WO2019108824A1 - Myst family histone acetyltransferase inhibitors - Google Patents
Myst family histone acetyltransferase inhibitors Download PDFInfo
- Publication number
- WO2019108824A1 WO2019108824A1 PCT/US2018/063110 US2018063110W WO2019108824A1 WO 2019108824 A1 WO2019108824 A1 WO 2019108824A1 US 2018063110 W US2018063110 W US 2018063110W WO 2019108824 A1 WO2019108824 A1 WO 2019108824A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- kat
- compound
- optionally substituted
- ring
- independently selected
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C*C(CC1)[N-][N+]1(C)[C@](C)C* Chemical compound C*C(CC1)[N-][N+]1(C)[C@](C)C* 0.000 description 40
- IGHFMCWYFKXQOT-UHFFFAOYSA-N CC(C(CN1C)Cl)[NH+]1[O-] Chemical compound CC(C(CN1C)Cl)[NH+]1[O-] IGHFMCWYFKXQOT-UHFFFAOYSA-N 0.000 description 1
- ZMIAIRKTGWPIDS-UHFFFAOYSA-N CC(C)(C)C1C(CC2)CC2CC1 Chemical compound CC(C)(C)C1C(CC2)CC2CC1 ZMIAIRKTGWPIDS-UHFFFAOYSA-N 0.000 description 1
- JCPARHDDRHLQHK-UHFFFAOYSA-N CC(C)(C)OC(N(C)c1cc(SCc2ccccc2)ccc1)=O Chemical compound CC(C)(C)OC(N(C)c1cc(SCc2ccccc2)ccc1)=O JCPARHDDRHLQHK-UHFFFAOYSA-N 0.000 description 1
- NSZFIEWUXHCQRG-UHFFFAOYSA-N CC(C)CC(CC1)CC1NC(N(C)C)=O Chemical compound CC(C)CC(CC1)CC1NC(N(C)C)=O NSZFIEWUXHCQRG-UHFFFAOYSA-N 0.000 description 1
- FMXMVKRXCYXCED-UHFFFAOYSA-N CC(C)CC(CC1)CC1NC(NCC(CC1)CCC1OC)=O Chemical compound CC(C)CC(CC1)CC1NC(NCC(CC1)CCC1OC)=O FMXMVKRXCYXCED-UHFFFAOYSA-N 0.000 description 1
- CBKCHQUWWTTYEQ-UHFFFAOYSA-N CC(C)CC1N=NCC1 Chemical compound CC(C)CC1N=NCC1 CBKCHQUWWTTYEQ-UHFFFAOYSA-N 0.000 description 1
- GCOOICCQOYDKNF-UHFFFAOYSA-N CC(C)S(N1CC(CC(C)(C)C)C1)(=O)=O Chemical compound CC(C)S(N1CC(CC(C)(C)C)C1)(=O)=O GCOOICCQOYDKNF-UHFFFAOYSA-N 0.000 description 1
- KWSARSUDWPZTFF-UHFFFAOYSA-N CC1C(CC2)CC2C1 Chemical compound CC1C(CC2)CC2C1 KWSARSUDWPZTFF-UHFFFAOYSA-N 0.000 description 1
- XISUNXMPFFHVNR-UHFFFAOYSA-N CC1C(CC2)CC2CC1 Chemical compound CC1C(CC2)CC2CC1 XISUNXMPFFHVNR-UHFFFAOYSA-N 0.000 description 1
- CFSFEIZUJGTCRB-UHFFFAOYSA-N CC1CC(C2)C2C1 Chemical compound CC1CC(C2)C2C1 CFSFEIZUJGTCRB-UHFFFAOYSA-N 0.000 description 1
- YDNRHXWDSWVSDN-UHFFFAOYSA-N CC1N=NC=C1 Chemical compound CC1N=NC=C1 YDNRHXWDSWVSDN-UHFFFAOYSA-N 0.000 description 1
- JGLNJCNCCMZMEX-UHFFFAOYSA-N CCC(C1)CN1S(C1CCC1)(=O)=O Chemical compound CCC(C1)CN1S(C1CCC1)(=O)=O JGLNJCNCCMZMEX-UHFFFAOYSA-N 0.000 description 1
- WEGQNCBAHLCDQU-UHFFFAOYSA-N CCC(CC1)CC1NC(N)=O Chemical compound CCC(CC1)CC1NC(N)=O WEGQNCBAHLCDQU-UHFFFAOYSA-N 0.000 description 1
- KWQALHWREWOOQT-UHFFFAOYSA-N CCC(CC1)CC1NC(N1CCCCC1)=O Chemical compound CCC(CC1)CC1NC(N1CCCCC1)=O KWQALHWREWOOQT-UHFFFAOYSA-N 0.000 description 1
- YEJJUJNTWYKFLS-UHFFFAOYSA-N CCC(N1CCCC1)=O Chemical compound CCC(N1CCCC1)=O YEJJUJNTWYKFLS-UHFFFAOYSA-N 0.000 description 1
- IIEWJVIFRVWJOD-UHFFFAOYSA-N CCC1CCCCC1 Chemical compound CCC1CCCCC1 IIEWJVIFRVWJOD-UHFFFAOYSA-N 0.000 description 1
- YQHVKMKMHMUAMJ-UHFFFAOYSA-N CCCC(C)[N](C)(C1)NC(C)C1Cl Chemical compound CCCC(C)[N](C)(C1)NC(C)C1Cl YQHVKMKMHMUAMJ-UHFFFAOYSA-N 0.000 description 1
- DMODCGXKGRESNJ-UHFFFAOYSA-N CCCC(C1Cl)[N-][NH+](C)C1C(C)(C)C Chemical compound CCCC(C1Cl)[N-][NH+](C)C1C(C)(C)C DMODCGXKGRESNJ-UHFFFAOYSA-N 0.000 description 1
- COAYDFNVMGJYQE-UHFFFAOYSA-N CCCC(CC1)CC1NC(N1CCCCC1)=O Chemical compound CCCC(CC1)CC1NC(N1CCCCC1)=O COAYDFNVMGJYQE-UHFFFAOYSA-N 0.000 description 1
- QYSRJQAFWNMVCO-UHFFFAOYSA-N CCCS(N1CC(CC)C1)(=O)=O Chemical compound CCCS(N1CC(CC)C1)(=O)=O QYSRJQAFWNMVCO-UHFFFAOYSA-N 0.000 description 1
- WPYOVDDPFSTFOV-UHFFFAOYSA-N CCN(CC(C)C1)C1=O Chemical compound CCN(CC(C)C1)C1=O WPYOVDDPFSTFOV-UHFFFAOYSA-N 0.000 description 1
- OZQATMOULRJAOL-VXGBXAGGSA-N CCO[C@H]1C[C@@H](CC(C)C)CCC1 Chemical compound CCO[C@H]1C[C@@H](CC(C)C)CCC1 OZQATMOULRJAOL-VXGBXAGGSA-N 0.000 description 1
- UNIOXDKEUNVBAC-JGVFFNPUSA-N CC[C@@H](CCC1)C[C@@H]1O Chemical compound CC[C@@H](CCC1)C[C@@H]1O UNIOXDKEUNVBAC-JGVFFNPUSA-N 0.000 description 1
- UNIOXDKEUNVBAC-YUMQZZPRSA-N CC[C@@H](CCC1)C[C@H]1O Chemical compound CC[C@@H](CCC1)C[C@H]1O UNIOXDKEUNVBAC-YUMQZZPRSA-N 0.000 description 1
- VBAPYXHNMYKBKN-OCAPTIKFSA-N C[C@H](CC1)CC[C@H]1OC Chemical compound C[C@H](CC1)CC[C@H]1OC VBAPYXHNMYKBKN-OCAPTIKFSA-N 0.000 description 1
- AYHJAFYGGNHRJY-UHFFFAOYSA-N C[N+]1(CCCC1)[Rn]C Chemical compound C[N+]1(CCCC1)[Rn]C AYHJAFYGGNHRJY-UHFFFAOYSA-N 0.000 description 1
- CSFAKVFYIYKTTG-UHFFFAOYSA-N C[n]1cnc(-c(cc2C(NNS(c(cc3)ncc3OC)(=O)=O)=O)cc(Cl)c2F)c1 Chemical compound C[n]1cnc(-c(cc2C(NNS(c(cc3)ncc3OC)(=O)=O)=O)cc(Cl)c2F)c1 CSFAKVFYIYKTTG-UHFFFAOYSA-N 0.000 description 1
- CBRVWGLEIUNELA-UHFFFAOYSA-N C[n]1cnc(-c(cc2Cl)cc(C(NNS(c(cccc3)c3F)(=O)=O)=O)c2F)c1 Chemical compound C[n]1cnc(-c(cc2Cl)cc(C(NNS(c(cccc3)c3F)(=O)=O)=O)c2F)c1 CBRVWGLEIUNELA-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C311/00—Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
- C07C311/48—Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups having nitrogen atoms of sulfonamide groups further bound to another hetero atom
- C07C311/49—Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups having nitrogen atoms of sulfonamide groups further bound to another hetero atom to nitrogen atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D205/00—Heterocyclic compounds containing four-membered rings with one nitrogen atom as the only ring hetero atom
- C07D205/02—Heterocyclic compounds containing four-membered rings with one nitrogen atom as the only ring hetero atom not condensed with other rings
- C07D205/04—Heterocyclic compounds containing four-membered rings with one nitrogen atom as the only ring hetero atom not condensed with other rings having no double bonds between ring members or between ring members and non-ring members
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D207/00—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom
- C07D207/02—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D207/04—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members
- C07D207/08—Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon radicals, substituted by hetero atoms, attached to ring carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D211/00—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings
- C07D211/04—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D211/06—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members
- C07D211/08—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms
- C07D211/18—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms with substituted hydrocarbon radicals attached to ring carbon atoms
- C07D211/20—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms with substituted hydrocarbon radicals attached to ring carbon atoms with hydrocarbon radicals, substituted by singly bound oxygen or sulphur atoms
- C07D211/24—Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms with substituted hydrocarbon radicals attached to ring carbon atoms with hydrocarbon radicals, substituted by singly bound oxygen or sulphur atoms by sulfur atoms to which a second hetero atom is attached
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/24—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
- C07D213/54—Radicals substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D223/00—Heterocyclic compounds containing seven-membered rings having one nitrogen atom as the only ring hetero atom
- C07D223/02—Heterocyclic compounds containing seven-membered rings having one nitrogen atom as the only ring hetero atom not condensed with other rings
- C07D223/04—Heterocyclic compounds containing seven-membered rings having one nitrogen atom as the only ring hetero atom not condensed with other rings with only hydrogen atoms, halogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D231/00—Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings
- C07D231/02—Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings
- C07D231/10—Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D231/12—Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D233/00—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings
- C07D233/54—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members
- C07D233/64—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with substituted hydrocarbon radicals attached to ring carbon atoms, e.g. histidine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D241/00—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings
- C07D241/02—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings not condensed with other rings
- C07D241/04—Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings not condensed with other rings having no double bonds between ring members or between ring members and non-ring members
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D257/00—Heterocyclic compounds containing rings having four nitrogen atoms as the only ring hetero atoms
- C07D257/02—Heterocyclic compounds containing rings having four nitrogen atoms as the only ring hetero atoms not condensed with other rings
- C07D257/04—Five-membered rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D265/00—Heterocyclic compounds containing six-membered rings having one nitrogen atom and one oxygen atom as the only ring hetero atoms
- C07D265/28—1,4-Oxazines; Hydrogenated 1,4-oxazines
- C07D265/30—1,4-Oxazines; Hydrogenated 1,4-oxazines not condensed with other rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D401/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
- C07D401/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
- C07D401/12—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D401/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
- C07D401/14—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D403/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
- C07D403/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
- C07D403/12—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D403/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
- C07D403/14—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing three or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D405/00—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
- C07D405/02—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings
- C07D405/12—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D405/00—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
- C07D405/14—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing three or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D409/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms
- C07D409/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings
- C07D409/12—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D413/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
- C07D413/06—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D413/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
- C07D413/12—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D413/14—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing three or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D417/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
- C07D417/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
- C07D417/12—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C2601/00—Systems containing only non-condensed rings
- C07C2601/06—Systems containing only non-condensed rings with a five-membered ring
- C07C2601/08—Systems containing only non-condensed rings with a five-membered ring the ring being saturated
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C2601/00—Systems containing only non-condensed rings
- C07C2601/12—Systems containing only non-condensed rings with a six-membered ring
- C07C2601/14—The ring being saturated
Definitions
- Protein acetylation is involved in several cellular processes. Lysine acetylation has been reported to modulate (e.g., inhibit) other protein modifications, such as methylation and ubiquitination, modify protein stability, alter subcellular localization, or change the spectrum of interacting proteins.
- Some aspects of the present disclosure are based on the recognition of the importance of histone acetyl transferases, such as lysine acetyl transferases (KATs), and in particular MYST family histone acetyltransferases, in initiation and/or progression of some diseases and disorders, e.g., in cancer.
- histone acetyl transferases such as lysine acetyl transferases (KATs), and in particular MYST family histone acetyltransferases
- MYST family KATs represent a valuable target for modulating MYST family KAT activity, e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8 activity, in vitro and in vivo, including, for example, in a clinical context, such as cancer therapies.
- MYST family KATs are therapeutic targets in diseases and conditions characterized by an aberrant activity of such KATs, e.g., an increased KAT-5, KAT-6A, KAT-7, and/or KAT-8 activity as compared to the respective activity observed in healthy cells, tissues, or under normal, non-pathological conditions.
- MYST family KATs e.g., KAT- 5, KAT-6A, KAT-7, and/or KAT-8
- KAT- 5, KAT-6A, KAT-7, and/or KAT-8 are therapeutic targets in various cancers.
- Some aspects of this disclosure are based on the recognition that MYST family KAT (e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8) activity in cancer cells is important for survival and/or proliferation of the cells.
- Some aspects of this disclosure provide methods and strategies for inhibiting the survival and/or proliferation of cells, e.g., of neoplastic or malignant cells, comprising contacting such cells with a MYST family KAT inhibitor, e.g., by contacting such cells with an inhibitor that inhibits KAT-5, KAT-6A, KAT-7, or KAT-8, or any combination thereof, in vitro, or in vivo , e.g., by administering the inhibitor to a subject harboring such cells or a tumor comprising such cells.
- a MYST family KAT inhibitor e.g., by contacting such cells with an inhibitor that inhibits KAT-5, KAT-6A, KAT-7, or KAT-8, or any combination thereof, in vitro, or in vivo , e.g., by administering the inhibitor to a subject harboring such cells or a tumor comprising such cells.
- the present disclosure thus provides certain therapies useful for the treatment of diseases or conditions characterized by aberrant MYST family KAT (e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8) activity, such as various cancers.
- Methods and compositions provided by the present disclosure may be applicable, for example, to treatment of a wide range of solid tumors and/or to hematological malignancies.
- Some aspects of this disclosure provide compounds, and pharmaceutically acceptable compositions thereof, that are inhibitors of MYST family lysine acetyl transferases (KATs).
- KATs MYST family lysine acetyl transferases
- the present disclosure provides inhibitors of MYST family KATs, e.g., of KAT-5, KAT-6A, KAT-7, and/or KAT-8.
- Such compounds have general formula G:
- compounds provided herein, and pharmaceutically acceptable compositions thereof are useful for treating a variety of diseases, disorders, or conditions, characterized by, associated with, or mediated by KAT activity, e.g., by KAT-5, KAT-6A, KAT- 7, and/or KAT-8 activity.
- KAT activity e.g., by KAT-5, KAT-6A, KAT- 7, and/or KAT-8 activity.
- Such diseases, disorders, or conditions include those described herein.
- Figure 1 presents a graph depicting the inhibition of acetylation of H3K23 in the human cell line CAL- 120 by compound A-30.
