윈, 플루로닉스 또는 폴리에틸렌 글리콜 (PEG)이 포함된다.
본 발명의 항체는 암으로 투병 중인 개체에 약학적으로 유효한 양으로 투여될 수 있다. 상기에서 “약학적으로 유효한 양”이란 음성 대조군에 비해 그 이상의 반응을 나타내는 양을 말하며 바람직하게는 암을 치료하기에 충분한 양 또는 암 전이를 예방 또는 억제하기에 충분한 양을 말한다. 본 발명의 항체 또는 그 단편의 총 유효량은 단일 투여량(single dose)으로 환자에게 투여될 수 있으며, 다중 투여량(multiple dose)으로 장기간 투여되는 분할 치료 방법(fractionated treatment protocol)에 의해 투여될 수 있다. 본 발명의 항체 또는 그 단편의 인체에 대한 투여량은 일반적으로 0.01 - 100 mg/kg/week이며, 바람직하게는 0.1 - 20 mg/kg/week이며, 더욱 바람직하게는 5 - 10 mg/kg/week일 수 있다. 그러나 상기 본 발명의 항체 또는 그 단편의 용량은 약학적 조성물의 투여 경로 및 치료 횟수뿐만 아니라 환자의 연령, 체중, 건강 상태, 성별, 질환의 중증도, 식이 및 배설율 등 다양한 요인들을 고려하여 환자에 대한 유효투여량이 결정되는 것이므로, 이러한 점을 고려할 때 당 분야의 통상적인 지식을 가진 자라면 상기 본 발명의 항체 또는 그 단편을 암 치료제 또는 암전이 예방 또는 억제제로서의 특정한 용도에 따른 적절한 유효 투여량을 결정할 수 있을 것이다. 본 발명에 따른 약학적 조성물은 본 발명의 효과를 보이는 한 그 제형, 투여 경로 및 투여 방법에 특별히 제한되지 아니한다.
본 발명의 조성물의 투여 경로는 공지된 항체 투여 방법, 예를 들어 정맥내, 복강내, 뇌내, 피하, 근육내, 안내, 동맥내, 뇌척수내, 또는 병변내 경로에 의한 주사 또는 주입, 또는 하기 기재된 서방성 (sustained release) 시스템에 의한 주사 또는 주입일 수 있으며 이에 제한되지 않는다. 일례로 본 발명의 항체는 전신으로 또는 국부적으로 투여될 수 있다.
본 발명의 약학적 조성물은 암 또는 암 전이의 예방 또는 치료를 위하여 단독으로, 또는 수술, 호르몬 치료, 화학 치료 및 생물학적 반응 조절제를 사용하는 방법들과 병용하여 사용할 수 있다.
본 발명에 따른 암, 암 전이의 진단 및 예후 평가는 생물학적 시료 중에서 KRS 단백질(특히, 세포 외막에 노출된 KRS N-말단 영역)을 검출함으로써 수행될 수 있다.
본 발명에서 용어 ‘진단’은, 병리 상태의 존재 또는 특징을 확인하는 것을 의미한다. 본 발명에서 상기 진단은 암 또는 암 전이의 발병 여부, 발병 가능성(위험성) 및 병의 진행단계를 확인하는 것이다.
‘검출’에 대해서는 전술한 바와 같으며, 상기 생물학적 시료는 혈액 및 생물학적 기원의 기타 액상 시료, 생검 표본, 조직 배양과 같은 고형 조직 시료 또는 이로부터 유래된 세포가 포함된다. 보다 구체적으로 예를 들면 이에 한정되지는 않으나 조직, 추출물, 세포 용해물, 전혈, 혈장, 혈청, 침, 안구액, 뇌척수액, 땀, 뇨, 젖, 복수액, 활액, 복막액 등일 수 있다. 상기 시료는 동물, 바람직하게는 포유동물, 가장 바람직하게는 인간으로부터 수득될 수 있다. 상기 시료는 검출에 사용하기 전에 전처리할 수 있다. 예를 들어, 여과, 증류, 추출, 농축, 방해 성분의 불활성화, 시약의 첨가 등을 포함할 수 있다. 또한, 상기 시료로부터 핵산 및 단백질을 분리하여 검출에 사용할 수 있다.
본 발명에 따른 항체 또는 그 단편은 진단 키트로서 제공될 수 있으며, 상기 키트는 당업계에 항체 또는 특정 결합 도메인을 갖는 펩타이드를 구성품으로 제공하는 분석 키트로서 알려진 것이라면 그 종류가 특별히 제한되지 않으나, 예를 들어 웨스턴 블랏, ELISA, 방사성면역분석법, 방사면역확산법, 오우크테로니 면역확산법, 로케이트 면역전기영동, 조직면역염색, 세포면역염색, 면역침전 분석법, 보체 고정 분석법, FACS 또는 단백질 칩용 키트 등을 포함한다.
본 발명의 항체 또는 그 단편은 상기 키트 즉, 진단 분석을 수행하기 위한 진단 키트에서 사용설명서와 함께 미리 지정된 양으로 시약들의 포장된 조합에 사용될 수 있다. 항체가 효소로 표지된 경우에, 키트는 기질 및 발색단 또는 형광단을 제공하는 기질 전구체로서 효소에 의해 요구되는 보조인자 (cofactor)를 포함할 수 있다. 또한, 안정화제, 완충액 (예를 들어, 차단 완충액 또는 용해 완충액) 등과 같은 다른 첨가제들이 포함될 수 있다. 다양한 시약들의 상대적인 양은 분석의 민감도를 충분히 최적화시키는 시약의 용액 내 농도를 제공하기 위해 폭넓게 변화될 수 있다. 시약은 용해 시 적절한 농도를 갖는 시약 용액을 제공하게 될 부형제를 포함하는, 일반적으로 동결건조된, 건조 분말로서 제공될 수 있다.
또한 본 발명은 상기 항체는 야생형 인간 IgG Fc 영역의 Fc 변이체를 포함하는 폴리펩티드로서, 상기 Fc 변이체는 서열번호 126으로 표시되는 야생형 인간 IgG1 Fc 영역의 L117A, L118A, T182A, P212G 또는 서열번호 138로 표시되는 인간 IgG4 Fc 영역의 T179A인 하나 이상의 추가의 아미노산 치환을 포함하고, 상기 폴리펩티드는 야생형 IgG Fc 영역을 포함하는 폴리펩티드에 비해, ADCC/CDC 기능이 감소되는 폴리펩티드를 포함하는 것을 특징으로 한다.
본 발명에서 상기 Fc 영역은 불변 영역의 일부 이상을 함유하는 면역글로불린 중쇄의 C-말단 영역을 의미하며, 야생형 서열 Fc 영역 및 변이체 Fc 영역을 포함한다. 본 발명에서 “Fc 변이체”는 Fc 도메인에 수식을 포함하는 폴리펩티드를 언급한다. 본 발명의 Fc 변이체는 그것을 구성하는 아미노산 수식에 따라 정의된다. 구체적으로는, L118A는 부모 Fc 폴리펩티드와 비교시 위치 118에서 류신이 알라닌으로 치환된 Fc 변이체이며, T182A는 위치 182에서 트레오닌이 알라닌으로 치환된 Fc 변이체이이며, P212G 는 위치 212에서 프롤린이 글리신으로 치환된 Fc 변이체이다. 아미노산 수식은 아미노산 부가, 아미노산 결실 또는 아미노산 치환일 수 있다. 아미노산 치환은 자연 발생적 아미노산 및 비-자연 발생적 아미노산을 포함할 수 있다. 변이체는 비-자연적 아미노산을 포함할 수 있다.
상기 “아미노산 치환”은 소정의 아미노산 서열 내에서 하나 이상의 기존 아미노산 잔기의 또다른 상이한 “대체” 아미노산 잔기에 의한 대체를 언급한다. 대체 잔기 또는 잔기들은 “자연 발생적 아미노산 잔기”일 (즉 유전부호에 의해 인코딩될) 수 있고, 알라닌 (Ala); 아르기닌 (Arg); 아스파라긴 (Asn); 아스파르트산 (Asp); 시스테인 (Cys); 글루타민 (Gln); 글루탐산 (Glu); 글리신 (Gly); 히스티딘 (His); 이소류신 (Ile): 류신 (Leu); 라이신 (Lys); 메티오닌 (Met); 페닐알라닌 (Phe); 프롤린 (Pro); 세린 (Ser); 트레오닌 (Thr); 트립토판(Trp); 티로신 (Tyr); 및 발린 (Val) 으로 이루어지는 군으로부터 선택될 수 있다.
상기 “ADCC/CDC 기능”은 항체-의존성 세포-매개성 세포독성(Antibody-dependent cellular cytotoxicity, ADCC), 보체-의존성 세포독성(complement-dependent cytotoxicity, CDC) 기능을 의미한다. 상기 "보체-의존성 세포독성" (CDC)이란 보체가 존재하는 상태에서 본 발명의 항체에 의한 항원-발현 세포의 용해를 의미한다. "항체-의존성 세포-매개성 세포독성" (ADCC)이란 Fc 수용체(FcRs)를 발현하는 비특이적 세포독성 세포(예: 자연 살해(NK) 세포, 호중구, 그리고 대식세포)가 표적 세포에서 결합된 항체를 인식하고 따라서 상기 표적 세포를 용해하게 되는 세포-매개성 반응을 의미한다. CDC 및 ADCC는 당업계에 잘 알려져 있고 사용 가능한분석법들을 사용하여 측정될 수 있다. (참고자료 예: U.S. 5,500,362 및 5,821,337, 그리고 Clynes et al. (1998) Proc. Natl. Acad. Sci. (USA) 95:652-656). 항체의 불변 영역은 보체를 고정시키고 세포 의존 세포독성을 매개하는 항체의 능력에 있어서 중요하다. 따라서, 항체의 동형(isotype)은 항체가 세포독성을 매개하는 것이 바람직한지에 근거하여 선택될 수 있다.
구체적으로는, 본 발명의 상기 항체는 구체적으로는 서열번호 140, 142, 144, 146, 148, 150, 152로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 91로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 140, 142, 144, 146, 148, 150, 152로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 107로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 140, 142, 144, 146, 148, 150, 152로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 154, 156, 158, 160, 162, 164, 166로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 107로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 154, 156, 158, 160, 162, 164, 166로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 168, 170, 172, 174, 176, 178, 180로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 182, 184, 186, 188, 190, 192, 194으로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 224, 226, 228, 230, 232, 234, 236로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 210, 212, 214, 216, 218, 220, 222로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 224, 226, 228, 230, 232, 234, 236로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 111로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 224, 226, 228, 230, 232, 234, 236로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 113으로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 224, 226, 228, 230, 232, 234, 236로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 115로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 238, 240, 242, 244, 246, 248, 250로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 111로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 238, 240, 242, 244, 246, 248, 250로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 113로 표시되는 아미노산 서열을 포함하는 경쇄;
서열번호 238, 240, 242, 244, 246, 248, 250로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 115로 표시되는 아미노산 서열을 포함하는 경쇄; 또는
서열번호 196, 198, 200, 202, 204, 206, 208으로 표시되는 아미노산 서열 중 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 및 서열번호 111로 표시되는 아미노산 서열을 포함하는 경쇄를 포함하는 항체이다.
본 발명은 상기 항체 또는 그 단편을 유효성분으로 포함하는 면역세포 이동 관련 질환 예방 또는 치료용 조성물 및 면역세포 이동 관련 질환의 진단용 조성물을 제공한다.
본 발명에서 용어‘면역세포 이동 관련 질환’은, 당업계에 과도한 면역세포 이동(또는/및 침윤)이 주요한 발병 기전인 것으로 공지된 것이라면 그 구체적 종류가 특별히 제한되지 않으나, 예를 들어 심혈관 질환, 섬유화 질환, 염증성 질환 및 알포트 증후군(Alport syndrome) 으로 이루어진 군에서 선택되는 것일 수 있다.
상기 심혈관 질환은 그 구체적 종류가 특별히 제한되지 않으나, 예를 들어 고혈압(고혈압에 의한 염증성 합병증 포함), 폐동맥 고혈압, 죽상동맥경화, 협심증, 심근경색증, 허혈성 뇌혈관질환, 세동맥 경화 및 중막 경화로 이루어진 군에서 선택되는 것일 수 있다.
상기 섬유화 질환은 그 구체적 종류가 특별히 제한되지 않으나, 예를 들어 경피증(scleroderma), 류마티스 관절염(rheumatoid arthritis), 크론 병(Crohn's disease), 궤양성 대장염 (ulcerative colitis), 골수 섬유증 (myelofibrosis), 폐 섬유증(pulmonary fibrosis), 간 섬유증(hepathic fibrosis), 간경변증(liver cirrhosis), 신장 섬유증(kidney fibrosis), 사구체 경화증, 근섬유증(myofibrosis), 심장 섬유증, 간질성 섬유화증, 췌장 섬유화증, 비장 섬유화증, 종격막 섬유화증, 혈관 섬유화증, 피부 섬유화증, 눈 섬유화증, 황반 변성, 관절 섬유화증, 갑상선 섬유화증, 심내막심근 섬유화증, 복막 섬유화증, 복막후 섬유화증, 진행성 종괴성 섬유화증, 신원성 전신섬유화증, 전신성 홍반성 루푸스 (systemic lupus erythematosu), 유전성 섬유증, 감염성 섬유증, 자극성 섬유증, 만성 자가면역에 의한 섬유증, 장기이식 시 항원부적합에 의한 섬유증, 외과수술의 섬유성 합병증, 고지혈증에 의한 섬유증, 비만에 의한 섬유증, 당뇨성 섬유증, 고혈압에 의한 섬유증 및 스텐트 삽입 시 섬유화로 인한 폐색으로 이루어진 군에서 선택되는 것일 수 있다.
본 발명에서 상기 염증성 질환은 그 종류가 특별히 제한되지는 않지만, 바람직하게는 자가 면역 질환, 염증성 장 질환, 피부염(예를들어 아토피성 피부염, 습진, 건선증 등), 당뇨성 안질환(당뇨병성 망막증 등), 복막염, 골수염, 봉소염, 뇌막염, 뇌염, 췌장염, 외상 유발 쇼크, 기관지 천식, 비염, 부비동염, 중이염, 폐렴, 위염, 장염, 낭포성 섬유증, 졸중(卒中, 뇌졸중 등), 기관지염, 세기관지염, 간염(간경변, 무알콜성 지방간염 (non-alcoholic steatohepatitis) 등), 신장염(당뇨병성 신부전증 등), 단백뇨증, 관절염(건선성 관절염, 골관절염 등), 신경염(당뇨병성 신경병증 , 다발성 경화증 등), 통풍, 척추염, 라이터 증후군, 결절성 다발동맥염, 혈관염, 루게릭병, 베게너 육아종증, 과사이토카인 혈증(hypercytokinemia), 류마티스성 다발성근육통, 관절 세포 동맥염, 칼슘 결정 침착 관절병증, 가성 통풍, 비-관절 류마티즘, 점액낭염, 건초염, 상과염(테니스 엘보), 신경병증성 관절 질환(Charcot's joint), 출혈성관절증(hemarthrosis), 헤노흐-쉔라인 자반병, 비후성 골관절병증, 다중심성 세망조직구종, 수르코일로시스(surcoilosis), 혈색소증, 겸상 적혈구증, 고지단백혈증, 저감마글로불린혈증, 부갑상선기능항진증, 말단거대증, 가족성 지중해열, 베하트 병, 전신성 홍반성 루푸스, 재귀열, 건선, 다발성 경화증, 패혈증, 패혈성 쇼크, 급성 호흡곤란 증후군, 다발성 장기부전, 만성 폐쇄성 폐질환(chronic obstructive pulmonary disease), 급성 폐손상(acute lung injury) 및 기관지 폐 형성장애(broncho-pulmonary dysplasia) 로 이루어진 군에서 선택될 수 있으며, 또한 만성 염증질환을 포함한다.
본 발명에서 자가면역 질환은 류마티스성 관절염, 전신성 경피증, 전신 홍반성 낭창, 건선, 천식, 궤양성 대장염, 베체씨병, 크론씨병, 다발성 경화증, 피부근염, 교원병, 혈관염, 관절염, 육아종증, 장기 특이적 자가면역병변, 궤양성 대장염 및 GvHD (이식편대 숙주 반응 질환: graft-versus-host disease)으로 이루어진 군에서 선택되는 것일 수 있다.
상기 만성 염증 질환은 전술한 염증성 질환의 종류를 참조로 하여 이들이 만성(chronic)화 된 상태를 포함하는 의미이며, 이들의 바람직한 일례로는 천식, 아토피성 피부염, 습진, 건선증, 골관절염, 통풍, 건선성 관절염, 간경변, 무알콜성 지방간염, 만성폐쇄성 폐질환, 비염, 당뇨병성 망막증, 당뇨병성 신부전증, 당뇨병성 신경병증 및 다발성 경화증 등이 있으나, 이에 제한되지 않는다.
또한 본 발명의 항체는 면역세포 이동 관련 질환으로 투병 중인 개체에 약학적으로 유효한 양으로 투여될 수 있다. 상기에서 '약학적으로 유효한 양'이란 음성 대조군에 비해 그 이상의 반응을 나타내는 양을 말하며 바람직하게는 면역세포 이동 관련 질환을 치료하기에 충분한 양을 말한다. 본 발명의 항체 또는 그 단편의 총 유효량, 상기 조성물의 제형, 투여 방법 및 투여 경로는 상기에 기재되어 있다.
본 발명의 약학적 조성물은 면역세포 이동 관련 질환의 예방 또는 치료를 위하여 단독으로, 또는 수술, 호르몬 치료, 화학 치료 및 생물학적 반응 조절제를 사용하는 방법들과 병용하여 사용할 수 있다.
본 발명에 따른 면역세포 이동 관련 질환의 진단 및 예후 평가는 생물학적 시료 중에서 KRS 단백질(특히, 세포 외막에 노출된 KRS N-말단 영역)을 검출함으로써 수행될 수 있다.
또한, 본 발명은 암 및 암 전이 예방 또는 억제용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공한다.
또한, 본 발명은 상기 항체 또는 그 단편을 포함하는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 암 및 암 전이 예방 또는 억제 방법을 제공한다.
또한, 본 발명은 암 또는 암 전이 진단용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공한다.
본 발명은
a) 암 전이가 의심되는 개체(피검체)로부터 생물학적 시료를 수득하는 단계;
b) 상기 시료 또는 개체에 상기 항체 또는 그 단편을 포함하는 조성물을 투여하는 단계;
c) 상기 b) 단계의 시료 또는 개체에서 KRS 단백질의 발현 수준을 검출하는 단계; 및
d) 상기 KRS 단백질의 발현 수준이 정상 대조군과 비교하여, KRS 단백질의 발현 수준이 증가하는 경우에 암 및 암 전이가 발생한 것으로 진단하는 단계를 포함하는, 암 또는 암 전이 진단 방법을 제공한다.
본 발명은 면역세포 이동 관련 질환의 치료용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공한다.
본 발명은 면역세포 이동 관련 질환의 진단용 제제를 제조하기 위한 상기 항체 또는 그 단편의 용도를 제공한다.
본 발명은 상기 항체 또는 그 단편을 포함하는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 면역세포 이동 관련 질환의 치료 방법을 제공한다.
본 발명은
a) 면역세포 이동 관련 질환이 의심되는 개체로부터 생물학적 시료를 수득하는 단계;
b) 상기 시료 또는 개체에 상기 항체 또는 그 단편을 포함하는 조성물을 투여하는 단계;
c) 상기 b) 단계의 시료 또는 개체에서 KRS 단백질의 발현 수준을 검출하는 단계; 및
d) 상기 KRS 단백질의 발현 수준을 정상 대조군과 비교하여, KRS 단백질의 발현 수준이 증가하는 경우에 면역세포 이동 관련 질환인 것으로 진단하는 단계를 포함하는, 면역세포 이동 관련 질환 진단 방법을 제공한다.