- structures depicted herein are also meant to include all isomeric (e.g., enantiomeric, diastereomeric, and geometric (or conformational)) forms of the structure; for example, the R and S configurations for each asymmetric center, Z and E double bond isomers, and Z and E conformational isomers. Therefore, single stereochemical isomers as well as enantiomeric, diastereomeric, and geometric (or conformational) mixtures of the present compounds are within the scope of the disclosure. LTnless otherwise stated, all tautomeric forms of the compounds of the disclosure are within the scope of the disclosure.
- structures depicted herein are also meant to include compounds that differ only in the presence of one or more isotopically enriched atoms.
- compounds having the present structures including the replacement of hydrogen by deuterium or tritium, or the replacement of a carbon by a 13 C- or 14 C-enriched carbon are within the scope of this disclosure.
- Such compounds are useful, for example, as analytical tools, as probes in biological assays, or as therapeutic agents in accordance with the present disclosure.
- administration typically refers to the administration of a composition to a subject or system.
- routes may, in appropriate circumstances, be utilized for administration to a subject, for example a human.
- administration may be systemic or local.
- administration may be enteral or parenteral.
- administration may be by injection ( e.g ., intramuscular, intravenous, or subcutaneous injection).
- injection may involve bolus injection, drip, perfusion, or infusion.
- administration may be topical.
- administration may involve electro-osmosis, hemodialysis, infiltration, iontophoresis, irrigation, and/or occlusive dressing.
- administration may involve dosing that is intermittent (e.g., a plurality of doses separated in time) and/or periodic (e.g ., individual doses separated by a common period of time) dosing.
- administration may involve continuous dosing.
- agent may refer to a compound, molecule, or entity of any chemical class including, for example, a small molecule, polypeptide, nucleic acid, saccharide, lipid, metal, or a combination or complex thereof.
- agent may refer to a compound, molecule, or entity that comprises a polymer.
- the term may refer to a compound or entity that comprises one or more polymeric moieties.
- the term“agent” may refer to a compound, molecule, or entity that is substantially free of a particular polymer or polymeric moiety.
- the term may refer to a compound, molecule, or entity that lacks or is substantially free of any polymer or polymeric moiety.
- Aliphatic means a straight-chain (i.e., unbranched) or branched, substituted or unsubstituted hydrocarbon chain that is completely saturated or that contains one or more units of unsaturation, or a monocyclic hydrocarbon or bicyclic hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic (also referred to herein as“carbocycle,” “carbocyclic”,“cycloaliphatic” or“cycloalkyl”), that has a single point of attachment to the rest of the molecule.
- aliphatic groups contain 1-6 aliphatic carbon atoms.
- aliphatic groups contain 1-5 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-4 aliphatic carbon atoms. In still other embodiments, aliphatic groups contain 1-3 aliphatic carbon atoms, and in yet other embodiments, aliphatic groups contain 1-2 aliphatic carbon atoms.
- “carbocyclic” refers to a monocyclic C 3 -C 8 hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic, that has a single point of attachment to the rest of the molecule.
- Suitable aliphatic groups include, but are not limited to, linear or branched, substituted or unsubstituted alkyl, alkenyl, or alkynyl groups and hybrids thereof such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl or (cycloalkyl)alkenyl.
- Alkylene refers to a bivalent alkyl group. Exemplary alkylenes include -CH 2 -, -CH 2 CH 2 -, -CH(CH 3 )-, -CH 2 CH(CH 3 )-, -CH(CH 3 )CH 2 -, etc.
- an“alkylene chain” is a polymethylene group, i.e., -(CH 2 ) n- , wherein n is a positive integer, preferably from 1 to 6, from 1 to 4, from 1 to 3, from 1 to 2, or from 2 to 3.
- a substituted alkylene chain is a bivalent alkyl group in which one or more hydrogen atoms are replaced with a substituent. Suitable substituents include those described below for a substituted aliphatic group.
- Allele refers to one of two or more existing genetic variants of a specific polymorphic genomic locus.
- amino acid refers to any compound and/or substance that can be incorporated into a polypeptide chain, e.g ., through formation of one or more peptide bonds.
- an amino acid has the general structure H 2 N- C(H)(R)-COOH.
- an amino acid is a naturally-occurring amino acid.
- an amino acid is a non-natural amino acid; in some embodiments, an amino acid is a D-amino acid; in some embodiments, an amino acid is an L-amino acid.
- Standard amino acid refers to any of the twenty L-amino acids commonly found in naturally occurring peptides. “Nonstandard amino acid” refers to any amino acid, other than the standard amino acids, regardless of whether it is or can be found in a natural source.
- an amino acid, including a carboxy- and/or amino-terminal amino acid in a polypeptide can contain a structural modification as compared to the general structure above.
- an amino acid may be modified by methylation, amidation, acetylation, pegylation, glycosylation, phosphorylation, and/or substitution (e.g., of the amino group, the carboxylic acid group, one or more protons, and/or the hydroxyl group) as compared to the general structure.
- such modification may, for example, alter the stability or the circulating half-life of a polypeptide containing the modified amino acid as compared to one containing an otherwise identical unmodified amino acid.
- such modification does not significantly alter a relevant activity of a polypeptide containing the modified amino acid, as compared to one containing an otherwise identical unmodified amino acid.
- amino acid may be used to refer to a free amino acid; in some embodiments it may be used to refer to an amino acid residue of a polypeptide, e.g, an amino acid residue within a polypeptide.
- an analog refers to a substance that shares one or more particular structural features, elements, components, or moieties with a reference substance.
- an“analog” shows significant structural similarity with the reference substance, for example sharing a core or consensus structure, but also differs in one or more certain discrete ways.
- an analog is a substance that can be generated from the reference substance, e.g ., by chemical manipulation of the reference substance.
- an analog is a substance that can be generated through performance of a synthetic process substantially similar to (e.g, sharing a plurality of steps with) one that generates the reference substance.
- an analog can be generated through performance of a synthetic process different from that used to generate the reference substance.
- the term“approximately” or“about,” as applied to one or more values of interest refers to a value that is similar to a stated reference value.
- the term“approximately” or“about” refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (for example when the one or more values of interest define a sufficiently narrow range that application of such a percentage variance would obviate the stated range).
- Aryl refers to monocyclic or bicyclic ring systems having a total of five to fourteen ring members, wherein at least one ring in the system is aromatic and wherein each ring in the system contains 3 to 7 ring members.
- the term“aryl” may be used interchangeably with the term“aryl ring.”
- “aryl” refers to an aromatic ring system and exemplary groups include phenyl, biphenyl, naphthyl, anthracyl and the like, which may bear one or more substituents.
- aryl is a group in which an aromatic ring is fused to one or more non aromatic rings, such as indanyl, phthalimidyl, naphthimidyl, phenanthridinyl, or tetrahydronaphthyl, and the like.
- Biological sample includes, without limitation, cell cultures or extracts thereof; biopsied material obtained from a mammal or extracts thereof; and blood, saliva, urine, feces, semen, tears, or other body fluids or extracts thereof.
- Inhibition of activity of a lysine acetyl transferase, for example, a MYST family KAT, such as, e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8, in a biological sample is useful for a variety of purposes that are known to one of skill in the art. Examples of such purposes include, but are not limited to, blood transfusion, organ transplantation, biological specimen storage, and biological assays.
- Bridged bicyclic refers to any bicyclic ring system, i.e. carbocyclic or heterocyclic, saturated or partially unsaturated, having at least one bridge.
- a“bridge” is an unbranched chain of atoms or an atom or a valence bond connecting two bridgeheads, where a“bridgehead” is any skeletal atom of the ring system which is bonded to three or more skeletal atoms (excluding hydrogen).
- a bridged bicyclic group has 7-12 ring members and 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- bridged bicyclic groups are well known in the art and include those groups set forth below where each group is attached to the rest of the molecule at any substitutable carbon or nitrogen atom. Unless otherwise specified, a bridged bicyclic group is optionally substituted with one or more substituents as set forth for aliphatic groups. Additionally or alternatively, any substitutable nitrogen of a bridged bicyclic group is optionally substituted. Exemplary bridged bicyclics include:
- cancer refers to a disease, disorder, or condition in which cells exhibit relatively abnormal, uncontrolled, and/or autonomous growth, so that they display an abnormally elevated proliferation rate and/or aberrant growth phenotype characterized by a significant loss of control of cell proliferation.