하나의 실시양태에서, 본 발명은 하기 단계를 포함하는 암 및 암 전이 진단 및 치료 방법을 제공한다:
a) 암 전이가 의심되는 개체(피검체)로부터 생물학적 시료를 수득하는 단계;
b) 상기 시료 또는 개체에 상기 항체 또는 그 단편을 투여하는 단계;
c) 상기 b) 단계의 시료 또는 개체에서 KRS 단백질의 발현 수준을 검출하는 단계;
d) 상기 KRS 단백질의 발현 수준이 정상 대조군과 비교하여, KRS 단백질의 발현 수준이 증가하는 경우에 암 및 암 전이가 발생한 것으로 진단하는 단계; 및
e) 상기 진단된 개체에 암 및 암 전이를 치료하기 위한 치료 약물을 투여하거나 수술을 통해 상기 질환을 치료하는 단계.
하나의 실시양태에서, 본 발명은 하기 단계를 포함하는 면역세포 이동 관련 질환 진단 및 치료 방법을 제공한다:
a) 면역세포 이동 관련 질환이 의심되는 개체로부터 생물학적 시료를 수득하는 단계;
b) 상기 시료 또는 개체에 상기 항체 또는 그 단편을 투여하는 단계;
c) 상기 b) 단계의 시료 또는 개체에서 KRS 단백질의 발현 수준을 검출하는 단계;
d) 상기 KRS 단백질의 발현 수준을 정상 대조군과 비교하여, KRS 단백질의 발현 수준이 증가하는 경우에 면역세포 이동 관련 질환인 것으로 진단하는 단계; 및
e) 상기 진단된 개체에 면역세포 이동 관련 질환을 치료하기 위한 치료 약물을 투여하거나 수술을 통해 상기 질환을 치료하는 단계.
상기 e) 단계는 상기 d) 단계에서 질환이 진단된 개체에, 치료 약물 투여 또는 수술 등의 수단을 통해 상기 질환의 치료를 수행하는 단계이다.
본 발명의 상기 '치료’는 암 및 암 전이 또는 면역세포 이동 관련 질환의 증상을 개선시키는 것을 포괄적으로 지칭하고, 이는 암 및 암 전이 또는 면역세포 이동 관련 질환을 치유하거나, 실질적으로 예방하거나, 또는 상태를 개선시키는 것을 포함할 수 있으며, 상기 질환으로부터 비롯된 한 가지 증상 또는 대부분의 증상을 완화시키거나, 치유하거나 예방하는 것을 포함하나, 이에 제한되는 것은 아니다.
상기 치료 약물은 통상적으로 암, 암 전이 또는 면역세포 이동 관련 질환의 치료에 대하여 사용되는 약물 종류라면 그 종류가 특별히 제한되지 않으며, 하나의 실시양태에서 항암제, 항염증제(대표적 일례로 스테로이드제 등) 및 폐동맥 고혈압 치료제 등으로 이루어지는 군에서 선택되는 하나 이상의 약물을 처리하는 것일 수 있으나, 이에 제한되는 것은 아니다. 상기 치료 약물은 ‘치료학적으로 유효한 양’으로 개체에 투여되며, 상기 치료학적으로 유효한 양은 당업자가 약물의 고유성질, 투여 경로 및 치료 횟수뿐만 아니라 환자의 연령, 체중, 건강 상태, 성별, 질환의 중증도, 식이 및 배설율 등 다양한 요인들을 고려하여 환자에 대한 유효 투여량을 결정할 수 있다. 상기 치료 약물의 투여 경로는 특별히 제한되지 않으며, 경구 또는 비경구적으로 투여되는 것일 수 있으며, 국소적 투여 뿐만 아니라 전신적 경로의 투여를 모두 포함한다. 상기 비경구적 투여는, 이에 제한되지 않으나, 일례로 비강내 약물 도포, 피하주사 등일 수 있으며, 또 다른 일례로 근육내 주사, 정맥 주사 등의 방법을 사용하는 것일 수 있다.
본 발명의 용어 ‘~을 포함하는(comprising)’이란 ‘함유하는’ 또는 ‘특징으로 하는’과 동일하게 사용되며, 조성물 또는 방법에 있어서, 언급되지 않은 추가적인 성분 요소 또는 방법 단계 등을 배제하지 않는다. 용어 ‘~로 구성되는(consisting of)’이란 별도로 기재되지 않은 추가적인 요소, 단계 또는 성분 등을 제외하는 것을 의미한다. 용어 ‘필수적으로 구성되는(consisting essentially of)’이란 조성물 또는 방법의 범위에 있어서, 기재된 성분 요소 또는 단계와 더불어 이의 기본적인 특성에 실질적으로 영향을 미치지 않는 성분 요소 또는 단계 등을 포함하는 것을 의미한다.
따라서, 본 발명은 본 명세서에서 기재하는 특정 CDR(상보성 결정부위) 서열을 가지며 세포 외막에 노출되는 KRS N-말단 영역에 특이적으로 결합하는 항체를 제공한다. 본 발명의 방법은 기존의 항체보다 KRS N-말단에 친화도가 높은 항체를 제조하는 데에 유용하게 이용될 수 있다.
도 1은 KRS N말단 표적 항체 N3의 KRS N 말단에 대한 친화도 향상을 위해 N3의 중쇄가변영역(VH)과 경쇄가변영역(VL) 각각을 기반으로 구축된 두 개의 라이브러리의 선별 및 구축 전략을 모식도로 나타낸 것이다.
도 2a는 FACS(Fluorescence Activated Cell Sorting)을 이용하여 선별된 각 단계별 라이브러리 발현 효모에 대해서 10 nM, 1 nM 또는 0.1 nM GST가 결합된 KRS (1-72) peptide와 분석한 결합능을 유세포 분석기 (FACS)로 분석한 결과를 나타낸 것이다.
도 2b는 최종 선별된 라이브러리 중 각각 47개의 개별클론을 발현하는 효모에 대해서 0.1 nM GST가 결합된 KRS (1-72) peptide와 결합능을 유세포 분석기로 분석한 결과를 나타낸 것이다.
도 3a 및 도 3b는 KRS (1-72) peptide에 고친화도 및 특이성을 갖는 것으로 선별된 N3-1 항체, N3-3 항체, N3-4 항체 및 N3-5 항체의 KRS의 N말단에 대한 친화도를 측정하기 위한 ELISA 결과를 나타낸 것이다.
도 4는 N3 항체와 N3-1 항체의 세포 이동 저해 효과를 확인한 결과를 나타낸 것이다.
도 5는 N3 항체와 N3-1 항체의 KRS 친화도를 SPR(surface plasmon resonance)방법으로 비교한 결과를 나타낸 것이다.
도 6은 MACS 및 FACS (Fluorescence Activated Cell Sorting)를 이용하여 선별된 각 단계별 라이브러리 발현 효모에 대해서 10 nM, 1 nM 또는 0.1 nM GST가 결합된 KRS (1-72) peptide와 분석한 결합능을 유세포 분석기 (FACS)로 분석한 결과를 나타낸 것이다.
도 7은 N3-1 항체, N3-6 항체, N3-7 항체, N3-8 항체 및 N3-9 항체의 KRS의 N말단에 대한 친화도를 측정하기 위한 ELISA 결과를 나타낸 것이다.
도 8은 N3-6 항체, N3-7 항체, N3-8 항체, N3-9 항체의 KRS 친화도를 SPR(surface plasmon resonance)방법으로 비교한 결과를 나타낸 것이다.
도 9는 N3 항체, N3-1 항체, N3-6 항체, N3-7 항체, N3-8 항체, N3-9 항체 세포 이동 저해 효과를 확인한 결과를 나타낸 것이다.
도 10은 N3 항체 및 N3-8 항체가 유방암 세포에서 엔도사이토시스(endocytosis)를 IHC(immunohistochemistry) 방법으로 확인한 결과를 나타낸다.
도 11은 N3 항체 투여에 의한 폐동맥 고혈압(PAH) 모델의 우심실 수축기말 압력(right ventricular end-systolic pressure; RVESP) 변화를 나타낸다(Mock IgG: 음성 대조군, Ab 1mpk: N3 항체 1mpk, Ab 10mpk : N3 항체 10mpk, sildenafil: 양성 대조군).
도 12는 폐동맥 고혈압(PAH) 모델에서 N3 항체 투여에 의해 면역세포 이동 및 침윤이 감소되었음을 IHC 염색으로 확인한 결과이다.
도 13은 급성 폐손상 마우스 모델의 BALF(Bronchoalveolar lavage fluid) 내에 증가된 총(total) 면역세포수가, N3 항체(KRS N-말단 결합 항체)의 처리 농도 의존적으로 감소됨을 확인한 결과를 나타낸다.
도 14는 급성 폐손상 마우스 모델의 BALF(Bronchoalveolar lavage fluid) 내에 특히 많이 증가되어있는 호중구(뉴트로필)이, N3 항체(KRS N-말단 결합 항체)의 처리 농도 의존적으로 감소됨을 확인한 결과를 나타낸다.
도 15는 급성 폐손상 마우스 모델의 폐 조직 내에 증가된 대식세포(IM, CD11b+/F4/80+) 이동 및 침윤이, N3 항체(KRS N-말단 결합 항체)의 처리 농도 의존적으로 감소됨을 FACS로 확인한 결과를 나타낸다.
도 16은 상기 도 15의 결과를 정량화하여 그래프로 나타낸 결과이다.
도 17은 급성 폐손상 마우스 모델의 폐 조직 내에 진행된 조직 섬유화가 N3 항체(KRS N-말단 결합 항체)의 처리에 의하여 억제됨을 보여주는 조직 이미지이다. 각 실험군 및 대조군의 조직은 Masson's trichrome 염색 처리된 후 현미경 관찰되었다.
도 18은 N3-8, N3-8-1 항체 및 ADCC/CDC 기능을 제거한 N3-8-1 항체 처리에 의하여 세포 이동(cell migration)이 억제됨을 확인한 결과를 나타낸다.
도 19는 N3-8, N3-8-1 항체 및 ADCC/CDC 기능을 제거한 N3-8-1 항체 처리에 의하여 암세포의 세포 이동(cell migration)이 억제되는 것을 확인한 결과를 나타낸다.
이하 본 발명을 상세히 설명한다.
단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 한정되는 것은 아니다.
실시예 1: 친화도 증가를 위한 효모 세포 표면 발현 라이브러리의 구축
기존 KRS의 N 말단을 표적하는 항체 N3(출원번호: 10-2018-0035446)의 N 말단에 대한 친화도는 약 150nM 수준으로, 완전한 IgG 형태의 다양한 항체들의 친화도에 비해 낮은 수준이다. 이에, 친화도를 증가시켜 보다 더 좋은 효과를 갖는 항체를 제조하기 위해, N3 항체의 경쇄가변영역과 중쇄가변영역을 개량하였다.
Homology 모델을 이용하여 N3의 대략적인 구조를 예측하였고, 이를 통해 항원 결합에 중요한 역할을 할 것으로 예측되는 CDR 부위에 무작위적인 돌연변이를 도입하였다. 구체적으로는 중쇄가변영역을 기반으로 한 라이브러리에서는, CDR3의 잔기를 20개의 모든 아미노산 서열을 포함할 수 있는 디제너레이트 코돈(degenerated codon)인 NNK를 사용하였다. 경쇄가변영역을 기반으로 한 라이브러리에서는 CDR3의 잔기를 20개의 모든 아미노산 서열을 포함할 수 있는 디제너레이트 코돈(degenerated codon)인 NNK를 사용하였다.
구체적으로, 디자인된 라이브러리를 코딩하는 DNA는 PCR 기법을 이용하여 증폭 후 에탄올 침전법을 사용하여 농축하였다. 상동성 접합(Homologous recombination)을 위한 C-말단에 aga2 단백질이 발현되는 효모표면발현 벡터(C-aga2)는 NheI과 MluI 제한효소를 처리하여 아가로스 젤 추출법을 이용하여 정제 및 에탄올 침전법을 이용하여 농축하였다. 각각 라이브러리 코딩 DNA 12 μg에 대하여 제한효소 처리된 4 μg 벡터를 효모표면 발현용 효모 EBY100에 전기천공법으로 형질전환하였고, 계단식 희석(serial dilution)을 통해 선택배지 SD-CAA (20 g/L Glucose, 6.7 g/L Yeast nitrogen base without amino acids, 5.4 g/L Na 2HPO 4, 8.6 g/L NaH 2PO 4, 5 g/L casamino acids)에 자란 콜로니의 수를 측정하여 라이브러리 크기를 확인하였다.
이 과정을 도 1에 나타내었다.
실시예 2. GST가 결합된 KRS (1-72) peptide에 친화도가 개량된 경쇄가변영역 ( VL ) 및 중쇄가변영역 (VH) 선별
GST가 결합된 KRS (1-72) peptide를 항원으로 이용하여 상기 실시예 1에서 구축된 2가지 종류의 N3 기반 친화도 개량 라이브러리를 선별하였다.
구체적으로, 1차 FACS 스크리닝을 위해 10 nM 수준의 정제된 GST가 결합된 KRS(1-72) peptide를 SG-CAA(20 g/L Galactose, 6.7 g/L Yeast nitrogen base without amino acids, 5.4 g/L Na 2HPO 4, 8.6 g/L NaH 2PO 4, 5 g/L casamino acids) 배지를 이용하여 세포 표면에 단일사슬 Fab(scFab) 형태의 경쇄가변영역 라이브러리 발현을 유도한 효모와 상온에서 1시간 동안 반응시켰다. 이후 GST가 결합된 KRS(1-72) peptide와 라이브러리를 발현하는 효모를 PE가 접합된 스트렙타아비딘(Streptavidin-R-phycoerythrin conjugate, SA-PE)와 4℃에서 20분간 반응하여 FACS(Fluorescence activated cell sorting, FACS Caliber; BD biosciences)를 통해 부유화하였다. 이후 동일한 방법으로 1 nM의 GST가 결합된 KRS(1-72) peptide로 2차 FACS 스크리닝을 하였으며, 0.5 nM의 GST가 결합된 KRS(1-72) peptide로 3차 FACS 스크리닝을 진행하였다.
그 결과 도 2a 및 도 2b에 나타난 바와 같이, FACS를 이용한 선별과정을 통하여, N3 항체와 비교하여 중쇄가변영역(VH) 또는 경쇄가변영역(VL) 의존적으로 GST가 결합된 KRS(1-72) peptide에 대한 높은 친화도를 갖는 클론들이 선별되는 것을 확인하였으며, 개별클론 결합능 분석을 통해 GST가 결합된 KRS(1-72) peptide에 고친화도 및 특이성을 갖는 3개의 유니크한 클론(N3-1, N3-3, N3-4를 선별하였다. 또한 이들의 경쇄가변영역 및 중쇄가변영역을 서로 조합하여 또 다른 1개의 유니크한 클론(N3-5)를 구축하였다. 즉, 총 4개의 유니크한 클론(N3-1, N3-3, N3-4, N3-5)을 선별하였다.
GST가 결합된 KRS (1-72) peptide에 높은 결합능을 보이는 4개의 개별클론의 경쇄가변영역 및 중쇄가변영역의 CDR 서열을 표 1에 나타내었고, 중쇄가변영역 서열 및 경쇄가변영역 서열을 표 2에 나타내었다.
Heavy Light
CDR H1 CDR H2 CDR H3 CDR L1 CDR L2 CDR L3
N3 SYDMS(서열번호 1) AISYDNGNTYYADSVKG(서열번호 3) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) ASWDDSLSAYV(서열번호 11)
N3-1 SYDMS(서열번호 1) AISYDNGNTYYADSVKG(서열번호 3) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) ASFSDELGAYV(서열번호 13)
N3-3 SYDMS(서열번호 1) AISYDNGNTYYADSVKG(서열번호 3) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) SSFSDELGAYV(서열번호 15)
N3-4 SYDMS(서열번호 1) VISSDGGNTYYADSVKG(서열번호 118) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) ASFSDELGAYV(서열번호 13)
N3-5 SYDMS(서열번호 1) VISSDGGNTYYADSVKG(서열번호 118) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) SSFSDELGAYV(서열번호 15)
서열 서열번호(서열명칭)
N3 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISYDNGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYSARMALDFDYWGQGTLVTVSS 서열번호 31(N3 VH)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCASWDDSLSAYVFGGGTKLTVL 서열번호 33(N3 VL)
N3-1 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISYDNGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYSARMALDFDYWGQGTLVTVSS 서열번호 31(N3 VH)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCASFSDELgAYVFGGGTKLTVL 서열번호 49(N3 VL mutant 1)
N3-3 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISYDNGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYSARMALDFDYWGQGTLVTVSS 서열번호 31(N3 VH)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELgAYVFGGGTKLTVL 서열번호 51(N3 VL mutant 2)
N3-4 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSVISSDGGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYSARMALDFDYWGQGTLVTVSS 서열번호 35(N3 VH mutant 1)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCASFSDELgAYVFGGGTKLTVL 서열번호 49(N3 VL mutant 1)
N3-5 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSVISSDGGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYSARMALDFDYWGQGTLVTVSS 서열번호 35(N3 VH mutant 1)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELgAYVFGGGTKLTVL 서열번호 51(N3 VL mutant 2)
또한, KRS의 N말단에 대한 친화도가 증가되었는지 확인하기 위해 KRS의 N말단에 대한 친화도를 측정하기 위하여 ELISA를 실시하였다.
구체적으로는, KRS의 N말단 부분(1-72)을 96 웰 EIA/RIA 플레이트(COSTAR Corning)에 1시간 동안 25℃에서 결합시킨 후, PBS(pH 7.4, 137 mM NaCl, 12mM phosphate, 2.7 mM KCl)(SIGMA)로 10분간 3회 씻어낸다. 이후, 4% BSA PBS(4% Bovine Serum Albumin, pH7.4, 137 mM NaCl, 12mM phosphate, 2.7 mM KCl)(SIGMA)로 1시간 동안 결합시킨 다음, PBS로 10분간 3회 씻어낸다. 그 다음, IgG 형태의 KRS N말단 표적 항체인 N3, N3-1, N3-3, N3-4, N3-5를 결합시킨 후, 0.1 % PBST로 10분간 3회 씻어낸다. 표지항체로는 HRP가 접합된 항-인간 항체(Horseradish peroxidase-conjugated anti-human mAb)(SIGMA)를 사용하였다. 그 다음, TMB(3,3',5,5'-Tetramethylbenzidine)(Sigma)로 반응시켜 450nm 흡광도에서 측정하여 정량하였다.
그 결과 도 3a 및 도 3b에 나타난 바와 같이, 야생형인 N3 항체에 비해 돌연변이인 N3-1, N3-3, N3-4, N3-5 항체의 친화도가 증가하는 것을 확인할 수 있었다. 음성 대조군으로 사용된 GST 또는 NRP1-b1b2에 대해서는 모든 클론이 결합하지 않은 것으로 나타났다. 돌연변이 항체인 N3-1, N3-3, N3-4, N3-5 간의 KRS 결합력에는 큰 차이가 없는 것으로 나타났다.
실시예 3: N3 항체와 N3-1 항체의 친화도 비교
3-1. 항체의 세포 이동 저해 효과
상기 실시예 2의 N3 돌연변이 항체들 중, N3-1 항체를 통상적인 방법을 이용하여, IgG 항체로 전환하였다. 전환한 IgG 항체를 이용하여 다음 실험을 실시하였다.
세포 이동은 통상적으로 사용되는 폴리카보네이트 막(8.0μm pore size, Costar)을 가진 24-웰 트랜스웰 챔버를 이용하여 측정하였다. 트렌스웰 챔버에서 lower well을 10μg 라미닌(Laminin)으로 코팅하였다. 그 다음, A549 세포를 무혈청(serum-free) RPMI 배지에 현탁하였고, 각 웰당 1 x 10 5세포의 농도로 상위 챔버에 넣어주었다. N3 및 N3-1 IgG, human mock IgG(대조군)를 각각 10 nM 또는 100 nM로 상기 챔버에 처리하여 24시간 동안 배양하였다. Membrane 위쪽에 존재하는 non-migrating 세포를 면봉으로 제거하였다. 그 다음, PBS로 2회 세척하고, 70% MeOH(in PBS)를 30분 동안 처리하였다. PBS로 2회 세척한 다음, Hematoxylin solution을 30분 동안 처리하였다. 그 다음 챔버를 DW로 3회 세척한 뒤, 챔버 내의 막(membrane)을 자르고 slide glass위에 마운팅하여 관찰하였다.