- a cancer may be characterized by one or more tumors.
- adrenocortical carcinoma astrocytoma, basal cell carcinoma, carcinoid, cardiac, cholangiocarcinoma, chordoma, chronic myeloproliferative neoplasms, craniopharyngioma, ductal carcinoma in situ, ependymoma, intraocular melanoma, gastrointestinal carcinoid tumor, gastrointestinal stromal tumor (GIST), gestational trophoblastic disease, glioma, histiocytosis, leukemia (e.g ., acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), hairy cell leukemia, myelogenous leukemia, myeloid leukemia), lymphoma (e.g., Burkitt lymphoma), ALL, acute myeloid leukemia (AML), chronic lymphocytic leuk
- Chromosome refers to a DNA molecule, optionally together with associated polypeptides and/or other entities, for example as found in the nucleus of eukaryotic cells.
- a chromosome carries genes and functions (e.g., origin of replication) that permit it to transmit hereditary information.
- Combination therapy refers to a clinical intervention in which a subject is simultaneously exposed to two or more therapeutic regimens (e.g. two or more therapeutic agents).
- the two or more therapeutic regimens may be administered simultaneously.
- the two or more therapeutic regimens may be administered sequentially (e.g., a first regimen administered prior to administration of any doses of a second regimen).
- the two or more therapeutic regimens are administered in overlapping dosing regimens.
- administration of combination therapy may involve administration of one or more therapeutic agents or modalities to a subject receiving the other agent(s) or modality.
- combination therapy does not necessarily require that individual agents be administered together in a single composition (or even necessarily at the same time).
- two or more therapeutic agents or modalities of a combination therapy are administered to a subject separately, e.g., in separate compositions, via separate administration routes (e.g, one agent orally and another agent intravenously), and/or at different time points.
- two or more therapeutic agents may be administered together in a combination composition, or even in a combination compound (e.g., as part of a single chemical complex or covalent entity), via the same administration route, and/or at the same time.
- the term“corresponding to”, designates the position/identity of a structural element, e.g, of an amino acid residue, a nucleotide residue, or a chemical moiety, in a compound or composition through comparison with an appropriate reference compound or composition.
- a“disease or disorder associated with a MYST family KAT” or, alternatively,“a MYST family KAT- mediated disease or disorder” means any disease or other deleterious condition in which a MYST family KAT (e.g., KAT-5, KAT-6A, KAT-7, or KAT-8), or a mutant of a MYST family KAT, is known or suspected to play a role.
- a“disease or disorder associated with KAT-7” or, alternatively,“a KAT-7-mediated disease or disorder” means any disease or other deleterious condition in which KAT-7, or a mutant thereof, is known or suspected to play a role.
- a“disease or disorder characterized by aberrant MYST family KAT activity” means any disease or other deleterious condition in which an aberrant activity of a MYST family KAT (e.g., KAT-5, KAT-6A, KAT-7, or KAT-8), or a mutant thereof, is known or suspected to play a role.
- An aberrant activity includes, for example, an increased level of a MYST family KAT (e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8) activity as compared to a control or reference level.
- the control or reference level is an activity level of the MYST family KAT (e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8) observed, measured, or expected in the absence of the disease or condition, e.g., in a normal cell, tissue, or sample.
- a“disease or disorder characterized by aberrant KAT-7 activity” means any disease or other deleterious condition in which an aberrant activity of KAT-7, or a mutant thereof, is known or suspected to play a role.
- An aberrant activity includes, for example, an increased level of KAT-7 activity as compared to a control or reference level.
- the control or reference level is an activity level of KAT-7 observed, measured, or expected in the absence of the disease or condition, e.g., in a normal cell, tissue, or sample.
- Domain refers to a section or portion of a polypeptide.
- a“domain” is associated with a particular structural and/or functional feature of the polypeptide so that, when the domain is physically separated from the rest of its parent polypeptide, it substantially or entirely retains the particular structural and/or functional feature.
- a domain may include a portion of a polypeptide that, when separated from that (parent) polypeptide and linked with a different (recipient) polypeptide, substantially retains and/or imparts on the recipient polypeptide one or more structural and/or functional features that characterized it in the parent polypeptide.
- a domain is a section of a polypeptide.
- a domain is characterized by a particular structural element (e.g., a particular amino acid sequence or sequence motif, a-helix character, b-sheet character, coiled-coil character, random coil character), and/or by a particular functional feature (e.g., binding activity, enzymatic activity, folding activity, or signaling activity).
- a particular structural element e.g., a particular amino acid sequence or sequence motif, a-helix character, b-sheet character, coiled-coil character, random coil character
- a particular functional feature e.g., binding activity, enzymatic activity, folding activity, or signaling activity.
- epigenetic mark refers to a feature of a nucleic acid or polypeptide not directly governed by genetic code.
- an epigenetic mark may represent or result from a modification to the nucleic acid or polypeptide.
- modification can include, for example, methylation, acetylation, ubiquitiniation, phosphorylation, ribosylation, amidation, glycosylation or combinations thereof.
- a gene product can be a transcript.
- a gene product can be a polypeptide.
- expression of a nucleic acid sequence involves one or more of the following: (1) production of an RNA template from a DNA sequence (e.g, by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5’ cap formation, and/or 3’ end formation); (3) translation of an RNA into a polypeptide or protein; and/or (4) post-translational modification of a polypeptide or protein.
- Gene refers to a DNA sequence in a chromosome that encodes a gene product (e.g., an RNA product and/or a polypeptide product).
- a gene includes a coding sequence (e.g, a sequence that encodes a particular gene product); in some embodiments, a gene includes a non-coding sequence.
- a gene may include both coding (e.g., exonic) and non-coding (e.g., intronic) sequences.
- a gene may include one or more regulatory elements (e.g. promoters, enhancers, silencers, termination signals) that, for example, may control or impact one or more aspects of gene expression (e.g., cell-type-specific expression, inducible expression).
- Halogen means F, Cl, Br, or I.
- Heteroatom means one or more of oxygen, sulfur, nitrogen, phosphorus, or silicon (including, any oxidized form of nitrogen, sulfur, phosphorus, or silicon; the quaternized form of any basic nitrogen; or a substitutable nitrogen of a heterocyclic ring, for example N (as in 3,4-dihydro-2//-pyrrolyl), NH (as in pyrrolidinyl) or NR + (as in N-substituted pyrrolidinyl)).
- Heteroaryl The terms“heteroaryl” and“heteroar-,” used alone or as part of a larger moiety, e.g.,“heteroaralkyl,” or“heteroaralkoxy,” refer to groups having 5 to 10 ring atoms, preferably 5, 6, or 9 ring atoms; having 6, 10, or 14 p electrons shared in a cyclic array; and having, in addition to carbon atoms, from one to five heteroatoms.
- the term“heteroatom” refers to nitrogen, oxygen, or sulfur, and includes any oxidized form of nitrogen or sulfur, and any quaternized form of a basic nitrogen.
- heteroaryl groups include thienyl, furanyl, pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, indolizinyl, purinyl, naphthyridinyl, and pteridinyl.
- heteroaryl and“heteroar-”, as used herein, also include groups in which a heteroaromatic ring is fused to one or more aryl, cycloaliphatic, or heterocyclyl rings, where the radical or point of attachment is on the heteroaromatic ring.
- Exemplary groups include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, 4// quinolizinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, and pyrido[2,3-b]-l,4-oxazin- 3(4H)-one.
- a heteroaryl group may be mono- or bicyclic.
- the term“heteroaryl” may be used interchangeably with the terms“heteroaryl ring,”“heteroaryl group,” or“heteroaromatic,” any of which terms include rings that are optionally substituted.
- the term“heteroaralkyl” refers to an alkyl group substituted by a heteroaryl, wherein the alkyl and heteroaryl portions independently are optionally substituted.
- Heterocycle As used herein, the terms“heterocycle,”“heterocyclyl,”“heterocyclic radical,” and“heterocyclic ring” are used interchangeably and refer to a stable 5- to 7- membered monocyclic or 7- to lO-membered bicyclic heterocyclic moiety that is either saturated or partially unsaturated, and having, in addition to carbon atoms, one or more, preferably one to four, heteroatoms, as defined above.