그 결과 도 4에 나타난 바와 같이, N3-1 항체가 N3 항체에 비해 A549세포의 이동을 현저하게 억제하는 것을 확인할 수 있었다.
3-2. 항체의 KRS 친화도 효과
KRS 조각(1-207aa) 정제 단백질을 항원으로 사용하여, Surface Plasmon Resonance(SPR)를 통해 N3 및 N3-1 항체와의 결합력을 분석하였다.
SPR 실험은 25℃에서 Series S 센서 칩 CM5(GE Healthcare)가 장착된 Biacore T200(GE Healthcare)을 사용하여 실시하였다. 아민 커플링 키트(GE Healthcare)를 이용하여 항체를 칩에 고정한 뒤, 항원을 4.8 nM-1250 nM 범위에서 PBS 용액에 4 배수 희석하여 60초간 흘려주었다. 이후 300초 동안 PBS를 흘려주었다. 얻어진 data는 Biacore T200 Evaluation 소프트웨어 v2.0(GE Healthcare)으로 분석하였다.
그 결과 도 5에 나타난 바와 같이, N3-1 항체의 KD 값이 31 nM로 측정되어 N3 항체보다 KRS 단백질에 대한 결합력이 증가하는 것을 확인할 수 있었다.
실시예 4: 친화도 증가를 위한 효모 세포 표면 발현 라이브러리의 구축(N 3-1 항체)
상기 실시예 2에서 도출된 KRS의 N말단을 표적하는 N3-1, N3-3, N3-4, N3-5 항체들은 KRS에 대한 친화도가 유사하며, N3-1 항체의 결과에서 나타난 바와 같이, 약 31 nM 수준의 친화도를 가지는 것으로 판단된다. 이는 완전 IgG 형태의 다양한 항체들의 친화도와 비교했을 때 여전히 낮은 수준이다. 이를 증가시켜 더욱 효과적인 항체를 얻기 위해 항체의 중쇄가변영역을 집중적으로 개량하고자 하였다.
경쇄 가변영역 서열을 N3-3으로 고정하고 homology modeling을 이용하여 N3-3의 대략적인 modeling 구조를 예측하였으며, 이를 통해 항원 결합에 중요한 역할을 할 것이라 예측되는 CDR에 무작위적인 돌연변이를 도입하였다.
구체적으로, 중쇄가변영역의 CDR2와 CDR3의 잔기를 20개의 모든 아미노산 서열을 포함할 수 있는 디제너레이트 코돈 (degenerated codon)인 NNK를 사용하였으며, 실시예 1과 동일한 방법으로 라이브러리를 구축하였다.
실시예 5. GST가 결합된 KRS (1-72) peptide에 친화도가 개량된 경쇄가변영역 ( VL ) 및 중쇄가변영역 (VH) 선별
GST가 결합된 KRS (1-72) peptide를 항원으로 이용하여 상기 실시예 4에서 구축된 2가지 종류의 N3-3 기반 친화도 개량 라이브러리를 선별하였다. N3-3과 N3-1의 친화도가 거의 동일한 것으로 판단되고 서열이 거의 유사하므로 항체 비교실험은 N3-1로 진행하였다.
구체적으로, GTP가 결합된 KRS (1-72) peptide와 결합된 라이브러리를 발현하는 효모를 스트렙타아비딘(Streptavidin) Microbead TM (Miltenyi Biotec)와 4℃에서 20분간 반응시킨 후 MACS (magnetic activated cell sorting)를 이용하여 GTP가 결합된 KRS (1-72) peptide에 고친화도를 가지는 중쇄가변영역을 발현하는 효모를 부유화하였다. 상기 선별된 라이브러리를 발현하는 효모를 SG-CAA(20 g/L Galactose, 6.7 g/L Yeast nitrogen base without amino acids, 5.4 g/L Na 2HPO 4, 8.6 g/L NaH 2PO 4, 5 g/L casamino acids) 배지에서 배양하여, 라이브러리 발현을 유도하였다. 그 다음. 실시예 2와 동일한 방법으로 FACS로 스크리닝 하였다.
10 nM의 GST가 결합된 KRS(1-72) peptide로 1차 FACS 스크리닝하였고, 1 nM의 GST가 결합된 KRS(1-72) peptide로 2차 FACS 스크리닝을 하였고, 0.5 nM의 GST가 결합된 KRS(1-72) peptide로 3차 FACS 스크리닝을 하였으며, 0.1 nM의 GST가 결합된 KRS (1-72) peptide로 4차 FACS 스크리닝을 진행하였다.
그 결과 도 6에 나타난 바와 같이, MACS 및 FACS (Fluorescence Activated Cell Sorting)를 이용한 선별과정을 통하여, N3-1 항체와 비교하여 GST가 결합된 KRS (1-72) peptide에 대해 중쇄가변영역(VH) 의존적으로 높은 친화도를 갖는 클론들이 선별되는 것을 확인하였으며, 개별클론 결합능 분석을 통해 GST가 결합된 KRS (1-72) peptide에 고친화도 및 특이성을 갖는 4개의 유니크한 클론(N3-6, N3-7, N3-8, N3-9)을 선별하였다.
GST가 결합된 KRS (1-72) peptide에 높은 결합능을 보이는 4개의 개별클론의 경쇄가변영역 및 중쇄가변영역의 CDR 서열을 표 3에 나타내었고, 중쇄가변영역 서열 및 경쇄가변영역 서열을 표 4에 나타내었다.
Heavy Light
CDR H1 CDR H2 CDR H3 CDR L1 CDR L2 CDR L3
N3-6 SYDMS(서열번호 1) AISPQMGRVYYADSVKG(서열번호 17) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) SSFSDELGAYV(서열번호 15)
N3-7 SYDMS(서열번호 1) AIDPLGGNIYYADSVKG(서열번호 19) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) SSFSDELGAYV(서열번호 15)
N3-8 SYDMS(서열번호 1) AISPYSGRIYYADSVKG(서열번호 21) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) SSFSDELGAYV(서열번호 15)
N3-9 SYDMS(서열번호 1) AIGADGGPSYYADSVKG(서열번호 23) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) SSFSDELGAYV(서열번호 15)
서열 서열번호(서열명칭)
N3-6 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISPQMGRVYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYSARMALDFDYWGQGTLVTVSS 서열번호 37(N3 VH mutant 2)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELgAYVFGGGTKLTVL 서열번호 51(N3 VL mutant 2)
N3-7 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAIDPLGGNIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYSARMALDFDYWGQGTLVTVSS 서열번호 39(N3 VH mutant 3)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELgAYVFGGGTKLTVL 서열번호 51(N3 VL mutant 2)
N3-8 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISPYSGRIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARMALDFDYWGQGTLVTVSS 서열번호 45(N3 VH mutant 6)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELgAYVFGGGTKLTVL 서열번호 51(N3 VL mutant 2)
N3-9 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAIGADGGPSYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYSARMALDFDYWGQGTLVTVSS 서열번호 43(N3 VH mutant 5)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELgAYVFGGGTKLTVL 서열번호 51(N3 VL mutant 2)
또한, KRS의 N말단에 대한 친화도가 증가되었는지 확인하기 위해 KRS의 N말단에 대한 친화도를 측정하기 위하여, 실시예 2와 동일한 방법으로 ELISA를 실시하였다.
구체적으로는, KRS의 N말단 부분(1-72)을 96 웰 EIA/RIA 플레이트(COSTAR Corning)에 1시간 동안 25℃에서 결합시킨 후, PBS로 10분간 3회 씻어낸다. 이후, 4% BSA PBS로 1시간 동안 결합시킨 다음, PBS로 10분간 3회 씻어낸다. 그 다음, IgG 형태의 KRS N말단 표적 항체인 N3-1, N3-6, N3-7, N3-8, N3-9를 결합시킨 후, 0.1 % PBST로 10분간 3회 씻어낸다. HRP가 접합된 항-인간 항체를 사용하였으며, TMB(3,3',5,5'-Tetramethylbenzidine)로 반응시켜 450nm 흡광도에서 측정하여 정량하였다.
그 결과 도 7에 나타난 바와 같이, N3-1 항체에 비해 돌연변이인 N3-6, N3-7, N3-8, N3-9 항체의 친화도가 증가하는 것을 확인할 수 있었다. 음성 대조군으로 사용된 NRP1-b1b2에 대해서는 모든 클론이 결합하지 않은 것으로 나타났다.
실시예 6: N3-1 항체와 N3-6, N3-7, N3-8, N3-9 항체의 친화도 비교
6-1. 항체의 KRS 결합 비교
KRS epitope peptide F4(EPKLSKNELKRRLKAEKKVAEKEAKQKE: 서열번호 117) 를 항원 epitope로 사용하여, Surface Plasmon Resonance(SPR)를 통해 N3, N3-6, N3-7, N3-8, N3-9 항체와의 결합력을 분석하였다. SPR 실험은 상기 실시에 3-2와 동일한 방법으로 실시하였으며, epitope를 PBS 용액에 희석하여 15.7 nM-4000 nM 범위에서 2배수 희석하여 90초간 흘려주었다. 이후 2400초 동안 PBS를 흘려주었다. 얻어진 data는 Biacore T200 Evaluation 소프트웨어 v2.0 (GE Healthcare)으로 분석하였다.
그 결과 도 8에 나타난 바와 같이, N3-8 항체의 KD가 가장 우수한 것으로 나타났으며, N3-9, N3-6 항체가 유사한 KD 값을 나타냈고, N3-7 항체의 KD 값이 가장 크게 나타났다. N3-6 항체 해리(dissociation)가 N3-7, N3-9보다 길고 결합이 더 오래 유지되는 sensorgram을 나타내었다.
또한, KRS epitope peptide F4(서열번호 117)의 단일 아미노산을 각각 알라닌(alanine, A)으로 치환한 펩티드(peptide)를 이용하여, 항체 epitope 결합에 중요하게 작용하는 잔기를 확인하기 위해, ELISA를 실시하였다. 그 결과 KRS epitope peptide F4에서 각 항체와의 결합에 중요하게 작용하는 잔기를 확인할 수 있었다.
6-2. 항체의 세포이동 저해 효과
상기 실시예 3-1과 동일한 방법으로 실험을 실시하였다. 상기 실시예에서 제조한 N3-6. N3-7, N3-8, N3-9 항체들을 통상적인 방법으로, IgG로 전환하였다. 전환한 IgG 항체를 이용하여 다음 실험을 진행하였다 .
각 웰당 1 x 10 5세포의 농도로 상위 챔버에 넣어준 다음, N3 IgG를 100nM로 처리하였고, N3-1, N3-6, N3-7, N3-8 및 N3-9 IgG, human mock IgG(대조군)를 각각 10 nM로 상기 챔버에 처리하여 24시간 동안 배양하였다. Membrane 위쪽에 존재하는 non-migrating 세포를 면봉으로 제거하였다. 그 다음, PBS로 2회 세척하고, 70% MeOH(in PBS)를 30분 동안 처리하였다. PBS로 2회 세척한 다음, Hematoxylin solution을 30분 동안 처리하였다. 그 다음 챔버를 DW로 세척한 뒤, 챔버 내의 막(membrane)을 slide glass 위에 마운팅하여 관찰하였다.
그 결과 도 9에 나타난 바와 같이, N3-6, N3-7, N3-8, N3-9 항체가 N3-1 항체에 비해 세포의 이동을 현저하게 억제하는 것을 확인할 수 있었다. 또한, N3-6, N3-7, N3-8, N3-9 항체에서 세포이동 저해 효과는 큰 차이가 보이지는 않았다.
실시예 7: N3-8 항체의 서열 정제(sequence refinement)
7-1. N3-8 항체 서열의 돌연변이 제작
상기 실시예에서 N3-8 항체가 친화도가 가장 우수한 것을 확인하였다. 이에, N3-8 항체의 생산성, 안정성 등 물성을 확인하기 위하여 다음과 같이 실험을 실시하였다.
N3-8 항체서열에서 안정성에 영향을 미칠 것으로 예상되는 서열에 mutation을 유도하였다. 그 결과, N3-8 항체의 중쇄서열(HC)에 변이가 도입된 2종의 추가 중쇄서열을 얻을 수 있었다. 또한, mutation이 도입된 3종의 추가 경쇄 서열을 얻을 수 있었다. 이에, N3-8의 서열이 변화된 7종의 항체 서열 (N3-8 derivatives)을 하기 표 5 및 표 6에 나타내었다.
Heavy Light
CDR H1 CDR H2 CDR H3 CDR L1 CDR L2 CDR L3
N3-8-1 SYDMS(서열번호 1) AISPYSGRIYYADSVKG(서열번호 21) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) SSFSDELGAYV(서열번호 15)
N3-8-2 SYDMS(서열번호 1) AISPYSGRIYYADSVKG(서열번호 21) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) SNNQRPS(서열번호 27) SSFSDELGAYV(서열번호 15)
N3-8-3 SYDMS(서열번호 1) AISPYSGRIYYADSVKG(서열번호 21) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) RNNQRPS(서열번호 29) SSFSDELGAYV(서열번호 15)
N3-8-4 SYDMS(서열번호 1) AISPYSGRIYYADSVKG(서열번호 21) LALDFDY(서열번호 25) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) SSFSDELGAYV(서열번호 15)
N3-8-5 SYDMS(서열번호 1) AISPYSGRIYYADSVKG(서열번호 21) LALDFDY(서열번호 25) TGSSSNIGSNYVT(서열번호 7) SNNQRPS(서열번호 27) SSFSDELGAYV(서열번호 15)
N3-8-6 SYDMS(서열번호 1) AISPYSGRIYYADSVKG(서열번호 21) LALDFDY(서열번호 25) TGSSSNIGSNYVT(서열번호 7) RNNQRPS(서열번호 29) SSFSDELGAYV(서열번호 15)
N3-8-7 SYDMS(서열번호 1) AISPYSGRIYYADSVKG(서열번호 21) MALDFDY(서열번호 5) TGSSSNIGSNYVT(서열번호 7) DNSNRPS(서열번호 9) SSFSDELGAYV(서열번호 15)
서열 서열번호(서열명칭)
N3-8-1 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISPYSGRIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARMALDFDYWGQGTLVTVSS 서열번호 45(N3 VH mutant 6)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELGAYVFGGGTKLTVL 서열번호 51(N3 VL mutant 2)
N3-8-2 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISPYSGRIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARMALDFDYWGQGTLVTVSS 서열번호 45(N3 VH mutant 6)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELGAYVFGGGTKLTVL 서열번호 53(N3 VL mutant 3)
N3-8-3 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISPYSGRIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARMALDFDYWGQGTLVTVSS 서열번호 45(N3 VH mutant 6)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELGAYVFGGGTKLTVL 서열번호 55(N3 VL mutant 4)
N3-8-4 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISPYSGRIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLALDFDYWGQGTLVTVSS 서열번호 47(N3 VH mutant 7)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELGAYVFGGGTKLTVL 서열번호 51(N3 VL mutant 2)
N3-8-5 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISPYSGRIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLALDFDYWGQGTLVTVSS 서열번호 47(N3 VH mutant 7)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELGAYVFGGGTKLTVL 서열번호 53(N3 VL mutant 3)
N3-8-6 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISPYSGRIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLALDFDYWGQGTLVTVSS 서열번호 47(N3 VH mutant 7)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELGAYVFGGGTKLTVL 서열번호 55(N3 VL mutant 4)
N3-8-7 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISPYSGRIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYSARMALDFDYWGQGTLVTVSS 서열번호 41(N3 VH mutant 4)
VL QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVTWYQQLPGTAPKLLIYDNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCSSFSDELGAYVFGGGTKLTVL 서열번호 51(N3 VL mutant 2)
7-2. N3-8 항체 유도체의 생산 및 Tm 측정
상기 실시예 7-1에서 수득한 N3-8 항체 유도체를 발현하는 벡터를 일시적 트랜스펙션(transient transfection)을 이용하여 단백질을 발현 및 정제하였다.
진탕 플라스크에서, 무혈청 FreeStyle 293 발현 배지 (Invitrogen)에서 부유 성장하는 HEK293-F 세포(Invitrogen)를 플라스미드 및 폴리에틸렌이민(Polyethylenimine, PEI) (Polyscience)의 혼합물로 트랜스펙션하였다. 진탕 플라스크(Corning)에 200mL 트랜스펙션 시, HEK293-F 세포를 2 X 10 6 세포/ml의 밀도로 배지 100ml에 파종하여, 150 rpm, 8% CO 2, 37℃에서 배양하였다.
각각의 단일클론항체 생산하기 위해 알맞은 중쇄와 경쇄 플라스미드를 10ml FreeStyle 293 발현 배지(Invitrogen)에 중쇄:경쇄 DNA 1:1, 혹은 1:2의 비율로 transfection 하였다. 1:1의 경우 중쇄 125μg, 경쇄 125μg 총 250μg(2.5 μg/ml)으로 희석하여, PEI 750μg (7.5 μg/ml)을 희석한 10ml의 배지와 혼합하여 실온에서 10분 동안 반응시켰다. 1:2의 경우 경쇄 DNA의 농도를 2배로 하였다. 그 후, 반응시킨 혼합배지를 앞서 100ml로 파종한 세포에 넣어 4시간 동안 150 rpm, 8% CO 2, 37℃에서 배양 후, 나머지 100 ml의 FreeStyle 293 발현 배지를 추가하여 6일 동안 배양하였다.
그 다음, 세포배양액을 50ml tubes에 옮겨 3000rpm 에서 5 분간 원심분리를 실시하였다. 이후 채취한 세포 배양 상등액으로부터 단백질을 정제하였다. 단백질 A 세파로오스 컬럼(Protein A Sepharose column)에 항체를 적용하고 PBS(pH 7.4)로 세척하였다. 0.1 M 글라이신 완충액을 이용하여 pH 3.0에서 항체를 용리한 후, 1M Tris 완충액을 이용하여 샘플을 즉시 중화하였다. 용리한 항체 분획은 투석방법을 통해 PBS(pH 7.4)로 완충액을 교환하며 농축하였다. 정제된 단백질은 280nm 파장에서 흡광도와 흡광계수를 이용하여 정량하였다.
또한, 상기 정제한 항체 1 mg/ml 농도로 100 μl를 사용하여 항체의 thermal stability를 측정하였다. Protein thermal shift Dye kit(Thermofisher)를 이용하여 Quant Studio 3 Real-time PCR 장비(Thermofisher)로 4번 반복 수행하였다.
그 결과 하기 표 7에서 보이는 바와 같이 테스트한 모든 N3-8 항체 유도체들의 수율(yield)이 N3-8 항체보다 개선되었거나 유사한 수준으로 높은 수율을 나타냈다. 또한 표 7과 같이, Tm 값을 얻었다. 항체에 따라 thermal transition이 1-2로 다르게 관찰되었으나 모든 N3-8 항체 유도체에서 Tm 값이 증가하는 것으로 나타났다.
이를 통해 N3-8 항체 유도체들이 N3-8 항체에 비해 수율이 더 높으며, thermal stability가 개선된 것을 확인하였다.
항체 Yield (mg/L) Thermal stability
(1:1) (1:2) Tm1 Tm2
N3-8 69.9 104.61 67.37 -
N3-8-1 87.13 109.9 69.94 -
N3-8-2 96.76 109.68 72.41 -
N3-8-3 93.44 93.53 71.02 76.31
N3-8-4 86.14 89.23 70.31 -
N3-8-5 84.31 107.37 72.9 -
N3-8-6 105.95 92.9 71.0 76.97
상기 실시예들에서 사용된 IgG 전체 항체들의 중쇄(HC) 및 경쇄(LC) 서열구성을 하기 표 8에 나타낸다.
아미노산 서열 염기 서열
N3 HC 서열번호 89 서열번호 90
LC 서열번호 91 서열번호 92
N3-1 HC 서열번호 89 서열번호 90
LC 서열번호 107 서열번호 108
N3-3 HC 서열번호 89 서열번호 90
LC 서열번호 109 서열번호 110
N3-4 HC 서열번호 93 서열번호 94
LC 서열번호 107 서열번호 108
N3-5 HC 서열번호 93 서열번호 94
LC 서열번호 109 서열번호 110
N3-6 HC 서열번호 95 서열번호 96
LC 서열번호 109 서열번호 110
N3-7 HC 서열번호 97 서열번호 98
LC 서열번호 109 서열번호 110
N3-8 HC 서열번호 103 서열번호 104
LC 서열번호 109 서열번호 110
N3-9 HC 서열번호 101 서열번호 102
LC 서열번호 109 서열번호 110
N3-8-1 HC 서열번호 103 서열번호 104
LC 서열번호 111 서열번호 112
N3-8-2 HC 서열번호 103 서열번호 104
LC 서열번호 113 서열번호 114
N3-8-3 HC 서열번호 103 서열번호 104
LC 서열번호 115 서열번호 116
N3-8-4 HC 서열번호 105 서열번호 106
LC 서열번호 111 서열번호 112
N3-8-5 HC 서열번호 105 서열번호 106
LC 서열번호 113 서열번호 114
N3-8-6 HC 서열번호 105 서열번호 106
LC 서열번호 115 서열번호 116
N3-8-7 HC 서열번호 99 서열번호 100
LC 서열번호 111 서열번호 112
7-3. N3-8-1. N3-8-4 항체의 친화도 비교
상기 실시예 6에 기재된 바와 같이, KRS epitope peptide F4(EPKLSKNELKRRLKAEKKVAEKEAKQKE: 서열번호 117) 를 항원 epitope로 사용하여, Surface Plasmon Resonance(SPR)를 통해 N3-8-1, N3-8-4 항체와의 결합력을 분석하였다. SPR 실험은 상기 실시에 3-2와 동일한 방법으로 실시하였으며, epitope를 PBS 용액에 희석하여 15.7 nM-4000 nM 범위에서 2배수 희석하여 90초간 흘려주었다. 이후 2400초 동안 PBS를 흘려주었다. 얻어진 data는 Biacore T200 Evaluation 소프트웨어 v2.0 (GE Healthcare)으로 분석하였다.
그 결과 하기 표 9에 나타난 바와 같이, N3-8-1 항체의 KD가 가장 우수한 것으로 나타났다.
Peptide Ab Ka (1/Ms) Kd (1/s) KD (nM)
F4 N3-8-1 267900 0.000215 0.8025
N3-8-4 89480 0.00090 10.06
실시예 8: 항체의 기전 확인
항체 (Ab)에 형광 probe를 conjugation 하여 4T1 breast cancer cell에 처리 후 세포막의 Anti-KRS 항체 (N3, N3-8)가 엔도사이토시스(endocytosis)되는 것을 확인하였다.
Alexa fluor 488 (Thermofisher) 형광 probe로 표지된 anti-KRS 항체 (N3, N3-8)와 대조군인 Mock IgG(Thermofisher) 1 μM을 처리하였고, 4시간 후에 항체의 이동을 모니터링하였다. 이 때, 엔도사이토시스 여부를 확인하기 위하여 lysosome 마커로서 Lysotracker(Thermofisher)를 사용하였으며, DAPI는 세포 핵 염색을 나타낸다. Mock과는 달리 N3 및 N3-8 항체는 4시간째에 세포 내에 존재함을 확인할 수 있다.
그 결과 도 10에 나타난 바와 같이, anti-KRS 항체가 세포막 KRS를 인식하여 빠르게 엔도사이토시스되며, 이를 통해 세포막 KRS 수준을 낮추는 것을 확인할 수 있었다.
실시예 9: ADCC / CDC 기능을 제거한 항체의 서열 정제
9-1. ADCC / CDC 기능을 제거한 항체 서열의 돌연변이 제작
상기 항체에서 ADCC/CDC 기능을 제거하기 위하여 다음과 같이 실험을 실시하였다. 상기 각 항체 서열에서, 중쇄(heavy chain)의 constant region에 ADCC/CDC 기능을 하는 것으로 예상되는 부분에 돌연변이를 도입하였다. 각 항체의 ADCC/CDC 기능을 낮추기 위하여 IgG1을 사용하여 항체를 제작하였고, 상기 항체의 중쇄서열(HC)에 변이가 도입된 5종의 추가 중쇄 서열을 얻을 수 있었다. 또한, IgG4가 도입된 추가 중쇄 서열과 IgG4에 변이가 도입된 추가 중쇄 서열을 얻을 수 있었다. 이에, 각 항체에서 ADCC/CDC 기능이 제거된 돌연변이 항체 서열을 각각 하기 표 10에 나타내었다.
아미노산 서열 염기 서열
N3 HC IgG1 서열번호 89 서열번호 90
IgG1 mutant TA 서열번호 140 서열번호 141
IgG1 mutant LALA 서열번호 142 서열번호 143
IgG1 mutant LALATA 서열번호 144 서열번호 145
IgG1 mutant LALAPG 서열번호 146 서열번호 147
IgG1 mutant LALAPGTA 서열번호 148 서열번호 149
IgG4 서열번호 150 서열번호 151
IgG4 mutant TA 서열번호 152 서열번호 153
LC 서열번호 91 서열번호 92
N3-1 HC IgG1 서열번호 89 서열번호 90
IgG1 mutant TA 서열번호 140 서열번호 141
IgG1 mutant LALA 서열번호 142 서열번호 143
IgG1 mutant LALATA 서열번호 144 서열번호 145
IgG1 mutant LALAPG 서열번호 146 서열번호 147
IgG1 mutant LALAPGTA 서열번호 148 서열번호 149
IgG4 서열번호 150 서열번호 151
IgG4 mutant TA 서열번호 152 서열번호 153
LC 서열번호 107 서열번호 108
N3-3 HC IgG1 서열번호 89 서열번호 90
IgG1 mutant TA 서열번호 140 서열번호 141
IgG1 mutant LALA 서열번호 142 서열번호 143
IgG1 mutant LALATA 서열번호 144 서열번호 145
IgG1 mutant LALAPG 서열번호 146 서열번호 147
IgG1 mutant LALAPGTA 서열번호 148 서열번호 149
IgG4 서열번호 150 서열번호 151
IgG4 mutant TA 서열번호 152 서열번호 153
LC 서열번호 109 서열번호 110
N3-4 HC IgG1 서열번호 93 서열번호 94
IgG1 mutant TA 서열번호 154 서열번호 155
IgG1 mutant LALA 서열번호 156 서열번호 157
IgG1 mutant LALATA 서열번호 158 서열번호 159
IgG1 mutant LALAPG 서열번호 160 서열번호 161
IgG1 mutant LALAPGTA 서열번호 162 서열번호 163
IgG4 서열번호 164 서열번호 165
IgG4 mutant TA 서열번호 166 서열번호 167
LC 서열번호 107 서열번호 108
N3-5 HC IgG1 서열번호 93 서열번호 94
IgG1 mutant TA 서열번호 154 서열번호 155
IgG1 mutant LALA 서열번호 156 서열번호 157
IgG1 mutant LALATA 서열번호 158 서열번호 159
IgG1 mutant LALAPG 서열번호 160 서열번호 161
IgG1 mutant LALAPGTA 서열번호 162 서열번호 163
IgG4 서열번호 164 서열번호 165
IgG4 mutant TA 서열번호 166 서열번호 167
LC 서열번호 109 서열번호 110
N3-6 HC IgG1 서열번호 95 서열번호 96
IgG1 mutant TA 서열번호 168 서열번호 169
IgG1 mutant LALA 서열번호 170 서열번호 171
IgG1 mutant LALATA 서열번호 172 서열번호 173
IgG1 mutant LALAPG 서열번호 174 서열번호 175
IgG1 mutant LALAPGTA 서열번호 176 서열번호 177
IgG4 서열번호 178 서열번호 179
IgG4 mutant TA 서열번호 180 서열번호 181
LC 서열번호 109 서열번호 110
N3-7 HC IgG1 서열번호 97 서열번호 98
IgG1 mutant TA 서열번호 182 서열번호 183
IgG1 mutant LALA 서열번호 184 서열번호 185
IgG1 mutant LALATA 서열번호 186 서열번호 187
IgG1 mutant LALAPG 서열번호 188 서열번호 189
IgG1 mutant LALAPGTA 서열번호 190 서열번호 191
IgG4 서열번호 192 서열번호 193
IgG4 mutant TA 서열번호 194 서열번호 195
LC 서열번호 109 서열번호 110
N3-8 HC IgG1 서열번호 103 서열번호 104
IgG1 mutant TA 서열번호 224 서열번호 225
IgG1 mutant LALA 서열번호 226 서열번호 227
IgG1 mutant LALATA 서열번호 228 서열번호 229
IgG1 mutant LALAPG 서열번호 230 서열번호 231
IgG1 mutant LALAPGTA 서열번호 232 서열번호 233
IgG4 서열번호 234 서열번호 235
IgG4 mutant TA 서열번호 236 서열번호 237
LC 서열번호 109 서열번호 110
N3-9 HC IgG1 서열번호 101 서열번호 102
IgG1 mutant TA 서열번호 210 서열번호 211
IgG1 mutant LALA 서열번호 212 서열번호 213
IgG1 mutant LALATA 서열번호 214 서열번호 215
IgG1 mutant LALAPG 서열번호 216 서열번호 217
IgG1 mutant LALAPGTA 서열번호 218 서열번호 219
IgG4 서열번호 220 서열번호 221
IgG4 mutant TA 서열번호 222 서열번호 223
LC 서열번호 109 서열번호 110
N3-8-1 HC IgG1 서열번호 103 서열번호 104
IgG1 mutant TA 서열번호 224 서열번호 225
IgG1 mutant LALA 서열번호 226 서열번호 227
IgG1 mutant LALATA 서열번호 228 서열번호 229
IgG1 mutant LALAPG 서열번호 230 서열번호 231
IgG1 mutant LALAPGTA 서열번호 232 서열번호 233
IgG4 서열번호 234 서열번호 235
IgG4 mutant TA 서열번호 236 서열번호 237
LC 서열번호 111 서열번호 112
N3-8-2 HC IgG1 서열번호 103 서열번호 104
IgG1 mutant TA 서열번호 224 서열번호 225
IgG1 mutant LALA 서열번호 226 서열번호 227
IgG1 mutant LALATA 서열번호 228 서열번호 229
IgG1 mutant LALAPG 서열번호 230 서열번호 231
IgG1 mutant LALAPGTA 서열번호 232 서열번호 233
IgG4 서열번호 234 서열번호 235
IgG4 mutant TA 서열번호 236 서열번호 237
LC 서열번호 113 서열번호 114
N3-8-3 HC IgG1 서열번호 103 서열번호 104
IgG1 mutant TA 서열번호 224 서열번호 225
IgG1 mutant LALA 서열번호 226 서열번호 227
IgG1 mutant LALATA 서열번호 228 서열번호 229
IgG1 mutant LALAPG 서열번호 230 서열번호 231
IgG1 mutant LALAPGTA 서열번호 232 서열번호 233
IgG4 서열번호 234 서열번호 235
IgG4 mutant TA 서열번호 236 서열번호 237
LC 서열번호 115 서열번호 116
N3-8-4 HC IgG1 서열번호 105 서열번호 106
IgG1 mutant TA 서열번호 238 서열번호 239
IgG1 mutant LALA 서열번호 240 서열번호 241
IgG1 mutant LALATA 서열번호 242 서열번호 243
IgG1 mutant LALAPG 서열번호 244 서열번호 245
IgG1 mutant LALAPGTA 서열번호 246 서열번호 247
IgG4 서열번호 248 서열번호 249
IgG4 mutant TA 서열번호 250 서열번호 251
LC 서열번호 111 서열번호 112
N3-8-5 HC IgG1 서열번호 105 서열번호 106
IgG1 mutant TA 서열번호 238 서열번호 239
IgG1 mutant LALA 서열번호 240 서열번호 241
IgG1 mutant LALATA 서열번호 242 서열번호 243
IgG1 mutant LALAPG 서열번호 244 서열번호 245
IgG1 mutant LALAPGTA 서열번호 246 서열번호 247
IgG4 서열번호 248 서열번호 249
IgG4 mutant TA 서열번호 250 서열번호 251
LC 서열번호 113 서열번호 114
N3-8-6 HC IgG1 서열번호 105 서열번호 106
IgG1 mutant TA 서열번호 238 서열번호 239
IgG1 mutant LALA 서열번호 240 서열번호 241
IgG1 mutant LALATA 서열번호 242 서열번호 243
IgG1 mutant LALAPG 서열번호 244 서열번호 245
IgG1 mutant LALAPGTA 서열번호 246 서열번호 247
IgG4 서열번호 248 서열번호 249
IgG4 mutant TA 서열번호 250 서열번호 251
LC 서열번호 115 서열번호 116
N3-8-7 HC IgG1 서열번호 99 서열번호 100
IgG1 mutant TA 서열번호 196 서열번호 197
IgG1 mutant LALA 서열번호 198 서열번호 199
IgG1 mutant LALATA 서열번호 200 서열번호 201
IgG1 mutant LALAPG 서열번호 202 서열번호 203
IgG1 mutant LALAPGTA 서열번호 204 서열번호 205
IgG4 서열번호 206 서열번호 207
IgG4 mutant TA 서열번호 208 서열번호 209
LC 서열번호 111 서열번호 112
9-2. ADCC/CDC 기능을 제거한 돌연변이 항체의 정제
상기 실시예 9-1에서 수득한 ADCC/CDC 기능을 제거한 돌연변이 항체들 중 N3-8-1 항체의 ADCC/CDC 기능을 제거한 돌연변이 항체를 발현하는 벡터를 일시적 트랜스펙션(transient transfection)을 이용하여 단백질을 발현 및 정제하였다.
상기 실시예 7-2에 기재된 방법에 따라 진탕 플라스크에서, HEK293-F 세포(Invitrogen) 트랜스펙션하였다. 그 다음 HEK293-F 세포를 2 X 10 6 세포/ml의 밀도로 배지에 파종하여, 150 rpm, 8% CO 2, 37℃에서 배양하였다.
각각의 단일클론항체를 생산하기 위해 알맞은 중쇄와 경쇄 플라스미드를 10ml FreeStyle 293 발현 배지(Invitrogen)에 중쇄:경쇄 DNA 1:1, 혹은 1:2의 비율로 transfection 하였다. 1:1의 경우 중쇄 125μg, 경쇄 125μg 총 250μg(2.5 μg/ml)으로 희석하여, PEI 750μg (7.5 μg/ml)을 희석한 10ml의 배지와 혼합하여 실온에서 10분 동안 반응시켰다. 1:2의 경우 경쇄 DNA의 농도를 2배로 하였다. 그 후, 반응시킨 혼합배지를 앞서 100 ml로 파종한 세포에 넣어 4시간 동안 150 rpm, 8% CO 2, 37℃에서 배양 후, 나머지 100 ml의 FreeStyle 293 발현 배지를 추가하여 6일 동안 배양하였다.
그 다음, 세포배양액을 50ml tubes에 옮겨 3000rpm 에서 5 분간 원심분리를 실시하였다. 이후 채취한 세포 배양 상등액으로부터 단백질을 정제하였다. 단백질 A 세파로오스 컬럼(Protein A Sepharose column)에 항체를 적용하고 PBS(pH 7.4)로 세척하였다. 0.1 M 글라이신 완충액을 이용하여 pH 3.0에서 항체를 용리한 후, 1M Tris 완충액을 이용하여 샘플을 즉시 중화하였다. 용리한 항체 분획은 투석방법을 통해 PBS(pH 7.4)로 완충액을 교환하며 농축하였다. 정제된 단백질은 280nm 파장에서 흡광도와 흡광계수를 이용하여 정량하였다.
또한, 상기 정제한 항체의 Purity를 측정하였고, Protein thermal shift Dye kit(Thermofisher)를 이용하여 Quant Studio 3 Real-time PCR 장비(Thermofisher)로 4번 반복 수행하였다.
그 결과 하기 표 11에서 보이는 바와 같이, 테스트한 모든 N3-8-1 항체 돌연변이의 수율이 wild type과 유사하거나 높은 수율을 나타냈으며, 이 중 LALAPGTA 돌연변이의 수율(yield)이 가장 높은 것으로 나타났다. 또한 모든 N3-8-1 항체 돌연변이는 wild type 항체와 유사한 수준으로 높은 순도를 나타냈다.
이를 통해 N3-8-1의 ADCC/CDC 기능을 제거한 항체들이 N3-8-1 항체에 비해 수율이 유사하거나 더 높으며, 유사한 순도를 갖는 것을 확인하였다.
항체 Yield (mg/ml) Purity (%)
N3-8-1 wild type 78.72 99.47
mutant LALA 70.7 99.87
mutant LALAPG 73.78 99.86
mutant LALATA 77.7 99.91
mutant LALAPGTA 146.37 99.9
실시예 10: KRS -N term 특이적 결합 항체의 면역세포 이동 관련 질환 in vivo 모델에서 효능 확인_ in vivo 폐동맥 고혈압 모델
KRS-N 말단에 특이적으로 결합하는 항체를 처리하면 세포막 위치에서의 KRS 수준이 감소(엔도사이토시스 등을 통해)되는 것을 통해 면역세포 이동/침윤이 저해되어, 결과적으로 세포막 KRS 수준 감소 효과를 가지는 것으로 볼 수 있다. 따라서 본 발명의 KRS N-term 특이적 항체(대표적으로 N3 항체)는 면역세포 이동 관련 질환에 대하여 치료효과를 보일 것임은 자명한 것으로 사료되며, 이는 후술되는 실시예들을 통해 더욱 증명되었다.