- nitrogen includes a substituted nitrogen.
- the term “heterocycle,”“heterocyclyl,”“heterocyclic radical,” and“heterocyclic ring” are used interchangeably and refer to a stable 5- to 7- membered monocyclic or 7- to lO-membered bicyclic heterocyclic moiety that is either saturated or partially unsaturated, and having, in addition to carbon atoms, one or more, preferably one to four, heteroatoms, as defined above.
- nitrogen includes a substituted nitrogen
- nitrogen may be N (as in 3, 4-di hydro-2// pyrrolyl NH (as in pyrrolidinyl
- a heterocyclic ring can be attached to its pendant group at any heteroatom or carbon atom that results in a stable structure and any of the ring atoms can be optionally substituted.
- saturated or partially unsaturated heterocyclic radicals include tetrahydrofuranyl, tetrahydrothiophenyl pyrrolidinyl, piperidinyl, pyrrolinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, oxazolidinyl, piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl, thiazepinyl, morpholinyl, and quinuclidinyl.
- heterocyclyl refers to an alkyl group substituted by a heterocyclyl, wherein the alkyl and heterocyclyl portions independently are optionally substituted.
- Inhibitor As used herein, the term“inhibitor” is defined as a compound that binds to and/or inhibits a target protein, here a MYST family KAT, e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8, with measurable affinity.
- a target protein here a MYST family KAT, e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8, with measurable affinity.
- an inhibitor has an IC 50 and/or binding constant of less than about 50 mM, less than about 1 mM, less than about 500 nM, less than about 100 nM, or less than about 10 nM.
- Lower alkyl refers to a Ci -4 straight or branched alkyl group.
- exemplary lower alkyl groups are methyl, ethyl, propyl, isopropyl, butyl, isobutyl, and tert-butyl.
- Lower haloalkyl refers to a Ci -4 straight or branched alkyl group that is substituted with one or more halogen atoms.
- Measurable affinity means a measurable change in the activity of a target enzyme, here a MYST family KAT, e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8 between a sample comprising compounds of the present disclosure, or compositions thereof, and the target enzyme, and an equivalent sample comprising the target enzyme in the absence of said compound, or composition thereof.
- a target enzyme here a MYST family KAT, e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8 between a sample comprising compounds of the present disclosure, or compositions thereof, and the target enzyme, and an equivalent sample comprising the target enzyme in the absence of said compound, or composition thereof.
- mutant nucleic acid refers to an organism, a cell, or a biomolecule (e.g., a nucleic acid or a protein) that comprises a genetic variation as compared to a reference organism, cell, or biomolecule.
- a mutant nucleic acid may, in some embodiments, comprise a mutation, e.g., a nucleobase substitution, a deletion of one or more nucleobases, an insertion of one or more nucleobases, an inversion of two or more nucleobases, or a truncation, as compared to a reference nucleic acid molecule.
- a mutant protein may comprise an amino acid substitution, insertion, inversion, or truncation, as compared to a reference polypeptide. Additional mutations, e.g, fusions and indels, are known to those of skill in the art.
- An organism or cell comprising or expressing a mutant nucleic acid or polypeptide is also sometimes referred to herein as a“mutant.”
- a mutant comprises a genetic variant that is associated with a loss of function of a gene product.
- a loss of function may be a complete abolishment of function, e.g., an abolishment of the enzymatic activity of an enzyme, or a partial loss of function, e.g., a diminished enzymatic activity of an enzyme.
- a mutant comprises a genetic variant that is associated with a gain of function, e.g., with a negative or undesirable alteration in a characteristic or activity in a gene product.
- a mutant is characterized by a reduction or loss in a desirable level or activity as compared to a reference; in some embodiments, a mutant is characterized by an increase or gain of an undesirable level or activity as compared to a reference.
- the reference organism, cell, or biomolecule is a wild-type organism, cell, or biomolecule.
- nucleic acid refers to a polymer of at least three nucleotides.
- a nucleic acid comprises DNA.
- RNA RNA
- a nucleic acid is single stranded.
- a nucleic acid is double stranded.
- a nucleic acid comprises both single and double stranded portions.
- a nucleic acid comprises a backbone that comprises one or more phosphodiester linkages.
- a nucleic acid comprises a backbone that comprises both phosphodiester and non-phosphodiester linkages.
- a nucleic acid may comprise a backbone that comprises one or more phosphorothioate or 5'-N-phosphoramidite linkages and/or one or more peptide bonds, e.g., as in a“peptide nucleic acid”.
- a nucleic acid comprises one or more, or all, natural residues (e.g, adenine, cytosine, deoxyadenosine, deoxycytidine, deoxyguanosine, deoxythymidine, guanine, thymine, uracil).
- a nucleic acid comprises one or more, or all, non-natural residues.
- a non-natural residue comprises a nucleoside analog (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3- methyl adenosine, 5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl-uridine, 2- aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5- propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, 0(6)-methylguanine, 2-thiocytidine, methylated bases, intercalated bases, and combinations thereof).
- a nucleoside analog e.
- a non-natural residue comprises one or more modified sugars (e.g., 2'-fluororibose, ribose, 2'-deoxyribose, arabinose, and hexose) as compared to those in natural residues.
- a nucleic acid has a nucleotide sequence that encodes a functional gene product such as an RNA or polypeptide.
- a nucleic acid has a nucleotide sequence that comprises one or more introns.
- a nucleic acid may be prepared by isolation from a natural source, enzymatic synthesis (e.g by polymerization based on a complementary template, e.g., in vivo or in vitro , reproduction in a recombinant cell or system, or chemical synthesis.
- a nucleic acid is at least 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60,
- Parenteral The term "parenteral" as used herein includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques.
- Partially unsaturated refers to a ring moiety that includes at least one double or triple bond.
- the term“partially unsaturated” is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aryl or heteroaryl moieties, as herein defined.
- Peptide refers to a polypeptide that is typically relatively short, for example having a length of less than about 100 amino acids, less than about 50 amino acids, less than about 40 amino acids less than about 30 amino acids, less than about 25 amino acids, less than about 20 amino acids, less than about 15 amino acids, or less than 10 amino acids.
- composition refers to a composition that is suitable for administration to a human or animal subject.
- a pharmaceutical composition comprises an active agent formulated together with one or more pharmaceutically acceptable carriers.
- the active agent is present in a unit dose amount appropriate for administration in a therapeutic regimen.
- a therapeutic regimen comprises one or more doses administered according to a schedule that has been determined to show a statistically significant probability of achieving a desired therapeutic effect when administered to a subject or population in need thereof.
- a pharmaceutical composition may be specially formulated for administration in solid or liquid form, including those adapted for the following: oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin, lungs, or oral cavity; intravaginally or intrarectally, for example, as a pessary, cream, or foam; sublingually; ocularly; transdermally; or nasally, pulmonary, and to other mucosal surfaces.
- a pharmaceutical composition is intended and suitable for administration to a
- compositions of the compounds of this disclosure include those derived from suitable inorganic and organic acids and bases.
- Examples of pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
- inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid
- organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
- salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecyl sulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemi sulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pec
- Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and N + (Ci ⁇ alkyl) 4 salts.
- Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
- Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, loweralkyl sulfonate and aryl sulfonate.
- compositions comprising: a non-toxic carrier, adjuvant, or vehicle that does not destroy the pharmacological activity of the compound with which it is formulated.
- compositions of this disclosure include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.
- ion exchangers alumina, aluminum stearate, lecithin
- serum proteins such as human serum albumin
- buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate,
- compositions are formulated so that a dosage of between 0.01 to about 100 mg/kg, or about 0.1 mg/kg to about 50 mg/kg, and preferably from about 1 mg/kg to about 25 mg/kg, of subject body weight/day of the inhibitor can be administered to a patient receiving these compositions to obtain the desired therapeutic effect.
- the amount of a compound of the present disclosure in the composition will also depend upon the particular compound in the composition.