실험방법
1) 폐동맥 고혈압(PAH) 모델 제작 및 시험물질 투여
7주령 SD rat(오리엔트바이오)에 PAH를 유도하기 위하여 MCT(monocrotaline) 60 mpk를 피하주사하였다. 이후 4개의 군으로 나누고(각 군당 5마리로 실험), 각각 Mock human IgG(Thermo Fisher Scientific, 음성 대조군) 1mpk, N3 IgG 항체 1mpk, N3 IgG 항체 10mpk, sildenafil(양성 대조군) 25 mpk를 3주간 투여하였다. 모든 항체는 주 2회 iv 주사하였고 sildenafil은 매일 경구투여하였다.
2) 혈류 및 혈압 측정
3주 후 rat를 isoflurane으로 마취하고, 동물용 초정밀공압측정시스템(MPVS Cardiovascular Pressure and Volume system, 모델명: MPVS Ultra, 제조사명: Millar Instruments)을 이용하여 혈류와 압력을 측정하였다. 우심실 수축기압 (RVESP) 및 이완기압, 좌심실 수축기압 및 이완기압은 전용 카테터(Mikro-Tip 　rat pressure catheter,제조사명: Millar Instruments)를 이용하여 측정하였다. 심박출량은 혈관주위(perivascular) 혈류 탐침자(Transonic 　Flowprobes,제조사명: Millar Instruments)를 이용하여 측정하였으며, 이에 대한 실험기법은 하기 문헌에 기재된 것과 동일한 방법으로 수행되었다:Pacher P, Nagayama T, Mukhopadhyay P, Batkai S, Kass DA. Measurement of cardiac function using pressure-volume conductance catheter technique in mice and rats. Nat Protoc 2008;3(9):1422-34.
3) 면역조직화학염색(immunohistochemistry, IHC)
채취한 폐를 통상적인 과정에 따라 PFA(paraformaldehyde)에 고정시킨 후 수세, 탈수, 투명 과정을 거쳐 파라핀 침투시켜 포매하였다. Rat의 폐조직 파라핀 블록을 3μm 두께로 박절하고 슬라이드를 제작하였다. 그 후 다음과 같이 염색을 수행하였다. 먼저 5분간 3회 xylene 처리 후, 100% 에탄올, 95% 에탄올, 90% 에탄올, 70% 에탄올, DW 순으로 2분 간 처리하고 PBS로 5분간 washing하였다. 0.3% H 2O 2의 처리 후, 샘플을 PBS로 5분 동안 2회 washing하였다. 0.01M citrate buffer에 담가 가열 후, PBS-T(0.03 % tween 20)로 세척하였다. 이후 30분간 실온에서 blocking(2 % BSA & 2 % goat serum in PBS)하였다. 항-CD68 항체(1 : 200, ED1 clone, Abcam)로 4℃에서 overnight 염색하였다. PBS-T로 5분간 3회 세척한 후, polymer-HRP anti-mouse envision kit(DAKO)로 4℃에서 1 시간 처리하였다. PBS-T로 3회 세척한 후, DAB substrate buffer 및 DAB chromogen 20을 처리하여 발색시켰다. 염색된 조직을 1 분간 Mayer's hematoxylin(Sigma)으로 처리 한 다음, 70% 에탄올, 90% 에탄올, 95% 에탄올, 100% 에탄올 순서로 각각 2분간 2회 처리하였다. 마지막으로 5분간 3회 xylene 처리한 후 광학현미경으로 관찰하였다.
실험결과
10-1. 혈압 및 심박출량 변화 확인
면역세포의 침윤이 병리현상과 깊이 관계된 질환인 PAH 모델에, N3 단클론 항체를 1mpk 또는 10 mpk로 3주간 처리한 뒤(iv, 주 2회), 우심실 수축기말 압력 (right ventricular end-systolic pressure; RVESP), 우심실 이완기말 압력 (right ventricular end-diastolic pressure; RVEDP), 좌심실 수축기말 압력 (left ventricular end-systolic pressure; LVESP) 좌심실 이완기말 압력 압력 (left ventricular end-diastolic pressure; LVEDP) 및 심박출량 (cardiac output; CO)을 측정하였으며, 그 결과를 표 12에 나타낸다.
MCT + Mock IgG (n = 4) MCT + N3 Ab 1mpk(n = 5) MCT + N3 Ab 10mpk(n = 5) MCT + Sildenafil(n = 5)
RVESP (mmHg) 62.5 ± 5.7 45.0 ± 8.1 41.2 ± 7.7 48.4 ± 9.6
RVEDP (mmHg) 2.8 ± 1.5 1.4 ± 2.2 3.8 ± 1.3 2.6 ± 1.3
LVESP (mmHg) 81.5 ± 11.4 95.8 ± 4.8 93.4 ± 11.3 83.2 ± 4.7
LVEDP (mmHg) 1.0 ± 0.8 2.6 ± 1.9 4.6 ± 3.9 3.6 ± 2.3
CO (ml/min) 58 ± 4.7 (n = 4) 74.0 ± 10.9 (n = 5) 59.8 ± 12.9 (n = 5) 49.6 ± 17.7 (n = 4)
(MCT +mock IgG 처리군 1마리는 마취사. Sildenafil 처리군 1마리는 수술 중 사망하여 CO 측정하지 못함).
폐동맥 고혈압은 폐동맥이 좁아짐으로 인하여 우심실 압력이 상승하며, 결과적으로 우심실 부전을 초래한다. 또한 지속적인 고혈압으로 그 보상 기전이 파괴되면 우심실 비대에 이어 우심실 확장이 일어나게 된다. 이는 심실중격의 이동으로 인한 좌심실의 압박을 가져오게 되고 좌심실의 확장기말 용적 및 심박출량의 감소를 가져오게 된다(이우석 et al., 중증 폐동맥 고혈압 환자의 임상적 특징과 예후 예측 인자, Korean Circulation J 2007;37 :265-270). 결과적으로 폐동맥 고혈압은 주로 우심실과 관계되지만 좌심실의 기능과도 연관된다.
PAH 환자에서는 RVESP가 증가되며 이는 본 실험의 PAH 동물 모델에서도 확인되었다. 이에 대하여 도 11에서 보는 바와 같이, N3 항체(KRS-N term 특이적 결합 항체)는 두 농도 모두에서 유의적으로 RVESP를 감소시켰으며, 특히 양성대조군 약물인 Sildenafil 보다 우수하게 RVESP를 감소시켰다.
또한 N3 항체(KRS-N term 특이적 결합 항체) 투여에 따른 좌심실 수축기말 압력(LVESP) 감소는 관찰되지 않았으며, 오히려 본 발명의 항체를 투여한 군에서는 도 13에서 보는 바와 같이 LVESP가 유의하게 증가되는 결과를 보였다. 이는 기존 폐동맥 고혈압의 치료제로 사용되고 있는 Sildenafil의 경우 폐동맥의 확장뿐만 아니라, 전신동맥의 확장도 유발하여 전신 혈압(systemic blood pressure)을 저하시킬 위험이 있는 것과 대비되는 것이다. 즉, 본 발명의 N3 항체는 Sildenafil과 비교하여 전신 동맥압(systemic artery pressure)에 미치는 영향이 낮은 경향성을 보이는 것을 확인하였으며, 이러한 효과는 임상현장에서 Sildenafil 투여 시 저혈압 발생 위험을 염려하는 상황이 있음을 고려하였을 때, 치료약제의 유리한 특성이 될 것으로 사료되었다. 뿐만아니라, 폐동맥고혈압이 심한 경우 수축기 우심실 부전(systolic RV failure)이 발생함에 따라, 낮은 심박출량(cardiac output) 및 전신 저혈압(systemic hypotension)이 동반될 수 있다. 이에 대하여 본 발명의 N3 항체에 의한 폐동맥고혈압을 호전시키는 치료에 의해 심박출량(cardiac output)과 전신 혈압(systemic blood pressure)이 상승되어 혈압이 정상화되는 효과가 예상된다.
종합하여, 이로서 본 발명의 KRS N-term 결합 항체(특히, N3 항체)의 투여는 기존 치료 약물의 부작용 가능성을 개선하며, PAH 증상완화 및 치료 효과를 보임을 확인하였다.
10-2. 심초음파 검사(Echocardiography)
우심실의 압력 과부하를 시사하는 D-shaped left ventricle 소견은 MCT 단독 투여 군(즉, 실험물질 비투여 PAH 모델)에서 3마리, MCT + Sildenafil 투여한 군의 3마리에서 각각 관찰되었으며, 치료항체(N3 항체)를 투여한 군에서는 관찰되지 않았다.
뿐만 아니라 하기 표 13에서 보는 바와 같이, 각 군의 체중은 비슷한 정도로 증가하였으며 유의적 차이가 없었다. 즉, 치료항체 투여를 통한 비정상적 몸무게 감소를 비롯한 이상 징후를 시사하는 소견은 관찰되지 않았다.
MCT + Mock IgG (n = 4) MCT + Ab 1 mpk(n = 5) MCT + Ab 10 mpk(n = 5) MCT + Sildenafil(n = 5)
Absolute change (g) 101.4 ± 14.2 113.5 ± 14.6 104.1 ± 12.3 104.1 ± 26.4
Relative change (%) 48.8 ± 7.8 43.6 ± 5.2 40.7 ± 5.0 49.8 ± 10.5
10-3. 단핵구/대식세포 이동 및 침윤 정도 확인
각 실험군의 폐 조직을 이용하여 단핵구/대식세포 마커인 CD68에 대한 IHC 염색을 수행하였다. 실험 결과 도 12에서 보는 바와 같이, 본 발명의 N3 항체(KRS N-term 결합 항체) 처리군은 단핵구/대식세포의 폐 조직 침윤을 명확하게 감소시켰음을 확인하였으며, 이러한 효과는 sildenafil 보다 현저히 우수함을 확인하였다.
실시예 11: KRS -N term 특이적 결합 항체의 면역세포 이동 관련 질환 in vivo 모델에서 효능 확인_급성 폐손상 모델
실험방법
1) LPS 유도 급성 폐손상 모델 제작 및 시험물질 투여
급성 폐손상 모델은 7주령 수컷 C57BL/6 마우스(두열바이오)에 LPS(Sigma) 2.5 mg/kg을 기관 내 주입하는 방식으로 제작되었다.
KRS 저해제의 급성 폐손상에 대한 효과를 알아보기 위하여, 먼저 C57BL/6 마우스에 N3 IgG 항체를 각각 1mg/kg 또는 10 mg/kg씩 IV 주입하고, 24시간 후 LPS 2.5 mg/kg을 기관내 주입하였다. 상기 LPS 주입 후 24시간 째에, 각 마우스들을 희생시켜 폐조직 및 BALF(Bronchoalveolar lavage fluid)를 수집하고 분석하였다.
2) BALF(Bronchoalveolar lavage fluid) 내 면역세포 수 측정
PBS로 폐를 세척하여 얻어진 BALF를 모아 800 x g에서 10 분간 4℃에서 원심하여 pellet을 수거하였다. 세포를 부유시킨 후 RBC lysis buffer(eBioscience cat.no.00-4333-57)를 이용해 red blood cell 제거하였다. 이후 PBS로 반응을 멈추고 2번 washing 한 뒤, 400 μl PBS에 부유시켜 hemocytometer로 세포수를 측정하고 Hema3 염색을 통해 neutrophil 수를 측정하였다.
3) 폐조직 내 면역세포에 대한 FACS
폐 조직을 수거하여 gentleMACS Octo Dissociator(MACS Miltenyi Biotec, Order no.130-095-937) 장비를 이용해 37℃에서 45 분간 rotation하여 조직을 으깼다. Cell strainer(40μm)를 이용해 filter한 뒤 1500 rpm에서 5분간 실온에서 원심분리를 수행하였다. Pellet을 수거하여 RBC lysis buffer(eBioscience cat.no.00-4333-57)를 이용해 red blood cell 제거하였다. 세포를 수거하여 FACS buffer (NaN3 1% 및 FBS 3%가 포함된 PBS)에 부유한 뒤 50μl를 tube에 담고, 동량의 항체 mxiture와 잘 혼합하여 4℃에서 1시간 동안 빛을 차단하여 염색하였다. 폐로 이동하는 IM (interstitial macrophage) 분석을 위해, FITC Rat Anti-CD11b (BD Pharmingen) 과 PE Rat Anti-Mouse F4/80 (BD Pharmingen) 항체를 사용하였다. FACS buffer를 이용하여 400 x g에서 5분간 2번 washing 한 뒤, Navios Flow Cytometer(Beckman) 장비로 분석하였다.
4) 폐 조직에 대한 masson's trichrome 염색
폐 조직을 통상적인 방법으로 파라핀 포매한 후, 박절하였다. 그 후 xylene을 이용하여 파라핀을 제거한 조직 슬라이드를 DW로 washing한 뒤, 56-60℃의 Bouin Fluid에 1시간 처리하였다. Weigert’s iron hematoxylin solution으로 10분 염색하였고, 그 후 washing하고, 다시 Biebrich scarlet-acid fuchsin solution으로 10-15분 염색한 뒤 washing하였다. Phosphomolybdic-phosphotungstic acid solution을 10-15 분간 처리하고, aniline blue solution으로 옮겨 5-10 분간 염색하였다. Washing 후 1% acetic acid solution에 2-5 분간 처리하였다. Washing 및 dehydration 이후 xylene 처리하여 mounting 하였다.
실험결과
11-1. BALF(Bronchoalveolar lavage fluid) 내 면역세포 이동 억제 효과 확인
도 13에서 보는 바와 같이 LPS 처리에 의하여 급성 폐손상을 유발한 마우스에서는 BALF 내 총(total) 면역세포수가 증가된 것을 확인하였으며, 이는 N3 항체(KRS N-term 결합 항체) 처리에 의하여 농도의존적으로 감소하였다.
특히, 도 14에서 보는 바와 같이, LPS 처리로 급성 폐손상을 유발한 마우스에서 호중구(neutrophil)가 많이 증가된 것이 확인되었고, N3 항체(KRS N-term 결합 항체) 처리는 이러한 호중구 수치를 감소시켰다. 이로서 KRS N-term에 특이적으로 결합하는 항체 처리에 의해 BALF 내 면역세포, 특히 neutrophil의 폐로의 침윤이 현저히 억제됨을 확인하였다.
11-2. 폐 조직 내 면역세포 이동 억제 효과 확인
도 15 및 도 16은 급성 폐손상에 의하여 폐 조직으로 이동해온 대식세포를 FACS로 분석한 결과를 나타낸다. IM(interstitial macrophage)은 CD11b+/F4/80+ 세포로서, 폐에 상주하지는 않고 특정 상황에서 폐로 이동해 오는 대식세포(migrating macrophages)이다. LPS 처리에 의해 IM의 폐로의 침윤이 증가하였으나, N3 항체 처리는 농도 의존적으로 IM의 폐로의 이동을 감소시켰다. 이를 통해 KRS N-term에 특이적으로 결합하는 항체(대표적으로, N3 항체) 처리에 의해 대식세포/단핵구 등 면역세포의 폐 조직으로의 이동 및 침윤이 억제되는 것을 확인하였다.
상기 대식세포/단핵구 등 면역세포의 과도한 폐 조직으로의 이동 및 침윤은 조직 섬유화 질환에 있어서 중요한 병리 현상이다. 상기 급성 폐손상 모델에 대하여 폐조직을 Masson's trichrome 염색하여 관찰한 결과(도 17) 폐 조직 내의 섬유화가 상당히 진행된 것을 확인하였으며, 이에 대하여 N3 항체(KRS N-term에 특이적으로 결합하는 항체)의 처리는 이러한 섬유화를 억제한 것을 확인하였다.
실시예 12: ADCC/CDC 기능을 제거한 돌연변이 항체의 면역세포 이동 분석
상기의 ADCC/CDC 기능을 제거한 돌연변이 항체가 면역세포 이동에 미치는 영향을 확인하기 위하여, 선행 문헌(Park, S. G. et al. Human lysyl-tRNA synthetase is secreted to trigger pro-inflammatory response, Proc. Natl. Acad. Sci. U S A 102, 6356-6361 (2005))에 기재된 방법에 따라 세포 이동 분석(migration assay)을 실시하였다.
폴리카보네이트 막(5.0μm 공극 사이즈, Costar)을 가진 트랜스웰 챔버로 측정하였다. 상기 트랜스 웰 챔버에 LN421을 2.5μg/ml의 농도로 하위 챔버에 넣어 주었다. 그 후 RAW264.7 세포를 각 웰당 5 x 10 4cells의 농도로 상위 챔버에 넣었다. 그 다음 각 항체를 10M 농도로 상기 챔버에 넣어준 다음 24시간 동안 배양하였다. 그 후, PBS로 2회 세척하고 70% MeOH(in PBS)를 처리하였다. 다시 PBS로 2회 세척하고 이동된 세포를 crystal violet(Sigma)으로 염색하여 건조시켰다. 그 다음 33% acetic acid(Merck)에 상위 챔버를 넣고 10분 동안 교반하였다. Crystal violet이 녹은 acetic acid solution을 96 웰 플레이트 옮겨 담고 microplate reader(Tecan)에서 흡광도 590 nm으로 측정하였다.
그 결과 도 18에서 나타난 바와 같이, N3-8, N3-8-1, N3-8-1 mutant LALA, N3-8-1 mutant LALATA, N3-8-1 mutant LALAPG, N3-8-1 mutant LALAPGTA 항체가 모두 아무것도 처리하지 않은 대조군(Control, C)과 유사한 수준으로 LN421에 의한 세포 이동을 저해하는 것으로 나타났다.
실시예 13. ADCC/CDC 기능을 제거한 돌연변이 항체의 암세포 이동 분석
상기의 ADCC/CDC 기능을 제거한 돌연변이 항체가 면역세포 이동에 미치는 영향을 확인하기 위하여, 실시예 12에 기재된 방법에 따라 세포 이동 분석(migration assay)를 실시하였다.
폴리카보네이트 막(8.0μm 공극 사이즈, Costar)를 가진 24-웰 트랜스웰 챔버로 측정하였다. 라미닌(laminin)을 하위 챔버에 1mg/ml 농도로 넣어주고, 인산화 KRS인 T52D KRS를 과발현하는 안정적인 MDA-MB-231 세포를 사용하여 세포 이동 분석(migration assay)을 수행하였다. T52D KRS 발현을 유도하기 위해 doxycycline (0.1μg/ml)을 하루 동안 처리한 T52D KRS-MDA-MB-231 안정적 세포를 무혈청(serum-free) RPMI 배지에 현탁한 다음 각 웰당 4×10 4 세포의 농도로 상위 챔버에 넣었다. 그 다음 N3-8, N3-8-1, N3-8-1 mutant LALA, N3-8-1 mutant LALATA, N3-8-1 mutant LALAPG, N3-8-1 mutant LALAPGTA 항체를 각각 10nM로 상기 챔버에 처리하여 7 시간 동안 배양하였다. 멤브레인(membrane) 위쪽에 존재하는 non-migrating 세포를 면봉으로 제거한 다음 PBS로 2회 세척하고, 70% MeOH(in PBS)를 30분 동안 처리하였다. 다시 PBS로 2회 세척하고, crystal violet(SIgma)을 이용하여 염색하고, 건조시켰다. 그 다음 33% 아세트산(acetic acid, Merck)에 상위 챔버를 넣고 교반하였다. Crystal violet이 녹은 acetic acid solution을 96 웰 플레이트 옮겨 담고 microplate reader(Tecan)에서 흡광도 590 nm으로 측정하였다.
그 결과 도 19에서 나타난 바와 같이, N3-8, N3-8-1, N3-8-1 mutant LALA, N3-8-1 mutant LALATA, N3-8-1 mutant LALAPG, N3-8-1 mutant LALAPGTA 항체가 모두 라미닌에 의한 암세포 이동을 저해하는 것으로 나타났다.
이상 살펴본 바와 같이, 본 발명의 항체 또는 그 단편들은 본 명세서에 기재된 특정 CDR(상보성 결정부위) 서열을 가지며, 세포 외막에 노출되는 KRS N-말단 영역에 특이적 결합능력 및 친화도가 매우 우수하기 때문에, 암 또는 면역세포 이동 관련 질환과 같은 KRS의 특이적 행태를 수반하는 질병의 진단에 이용가능하며, 생산성 및 안정성이 우수하고, 암 전이 억제 효과가 뛰어나기 때문에 암 치료제, 암전이 예방 또는 억제제로서 유용하게 이용될 수 있으며, 면역세포 이동과 관련한 질환의 예방, 개선 및 치료 등에 있어서 매우 유용하게 사용될 수 있다.

Claims (26)

  1. (a) (i) 아미노산 서열 SYDMS를 포함하는 중쇄 상보성 결정부위 1(CDR1);
    (ii) 아미노산 서열 X 1IX 2X 3X 4X 5GX 6X 7YYADSVKG를 포함하고, 여기서 X 1은 A 또는 V이고, X 2은 S, D 또는 G이고, X 3는 Y, P, S 또는 A 이고, X 4는 D, Q, L 또는 Y이고, X 5는 N, M, S, 또는 G이고, X 6는 N, R 또는 P이고, X 7는 T, V, I 또는 S인 중쇄 상보성 결정부위 2(CDR2); 및
    (iii) 아미노산 서열 X 8ALDFDY를 포함하고, 여기서 X 8은 M 또는 L인 중쇄 상보성 결정부위 3(CDR3)를 포함하는 중쇄가변영역(VH) 및
    (b) (i) 아미노산 서열 TGSSSNIGSNYVT를 포함하는 경쇄 상보성 결정부위 1(CDR1);
    (ii) 아미노산 서열 X 9NX 10X 11RPS를 포함하고, 여기서 X 9는 D, S 또는 R이고, X 10은 S 또는 N이고, X 11은 N 또는 Q인 경쇄 상보성 결정부위 2(CDR2); 및
    (iii) 아미노산 서열 X 12SFSDELGAYV를 포함하고, 여기서 X 12은 A 또는 S인 경쇄 상보성 결정부위 3(CDR3)를 포함하는 경쇄가변영역(VL)
    을 포함하는, 세포 외막에 노출되는 라이실-tRNA 합성효소(KRS, Lysyl-tRNA synthetase) N-말단 영역에 특이적으로 결합하는 항체 또는 그 단편.
  2. 제1항에 있어서,(a) 중쇄가변영역(VH)은 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1); 서열번호 3, 서열번호 17, 서열번호 19, 서열번호 21, 서열번호 23 및 서열번호 118로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2); 서열번호 5 및 서열번호 25로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 것을 특징으로 하는 항체 또는 그 단편.
  3. 제1항에 있어서,(b) 경쇄가변영역(VL)은 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1); 서열번호 9, 서열번호 27 및 서열번호 29로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2); 서열번호 13 및 서열번호 15로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 것을 특징으로 하는 항체 또는 그 단편.
  4. 제1항에 있어서, 상기 항체 또는 그 단편은
    i) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 3으로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 13으로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    ii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 3으로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    iii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 118로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 13으로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    iv) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 118로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    v) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 17로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    vi) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 19로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    vii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    viii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 23으로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    ix) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 27로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    x) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 29로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    xi) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 25로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 9로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    xii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 25로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 27로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체; 또는
    xiii) 서열번호 1로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 1(CDR1), 서열번호 21로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 2(CDR2), 서열번호 25로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 중쇄가변영역(VH) 및 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 1(CDR1), 서열번호 29로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 2(CDR2), 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 상보성 결정부위 3(CDR3)을 포함하는 항체 경쇄가변영역(VL)을 포함하는 항체;
    를 포함하는 것을 특징으로 하는 항체 또는 그 단편.
  5. 제1항에 있어서, 상기 항체 또는 그 단편은
    서열번호 89, 서열번호 93, 서열번호 95, 서열번호 97, 서열번호 99, 서열번호 101, 서열번호 103 및 서열번호 105로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 중쇄(HC); 및
    서열번호 107, 서열번호 109, 서열번호 111, 서열번호 113 및 서열번호 115로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 경쇄(LC);
    를 포함하는 것을 특징으로 하는 항체 또는 그 단편.
  6. 제1항에 있어서, 상기 항체 또는 그 단편은
    서열번호 89로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 107로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 89로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 93으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 107로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 93으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 95로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 97로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 99로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 101로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 103으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 111로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 103으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 113으로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 103으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 115로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 105로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 111로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 105로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 113으로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 105로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 115로 표시되는 아미노산 서열을 포함하는 경쇄;
    서열번호 99로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 111로 표시되는 아미노산 서열을 포함하는 경쇄; 또는
    서열번호 103으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 109로 표시되는 아미노산 서열을 포함하는 경쇄;
    를 포함하는 것을 특징으로 하는 항체 또는 그 단편.
  7. 제1항에 있어서, 상기 항체는 IgG, IgA, IgM, IgE 및 IgD로 이루어진 군에서 선택되며, 상기 단편은 디아바디, Fab, Fab', F(ab)2, F(ab')2, Fv 및 scFv로 이루어진 군에서 선택되는 것을 특징으로 하는 항체 또는 그 단편.
  8. 제1항에 있어서, 상기 단편은 서열번호 61, 서열번호 63, 서열번호 65, 서열번호 67, 서열번호 69, 서열번호 71, 서열번호 73, 서열번호 75, 서열번호 77, 서열번호 79, 서열번호 81, 서열번호 83, 서열번호 85, 및 서열번호 87로 이루어진 군에서 선택된 하나 이상의 아미노산 서열을 포함하는 것을 특징으로 하는 항체 또는 그 단편.
  9. 제1항 내지 제8항 중 어느 한 항의 항체 또는 그 단편을 암호화 하는 폴리뉴클레오티드.
  10. 제9항의 폴리뉴클레오티드를 포함하는 재조합 발현 벡터.
  11. 제10항의 재조합 발현 벡터로 형질전환된 세포.
  12. (a) 제11항의 재조합 발현 벡터로 숙주 세포를 형질전환하는 단계;
    (b) 형질전환된 숙주 세포를 배양하여 항체 또는 그 단편을 생산하는 단계; 및
    (c) 숙주 세포에서 생산된 항체 또는 그 단편을 수득하는 단계를 포함하는, 세포 외막에 노출되는 라이실-tRNA 합성효소(KRS, Lysyl-tRNA synthetase) N-말단에 특이적으로 결합하는 항체 또는 그 단편을 제조하는 방법.
  13. 제1항의 항체 또는 그 단편을 유효성분으로 포함하는 암 및 암 전이 예방 또는 억제용 약학적 조성물.
  14. 제1항의 항체 또는 그 단편을 유효성분으로 포함하는 암 또는 암 전이 진단용 조성물.
  15. 제1항에 있어서, 상기 항체는 야생형 인간 IgG Fc 영역의 Fc 변이체를 포함하는 폴리펩티드로서, 상기 Fc 변이체는 서열번호 126으로 표시되는 야생형 인간 IgG1 Fc 영역의 L117A, L118A, T182A, P212G 또는 서열번호 138로 표시되는 인간 IgG4 Fc 영역의 T179A인 하나 이상의 추가의 아미노산 치환을 포함하고, 상기 폴리펩티드는 야생형 IgG Fc 영역을 포함하는 폴리펩티드에 비해, ADCC/CDC 기능이 감소되는 폴리펩티드를 포함하는 것을 특징으로 하는 항체 또는 그 단편.
  16. 제1항의 항체 또는 그 단편을 유효성분으로 포함하는 면역세포 이동 관련 질환의 예방 또는 치료용 조성물.
  17. 제1항의 항체 또는 그 단편을 유효성분으로 포함하는 면역세포 이동 관련 질환의 진단용 조성물.
  18. 제16항 또는 제17항에 있어서, 면역세포 이동과 관련된 질환은 심혈관 질환, 섬유화 질환, 염증성 질환 및 알포트 증후군(Alport syndrome)으로 이루어진 군에서 선택되는 것을 특징으로 하는 조성물.
  19. 암 및 암 전이 예방 또는 억제용 제제를 제조하기 위한 제1항의 항체 또는 그 단편의 용도.
  20. 제1항의 항체 또는 그 단편을 포함하는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 암 및 암 전이 예방 또는 억제 방법.
  21. 암 또는 암 전이 진단용 제제를 제조하기 위한 제1항의 항체 또는 그 단편의 용도.
  22. a) 암 전이가 의심되는 개체(피검체)로부터 생물학적 시료를 수득하는 단계;
    b) 상기 시료 또는 개체에 제1항의 항체 또는 그 단편을 포함하는 조성물을 투여하는 단계;
    c) 상기 b) 단계의 시료 또는 개체에서 KRS 단백질의 발현 수준을 검출하는 단계; 및
    d) 상기 KRS 단백질의 발현 수준이 정상 대조군과 비교하여, KRS 단백질의 발현 수준이 증가하는 경우에 암 및 암 전이가 발생한 것으로 진단하는 단계를 포함하는, 암 또는 암 전이 진단 방법.
  23. 면역세포 이동 관련 질환의 치료용 제제를 제조하기 위한 제1항의 항체 또는 그 단편의 용도.
  24. 제1항의 항체 또는 그 단편을 포함하는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 면역세포 이동 관련 질환의 치료 방법.
  25. 면역세포 이동 관련 질환의 진단용 제제를 제조하기 위한 제1항의 항체 또는 그 단편의 용도.
  26. a) 면역세포 이동 관련 질환이 의심되는 개체로부터 생물학적 시료를 수득하는 단계;
    b) 상기 시료 또는 개체에 제1항의 항체 또는 그 단편을 포함하는 조성물을 투여하는 단계;
    c) 상기 b) 단계의 시료 또는 개체에서 KRS 단백질의 발현 수준을 검출하는 단계; 및
    d) 상기 KRS 단백질의 발현량을 정상 대조군과 비교하여, KRS의 발현량이 증가하는 경우에 면역세포 이동 관련 질환인 것으로 진단하는 단계를 포함하는, 면역세포 이동 관련 질환 진단 방법.
PCT/KR2019/011998 2018-09-17 2019-09-17 세포 외막에 노출되는 라이실-tRNA 합성효소 N-말단 영역에 특이적으로 결합하는 항체 WO2020060156A1 (ko)