- Polypeptide As used herein, the term“polypeptide,” which is interchangeably used herein with the term“protein,” refers to a polymer of at least three amino acid residues. In some embodiments, a polypeptide comprises one or more, or all, natural amino acids. In some embodiments, a polypeptide comprises one or more, or all non-natural amino acids. In some embodiments, a polypeptide comprises one or more, or all, D-amino acids. In some embodiments, a polypeptide comprises one or more, or all, L-amino acids.
- a polypeptide comprises one or more pendant groups or other modifications, e.g., modifying or attached to one or more amino acid side chains, at the polypeptide’s N-terminus, at the polypeptide’s C-terminus, or any combination thereof.
- a polypeptide comprises one or more modifications such as acetylation, amidation, aminoethylation, biotinylation, carbamylation, carbonylation, citrullination, deamidation, deimination, eliminylation, glycosylation, lipidation, methylation, pegylation, phosphorylation, sumoylation, or combinations thereof.
- a polypeptide may participate in one or more intra- or inter-molecular disulfide bonds.
- a polypeptide may be cyclic, and/or may comprise a cyclic portion.
- a polypeptide is not cyclic and/or does not comprise any cyclic portion.
- a polypeptide is linear.
- a polypeptide may comprise a stapled polypeptide.
- a polypeptide participates in non-covalent complex formation by non-covalent or covalent association with one or more other polypeptides (e.g, as in an antibody).
- a polypeptide has an amino acid sequence that occurs in nature.
- a polypeptide has an amino acid sequence that does not occur in nature. In some embodiments, a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man. In some embodiments, the term“polypeptide” may be appended to a name of a reference polypeptide, activity, or structure; in such instances it is used herein to refer to polypeptides that share the relevant activity or structure and thus can be considered to be members of the same class or family of polypeptides.
- exemplary polypeptides within the class whose amino acid sequences and/or functions are known; in some embodiments, such exemplary polypeptides are reference polypeptides for the polypeptide class or family.
- a member of a polypeptide class or family shows significant sequence homology or identity with, shares a common sequence motif (e.g., a characteristic sequence element) with, and/or shares a common activity (in some embodiments at a comparable level or within a designated range) with a reference polypeptide of the class; in some embodiments with all polypeptides within the class).
- a member polypeptide shows an overall degree of sequence homology or identity with a reference polypeptide that is at least about 30-40%, and is often greater than about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more and/or includes at least one region (e.g ., a conserved region that may in some embodiments comprise a characteristic sequence element) that shows very high sequence identity, often greater than 90% or even 95%, 96%, 97%, 98%, or 99%.
- a conserved region that may in some embodiments comprise a characteristic sequence element
- Such a conserved region usually encompasses at least 3-4 and often up to 20 or more amino acids; in some embodiments, a conserved region encompasses at least one stretch of at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more contiguous amino acids.
- a useful polypeptide may comprise a fragment of a parent polypeptide.
- a useful polypeptide as may comprise a plurality of fragments, each of which is found in the same parent polypeptide in a different spatial arrangement relative to one another than is found in the polypeptide of interest (e.g., fragments that are directly linked in the parent may be spatially separated in the polypeptide of interest or vice versa, and/or fragments may be present in a different order in the polypeptide of interest than in the parent), so that the polypeptide of interest is a derivative of its parent polypeptide.
- reference refers to a standard or control relative to which a comparison is performed.
- an agent, animal, individual, population, sample, sequence, or value of interest is compared to a reference or control agent, animal, individual, population, sample, sequence, or value.
- a reference or control is tested and/or determined substantially simultaneously with the testing or determination of interest.
- a reference or control is a historical reference or control, optionally embodied in a tangible medium.
- a reference or control is determined or characterized under comparable conditions or circumstances to those under assessment.
- sample refers to a biological sample obtained or derived from a source of interest, as described herein.
- a source of interest comprises an organism, such as a microbe, a plant, an animal or a human.
- a biological sample comprises biological tissue or fluid.
- a biological sample may comprise bone marrow; blood; blood cells; ascites; tissue or fine needle biopsy samples; cell-containing body fluids; free floating nucleic acids; sputum; saliva; urine; cerebrospinal fluid, peritoneal fluid; pleural fluid; feces; lymph; gynecological fluids; skin swabs; vaginal swabs; oral swabs; nasal swabs; washings or lavages such as a ductal lavages or broncheoalveolar lavages; aspirates; scrapings; bone marrow specimens; tissue biopsy specimens; surgical specimens; other body fluids, secretions, and/or excretions; and/or cells therefrom.
- a biological sample comprises cells obtained from an individual, e.g., from a human or animal subject.
- obtained cells are or include cells from an individual from whom the sample is obtained.
- a sample is a“primary sample” obtained directly from a source of interest by any appropriate means.
- a primary biological sample is obtained by methods selected from the group consisting of biopsy (e.g, fine needle aspiration or tissue biopsy), surgery, collection of body fluid (e.g, blood, lymph, feces).
- sample refers to a preparation that is obtained by processing (e.g., by removing one or more components of and/or by adding one or more agents to) a primary sample. For example, filtering using a semi-permeable membrane.
- a“processed sample” may comprise, for example nucleic acids or polypeptides extracted from a sample or obtained by subjecting a primary sample to techniques such as amplification or reverse transcription of mRNA, isolation and/or purification of certain components.
- Subject refers to an organism, for example, a mammal (e.g., a human, a non-human mammal, a non-human primate, a primate, a laboratory animal, a mouse, a rat, a hamster, a gerbil, a cat, or a dog).
- a human subject is an adult, adolescent, or pediatric subject.
- a subject is suffering from a disease, disorder or condition, e.g, a disease, disorder or condition that can be treated as provided herein, e.g, a cancer or a tumor listed herein.
- a subject is susceptible to a disease, disorder, or condition; in some embodiments, a susceptible subject is predisposed to and/or shows an increased risk (as compared to the average risk observed in a reference subject or population) of developing the disease, disorder or condition.
- a subject displays one or more symptoms of a disease, disorder or condition.
- a subject does not display a particular symptom (e.g, clinical manifestation of disease) or characteristic of a disease, disorder, or condition.
- a subject does not display any symptom or characteristic of a disease, disorder, or condition.
- a subject is a patient.
- a subject is an individual to whom diagnosis and/or therapy is and/or has been administered.
- Substituted or optionally substituted As described herein, compounds of the disclosure may contain“optionally substituted” moieties.
- the term“substituted,” whether preceded by the term“optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent.“Substituted” applies to one or more
- an optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position.
- Combinations of substituents envisioned by this disclosure are preferably those that result in the formation of stable or chemically feasible compounds.
- the term“stable,” as used herein, refers to compounds that are not substantially altered when subjected to conditions to allow for their production, detection, and, in certain embodiments, their recovery, purification, and use for one or more of the purposes disclosed herein.
- Suitable monovalent substituents on R° are independently halogen, -(CH 2 ) 0-2 R ⁇ , -(haloR*), -(CH 2 ) 0-2 OH, -(CH 2 ) 0-2 OR ⁇ , -(CH 2 ) 0 _
- Suitable divalent substituents that are bound to vicinal substitutable carbons of an “optionally substituted” group include: -0(CR * 2 ) 2-3 0-, wherein each independent occurrence of R * is selected from hydrogen, Ci_ 6 aliphatic which may be substituted as defined below, or an unsubstituted 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- Suitable substituents on the aliphatic group of R * include halogen, -R*, -(haloR*), -OH, -OR*, -O(haloR'), -CN, -C(0)OH, -C(0)OR*, -NH 2 , -NHR*, -NR* 2 , or -NO2, wherein each R* is unsubstituted or where preceded by“halo” is substituted only with one or more halogens, and is independently Ci_ 4 aliphatic, -CH 2 Ph, -0(CH 2 )o-iPh, or a 5- to 6- membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- Suitable substituents on a substitutable nitrogen of an“optionally substituted” group include -R ⁇ , -NR ⁇ 2 , -C(0)R ⁇ , -C(0)OR ⁇ , -C(0)NR ⁇ 2 , -C(0)C(0)R ⁇ ,
- each R ⁇ is independently hydrogen, Ci_ 6 aliphatic which may be substituted as defined below, unsubstituted -OPh, or an unsubstituted 5- to 6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or, notwithstanding the definition above, two independent occurrences of R ⁇ , taken together with their intervening atom(s) form an unsubstituted 3- to l2-membered saturated, partially unsaturated, or aryl mono- or bicyclic ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- Suitable substituents on the aliphatic group of R ⁇ are independently halogen, -R*, -(haloR*), -OH, -OR*, -O(haloR'), -CN, -C(0)OH, -C(0)OR*, -NH 2 , -NHR*, -NR* 2, or -N0 2 , wherein each R* is unsubstituted or where preceded by“halo” is substituted only with one or more halogens, and is independently C
- therapeutic agent in general refers to any agent that elicits a desired effect (e.g a desired biological, clinical, or pharmacological effect) when administered to a subject.
- a desired effect e.g a desired biological, clinical, or pharmacological effect
- an agent is considered to be a therapeutic agent if it demonstrates a statistically significant effect across an appropriate population.
- an appropriate population is a population of subjects suffering from and/or susceptible to a disease, disorder or condition.
- an appropriate population is a population of model organisms.
- an appropriate population may be defined by one or more criterion such as age group, gender, genetic background, preexisting clinical conditions, or prior exposure to therapy.
- a therapeutic agent is a substance that alleviates, ameliorates, relieves, inhibits, prevents, delays onset of, reduces severity of, and/or reduces incidence of one or more symptoms or features of a disease, disorder, and/or condition in a subject when administered to the subject in an effective amount.
- a“therapeutic agent” is an agent that has been or is required to be approved by a government agency before it can be marketed for administration to humans.
- a“therapeutic agent” is an agent for which a medical prescription is required for administration to humans.
- therapeutic agents may be MYST family KAT inhibitors, for example, KAT-5, KAT-6A, KAT-7, and/or KAT-8 inhibitors, as described herein.
- therapeutically effective amount refers to an amount that produces a desired effect (e.g ., a desired biological, clinical, or pharmacological effect) in a subject or population to which it is administered. In some embodiments, the term refers to an amount statistically likely to achieve the desired effect when administered to a subject in accordance with a particular dosing regimen (e.g., a therapeutic dosing regimen).
- the term refers to an amount sufficient to produce the effect in at least a significant percentage (e.g, at least about 25%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, or more) of a population that is suffering from and/or susceptible to a disease, disorder, and/or condition.
- a therapeutically effective amount is one that reduces the incidence and/or severity of, and/or delays onset of, one or more symptoms of the disease, disorder, and/or condition.
- a therapeutically effective amount does not in fact require successful treatment be achieved in a particular individual.
- a therapeutically effective amount may be an amount that provides a particular desired response in a significant number of subjects when administered to patients in need of such treatment, e.g., in at least about 25%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, or more patients within a treated patient population.
- reference to a therapeutically effective amount may be a reference to an amount sufficient to induce a desired effect as measured in one or more specific tissues (e.g ., a tissue affected by the disease, disorder or condition) or fluids (e.g ., blood, saliva, serum, sweat, tears, urine).
- a therapeutically effective amount of a particular agent or therapy may be formulated and/or administered in a single dose.
- a therapeutically effective agent may be formulated and/or administered in a plurality of doses, for example, as part of a dosing regimen.
- Treat, treatment or treating refers to partially or completely alleviating, inhibiting, delaying onset of, preventing, ameliorating and/or relieving a disorder or condition, or one or more symptoms of the disorder or condition, as described herein.
- treatment may be administered after one or more symptoms have developed.
- the term “treating” includes preventing or halting the progression of a disease or disorder.
- treatment may be administered in the absence of symptoms.
- treatment may be administered to a susceptible individual prior to the onset of symptoms (e.g., in light of a history of symptoms and/or in light of genetic or other susceptibility factors). Treatment may also be continued after symptoms have resolved, for example to prevent or delay their recurrence.
- the term“treating” includes preventing relapse or recurrence of a disease or disorder.
- Tumor refers to an abnormal growth of cells or tissue.
- a tumor may comprise cells that are precancerous (e.g., benign), malignant, pre-metastatic, metastatic, and/or non-metastatic.
- a tumor is associated with, or is a manifestation of, a cancer.
- a tumor may be a disperse tumor or a liquid tumor.
- a tumor may be a solid tumor.
- Unit dosage form refers to a physically discrete unit of a provided compound and/or compositions thereof appropriate for the subject to be treated. It will be understood, however, that the total daily usage of the active agent (i.e., compounds and compositions of the present disclosure) will be decided by the attending physician within the scope of sound medical judgment.
- the specific effective dose level for any particular subject i.e., patient or organism will depend upon a variety of factors including the disorder being treated and the severity of the disorder; activity of specific active agent employed; specific composition employed; age, body weight, general health, sex and diet of the subject; time of administration, route of administration, and rate of excretion of the specific active agent employed; duration of the treatment; and like factors well known in the medical arts.
- Unsaturated means that a moiety has one or more units of unsaturation.
- Wild-type refers to a form of an entity (e.g ., a polypeptide or nucleic acid) that has a structure and/or activity as found in nature in a“normal” (as contrasted with mutant, diseased, altered) state or context.
- entity e.g ., a polypeptide or nucleic acid
- more than one“wild type” form of a particular polypeptide or nucleic acid may exist in nature, for example as“alleles” of a particular gene or normal variants of a particular polypeptide.
- that form (or those forms) of a particular polypeptide or nucleic acid that is most commonly observed in a population is the“wild type” form.
- the present disclosure provides a compound of formula
- Z is selected from -Cy, -(C l-3 aliphatic)-Cy, or optionally substituted Ci -4 aliphatic;
- Cy is an optionally substituted group selected from phenyl, a 3-10 membered saturated or partially unsaturated carbocyclic ring, a 6-10 membered bridged bicyclic carbocyclic ring, a 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 6-8 membered bridged bicyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur, an 8-10 membered bicyclic aryl ring, and an 8-10 membered bicyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen oxygen and sulfur;
- each of R 1 and R 2 is independently selected from halogen and Ci -4 aliphatic;
- R 3 is selected from hydrogen, halogen, -CN, -NR 2 , and optionally substituted C l-4 aliphatic; each R is independently selected from hydrogen, optionally substituted C l-4 aliphatic, and - C(0)0(Ci- aliphatic);
- Ring A is an optionally substituted 5- or 6-membered heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen and sulfur;
- each R a is selected from halogen and optionally substituted C l-4 aliphatic;
- x is 0-3.
- the present disclosure provides a compound of formula I:
- Z is selected from -Cy, -(Ci aliphatic)-Cy or optionally substituted Ci -4 aliphatic;
- Cy is an optionally substituted group selected from phenyl, a 3-10 membered saturated or partially unsaturated carbocyclic ring, a 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 6-8 membered bridged bicyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur, an 8-10 membered bicyclic aryl ring, and an 8-10 membered bicyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen oxygen and sulfur; each of R 1 and R 2 is independently selected from halogen and Ci -4 aliphatic;
- Ring A is an optionally substituted 5- or 6-membered heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen and sulfur;
- each R a is selected from halogen and optionally substituted C l-4 aliphatic;
- x is 0-3.
- the compound of formula I’ is not:
- the compound of formula I is not:
- Z is selected from -Cy, -(Ci aliphatic)-Cy or optionally substituted Ci -4 aliphatic.
- Z is optionally substituted Ci -4 aliphatic.
- Z is methyl, ethyl, isopropyl, and tert- butyl.
- Z is -Cy. In some such embodiments, Z is selected from the group consisting of:
- Z is -Cy. In some such embodiments, Z is selected from the group consisting of: 31
- Z is -Cy. In some such embodiments, Z is selected from the group consisting of:
- Z is not:
- Z is -(C l-3 aliphatic)-Cy. In some such embodiments, Z is -
- Z is selected from the group consisting of:
- Z is -(Ci aliphatic)-Cy. In some such embodiments, Z is -
- Z is selected from the group consisting of:
- Cy is an optionally substituted group selected from phenyl, a 3-10 membered saturated or partially unsaturated carbocyclic ring, a 6-10 membered bridged bicyclic carbocyclic ring, a 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 6-8 membered bridged bicyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 5-6 membered heteroaryl ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, an 8-10 membered bicyclic aryl ring, and an 8-10 membered bicyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen oxygen and sulfur.