Priority Applications (7)

Application Number Priority Date Filing Date Title
BR112021004982-7A BR112021004982A2 (pt) 2018-09-17 2019-09-17 anticorpo, polinucleotídeo, vetor de expressão, célula transformada, métodos para produzir um anticorpo, para prevenir ou inibir o câncer e metástase do câncer, para diagnosticar câncer ou metástase do câncer, para tratar uma doença e para diagnosticar uma doença, composição farmacêutica, composições para diagnóstico e composição para prevenção ou tratamento de uma doença e uso do anticorpo
AU2019341266A AU2019341266B2 (en) 2018-09-17 2019-09-17 Antibody for specifically binding to Lysyl-tRNA synthetase N-terminal domain exposed to extracellular membrane
JP2021514393A JP7453694B2 (ja) 2018-09-17 2019-09-17 細胞外膜に露出されるリシル－ｔＲＮＡ合成酵素のＮ－末端領域に特異的に結合する抗体
CA3117001A CA3117001C (en) 2018-09-17 2019-09-17 Antibody for specifically binding to lysyl-trna synthetase n-terminal domain exposed to extracellular membrane
US17/276,570 US20220049016A1 (en) 2018-09-17 2019-09-17 Antibody for Specifically Binding to Lysyl-tRNA Synthetase N-Terminal Domain Exposed to Extracellular Membrane
EP19863201.0A EP3882272A4 (en) 2018-09-17 2019-09-17 ANTIBODIES SPECIFICALLY BINDING TO AN N-TERMINAL DOMAIN OF LYSYL-ARNT SYNTHETASE EXPOSED ON AN EXTRACELLULAR MEMBRANE
CN201980075543.0A CN113195543A (zh) 2018-09-17 2019-09-17 与暴露于细胞外的赖氨酰-tRNA合成酶N-末端区域特异性结合的抗体

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20180111046 2018-09-17
KR10-2018-0111046 2018-09-17

Publications (1)

Publication Number Publication Date
WO2020060156A1 true WO2020060156A1 (ko) 2020-03-26

Family

ID=69887585

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2019/011998 WO2020060156A1 (ko) 2018-09-17 2019-09-17 세포 외막에 노출되는 라이실-tRNA 합성효소 N-말단 영역에 특이적으로 결합하는 항체

Country Status (9)

Country Link
US (1) US20220049016A1 (ko)
EP (1) EP3882272A4 (ko)
JP (1) JP7453694B2 (ko)
KR (1) KR102290507B1 (ko)
CN (1) CN113195543A (ko)
AU (1) AU2019341266B2 (ko)
BR (1) BR112021004982A2 (ko)
CA (1) CA3117001C (ko)
WO (1) WO2020060156A1 (ko)

Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO2001040302A2 (en) * 1999-11-29 2001-06-07 Marlene Lydia Rose Organ transplant rejection and associated conditions
KR20100040583A (ko) * 2008-10-10 2010-04-20 서울대학교산학협력단 항-라이실 티알엔에이 합성효소 항체 및 항-라미닌 수용체 항체를 유효성분으로 포함하는 암 진단용 조성물
WO2011153277A2 (en) * 2010-06-01 2011-12-08 Atyr Pharma, Inc. Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of lysyl-trna synthetases
KR101658625B1 (ko) * 2013-12-30 2016-09-22 재단법인 의약바이오컨버젼스연구단 항 krs 모노클로날 항체 및 이의 용도
KR20170100206A (ko) * 2016-02-25 2017-09-04 재단법인 의약바이오컨버젼스연구단 대장암 진단용 조성물과 진단 마커 검출 방법
KR20180035446A (ko) 2016-09-29 2018-04-06 엘지디스플레이 주식회사 유기발광 표시장치
KR20180111046A (ko) 2017-03-31 2018-10-11 가톨릭관동대학교산학협력단 Co2와 rf를 이용한 봉합사 장치
KR20190031189A (ko) * 2017-09-15 2019-03-25 재단법인 의약바이오컨버젼스연구단 라이실 tRNA 합성효소 N-말단에 특이적으로 결합하는 항체를 유효성분으로 포함하는 면역세포 이동 관련 질환의 예방 또는 치료용 약학적 조성물

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010021415A1 (en) * 2008-08-18 2010-02-25 Seoul National University Industry Foundation Method for controlling cancer metastasis or cancer cell migration by modulating the cellular level of lysyl trna synthetase
KR20180109645A (ko) * 2017-03-27 2018-10-08 재단법인 의약바이오컨버젼스연구단 세포 외막에 노출되는 라이실-tRNA 합성효소 N-말단 영역에 특이적으로 결합하는 항체

Patent Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO2001040302A2 (en) * 1999-11-29 2001-06-07 Marlene Lydia Rose Organ transplant rejection and associated conditions
KR20100040583A (ko) * 2008-10-10 2010-04-20 서울대학교산학협력단 항-라이실 티알엔에이 합성효소 항체 및 항-라미닌 수용체 항체를 유효성분으로 포함하는 암 진단용 조성물
WO2011153277A2 (en) * 2010-06-01 2011-12-08 Atyr Pharma, Inc. Innovative discovery of therapeutic, diagnostic, and antibody compositions related to protein fragments of lysyl-trna synthetases
KR101658625B1 (ko) * 2013-12-30 2016-09-22 재단법인 의약바이오컨버젼스연구단 항 krs 모노클로날 항체 및 이의 용도
KR20170100206A (ko) * 2016-02-25 2017-09-04 재단법인 의약바이오컨버젼스연구단 대장암 진단용 조성물과 진단 마커 검출 방법
KR20180035446A (ko) 2016-09-29 2018-04-06 엘지디스플레이 주식회사 유기발광 표시장치
KR20180111046A (ko) 2017-03-31 2018-10-11 가톨릭관동대학교산학협력단 Co2와 rf를 이용한 봉합사 장치
KR20190031189A (ko) * 2017-09-15 2019-03-25 재단법인 의약바이오컨버젼스연구단 라이실 tRNA 합성효소 N-말단에 특이적으로 결합하는 항체를 유효성분으로 포함하는 면역세포 이동 관련 질환의 예방 또는 치료용 약학적 조성물

Non-Patent Citations (7)

* Cited by examiner, † Cited by third party
Title
"Genbank", Database accession no. XP_006255692.1
CLYNES ET AL., PROC. NATL. ACAD. SCI. (USA, vol. 95, 1998, pages 652 - 656
DAE GYU KIM ET AL.: "Chemical inhibition of prometastatic lysyl-tRNA synthetase-laminin receptor interaction", NAT CHEM BIOL., vol. 10, no. 1, January 2014 (2014-01-01), pages 29 - 34, XP055758205, DOI: 10.1038/nchembio.1381
DAE GYU KIM: "Interaction of two translational components, lysyl-tRNA synthetase and p40/37LRP, in plasma membrane promotes laminin-dependent cell migration", FASEB J., vol. 26, 2012, pages 4142 - 4159, XP009171174, DOI: 10.1096/fj.12-207639
LEE WOO SEOK ET AL.: "Clinical characteristics and prognostic factors of patients with severe pulmonary hypertension", KOREAN CIRCULATION J, vol. 37, 2007, pages 265 - 270
PACHER PNAGAYAMA TMUKHOPADHYAY PBATKAI SKASS DA: "Measurement of cardiac function using pressure-volume conductance catheter technique in mice and rats", NAT PROTOC, vol. 3, no. 9, 2008, pages 1422 - 34
PARK, S. G. ET AL.: "Human lysyl-tRNA synthetase is secreted to trigger pro-inflammatory response", PROC. NATL. ACAD. SCI. U S A, vol. 102, 2005, pages 6356 - 6361

Also Published As

Publication number Publication date
CA3117001A1 (en) 2020-03-26
KR102290507B1 (ko) 2021-08-17
BR112021004982A2 (pt) 2021-06-08
KR20200032019A (ko) 2020-03-25
CN113195543A (zh) 2021-07-30
JP7453694B2 (ja) 2024-03-21
CA3117001C (en) 2023-09-19
EP3882272A4 (en) 2022-10-12
AU2019341266A1 (en) 2021-05-20
EP3882272A1 (en) 2021-09-22
US20220049016A1 (en) 2022-02-17
AU2019341266B2 (en) 2024-09-05
JP2022500051A (ja) 2022-01-04

Similar Documents

Publication Publication Date Title
WO2019190206A1 (ko) 클라우딘 3의 ecl-2에 특이적으로 결합하는 항체, 이의 단편 및 이들의 용도
WO2013187724A1 (en) Novel antibody specific for clec14a and uses thereof
WO2019107812A1 (ko) 세포의 세포질에 침투하여 세포내 활성화된 ras를 억제하는 항체 및 이의 용도
WO2016137108A1 (en) Novel antibody binding to tfpi and composition comprising the same
WO2016013870A1 (ko) 완전한 이뮤노글로불린 형태의 항체를 세포막을 투과하여 세포질에 위치시키는 방법 및 그의 이용
WO2014077648A1 (ko) 인간 및 마우스 ｌ１ｃａｍ 단백질에 특이적으로 결합하는 항체 및 이의 용도
WO2022039490A1 (en) Anti-b7-h4/anti-4-1bb bispecific antibodies and use thereof
WO2020251316A1 (ko) α-SYN/IGF1R에 대한 이중 특이 항체 및 그 용도
WO2018174544A2 (ko) Muc1에 특이적으로 결합하는 항체 및 그의 용도
WO2016013871A1 (ko) 완전한 이뮤노글로불린 형태의 세포질 침투능을 갖는 항체를 이용하여 세포내 활성화된 ras를 억제하는 방법 및 그의 이용
WO2021010800A1 (ko) Wrs 단백질에 특이적으로 결합하는 항체 및 이의 용도
WO2024196163A1 (ko) 신규한 항-인간 알스폰딘3 항체 및 이의 용도
WO2024196162A1 (ko) 신규한 항-인간 알스폰딘2 항체 및 이의 용도
WO2022149837A1 (ko) 항-fgfr3 항체 및 이의 용도
WO2022085905A1 (ko) SARS-CoV-2 스파이크 단백질에 특이적으로 결합하는 항체 및 이의 용도
WO2021101346A1 (en) Anti-ror1/anti-4-1bb bispecific antibodies and uses thereof
WO2015130115A1 (en) Novel antibody specific for tspan8 and uses thereof
WO2020060156A1 (ko) 세포 외막에 노출되는 라이실-tRNA 합성효소 N-말단 영역에 특이적으로 결합하는 항체
WO2021010799A1 (ko) Wrs 단백질에 특이적으로 결합하는 항체 및 이의 용도
WO2021015419A1 (ko) 인산화된 베타-카테닌에 특이적으로 결합하는 항체 및 이의 용도
WO2020117017A1 (ko) 항 c-met 아고니스트 항체 및 이의 용도
WO2020117019A1 (ko) 항 c-met 아고니스트 항체 및 이의 용도
WO2021054778A1 (ko) Cox2 단백질의 아세틸화 검출용 항체 및 이의 용도
WO2022231320A1 (ko) Sars-cov-2 s 단백질에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편, 및 이들의 용도
WO2023022531A1 (ko) Lpa 수용체에 대한 고 친화성 항체의 개발

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19863201

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2021514393

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021004982

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 3117001

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019863201

Country of ref document: EP

Effective date: 20210419

ENP Entry into the national phase

Ref document number: 2019341266

Country of ref document: AU

Date of ref document: 20190917

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112021004982

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210316