- Cy is phenyl
- Cy is an optionally substituted 3-10 membered saturated or partially unsaturated carbocyclic ring. In some embodiments, Cy is an optionally substituted 3- 10 membered saturated carbocyclic ring. In some such embodiments, Cy is an optionally substituted group selected from cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and cycloheptyl.
- Cy is an optionally substituted bicyclic carbocyclic ring. It will be appreciated that a bicyclic carbocyclic ring can be a bridged bicyclic ring. In some such embodiments, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some embodiments, Cy is a 5-membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from pyrazolyl, imidazolyl, and triazolyl. In some embodiments, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some embodiments, Cy is a 6-membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from pyridinyl. In some embodiments, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur.
- Cy is an optionally substituted 4-membered saturated heterocyclic group having 1 heteroatom independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is optionally substituted oxetanyl. In some such embodiments, Cy is optionally substituted oxetanyl or azetidinyl.
- Cy is an optionally substituted 5-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from tetrahydrofuranyl and pyrrolidinyl.
- Cy is an optionally substituted 6-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from tetrahydropyranyl and piperidinyl. In some such embodiments, Cy is an optionally substituted group selected from tetrahydropyranyl, piperidinyl, and piperazinyl.
- Cy is an optionally substituted 7-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. It will be appreciated that a 7-membered saturated heterocyclic ring can be a bridged bicyclic ring. In some such embodiments, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 8-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. It will be appreciated that an 8-membered saturated heterocyclic ring can be a bridged bicyclic ring. In some such embodiments, Cy is an optionally substituted group selected from:
- each of R 1 and R 2 is independently selected from halogen and Ci -4 aliphatic.
- R 1 is fluoro.
- R 1 is chloro.
- R 1 is methyl.
- R 2 is fluoro.
- R 2 is chloro.
- R 2 is methyl.
- R 1 is fluoro and R 2 is chloro.
- R 1 is fluoro and R 2 is methyl.
- R 1 is fluoro and R 2 is fluoro.
- R 1 is chloro and R 2 is chloro.
- R 1 is methyl and R 2 is methyl.
- R 3 is selected from hydrogen, halogen, -CN, -NR 2 , and optionally substituted C l-4 aliphatic.
- R 3 is hydrogen.
- R 3 is halogen.
- R 3 is -CN.
- R 3 is -NR 2.
- R 3 is -NH 2.
- R 3 is -N(C(0)O l Bu) 2.
- R 3 is optionally substituted C l-4 aliphatic.
- each R is independently selected from hydrogen, optionally substituted C l-4 aliphatic, and -C(0)0(Ci -4 aliphatic). In some embodiments, each R is hydrogen. In some embodiments, each R is -C(0)0(Ci -4 aliphatic). In some embodiments, each R is -C(0)O l Bu.
- Ring A is an optionally substituted 5- or 6-membered heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen and sulfur.
- Ring A is an optionally substituted 5-membered heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some embodiments, Ring A is an optionally substituted 5-membered heteroaryl ring having 2-3 nitrogen atoms. In some such embodiments, Ring A is selected from pyrazolyl, imidazolyl, and triazolyl.
- Ring A is an optionally substituted 5-membered heteroaryl ring having 4 nitrogen atoms. In some embodiments, Ring A is tetrazol-5-yl.
- Ring A is an optionally substituted 5-membered heteroaryl ring having 1 nitrogen atom and 1 additional heteroatom selected from oxygen and sulfur. In some such embodiments, Ring A is selected from oxazolyl and thiazolyl.
- Ring A is selected from:
- Ring A is selected from
- Ring ⁇ [0108] In some embodiments, Ring ⁇
- Ring A is not:
- Ring A is an optionally substituted 6-membered heteroaryl ring having 1-4 heteroatoms independently selected nitrogen, oxygen and sulfur. In some such embodiments, Ring A is selected from 2-pyridyl, 3-pyridyl and 4-pyridyl. [0111] As defined above, x is 0-3. In some embodiments, x is 0. In some embodiments, x is
- x is 2. In some embodiments, x is 3. In some embodiments, x is 0-1. In some embodiments, x is 1-2.
- ⁇ / ⁇ (Ra) x j selected from the group consisting of:
- a compound of formula I is selected from the group consisting of those listed in Table 1:
- R 1 is fluoro and R 2 is chloro, thus forming a compound of formula I-a:
- Z is selected from -Cy, -(Ci- 3 aliphatic)-Cy or optionally substituted Ci -4 aliphatic.
- Z is optionally substituted Ci -4 aliphatic.
- Z is methyl, ethyl, isopropyl, and /er/-butyl.
- Z is -Cy. In some such embodiments of formula I-a, Z is selected from the group consisting of:
- Z is -Cy. In some such embodiments of formula I-a, Z is selected from the group consisting of:
- Z is -Cy. In some such embodiments, Z is selected from the group consisting of:
- Z is -(Ci aliphatic)-Cy. In some such embodiments of formula I-a, Z is -CH 2 -Cy. In some such embodiments of formula I-a, Z is selected from the group consisting of:
- Z is -(Ci aliphatic)-Cy. In some such embodiments, Z is -CH 2 -Cy. In some such embodiments, Z is selected from the group consisting of:
- Cy is an optionally substituted group selected from phenyl, a 3-10 membered saturated or partially unsaturated carbocyclic ring, a 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 6-8 membered bridged bicyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 5-6 membered heteroaryl ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, an 8-10 membered bicyclic aryl ring, and an 8-10 membered bicyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen oxygen and sulfur.
- Cy is phenyl
- Cy is an optionally substituted 3-10 membered saturated or partially unsaturated carbocyclic ring. In some embodiments, Cy is an optionally substituted 3-10 membered saturated carbocyclic ring. In some such embodiments, Cy is an optionally substituted group selected from cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl.
- Cy is an optionally substituted bicyclic carbocyclic ring. It will be appreciated that a bicyclic carbocyclic ring can be a bridged bicyclic ring. In some such embodiments of formula I-a, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some embodiments of formula I-a, Cy is a 5-membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments of formula I-a, Cy is an optionally substituted group selected from pyrazolyl, imidazolyl, and triazolyl. In some embodiments of formula I-a, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some embodiments of formula I-a, Cy is a 6-membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments of formula I-a, Cy is an optionally substituted group selected from pyridinyl. In some embodiments of formula I-a, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur.
- Cy is an optionally substituted 4-membered saturated heterocyclic group having 1 heteroatom independently selected from nitrogen, oxygen and sulfur.
- Cy is optionally substituted oxetanyl.
- Cy is optionally substituted oxetanyl or azetidinyl.
- Cy is an optionally substituted 5-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments of formula I-a, Cy is an optionally substituted group selected from tetrahydrofuranyl and pyrrolidinyl.
- Cy is an optionally substituted 6-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments of formula I-a, Cy is an optionally substituted group selected from tetrahydropyranyl and piperidinyl. In some such embodiments, Cy is an optionally substituted group selected from tetrahydropyranyl, piperidinyl, and piperazinyl.
- Cy is an optionally substituted 7-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. It will be appreciated that a 7-membered saturated heterocyclic ring can be a bridged bicyclic ring. In some such embodiments of formula I-a, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 8-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. It will be appreciated that an 8-membered saturated heterocyclic ring can be a bridged bicyclic ring. In some such embodiments of formula I-a, Cy is an optionally substituted group selected from:
- each of R 1 and R 2 is independently selected from halogen and Ci -4 aliphatic.
- R 1 is fluoro.
- R 1 is chloro.
- R 1 is methyl.
- R 2 is fluoro.
- R 2 is chloro.
- R 1 is fluoro and R 2 is chloro.
- R 1 is fluoro and R 2 is methyl.
- R 1 is fluoro and R 2 is fluoro. In some embodiments of formula I-a, R 1 is chloro and R 2 is chloro. In some embodiments of formula I-a, R 1 is methyl and R 2 is methyl.
- Ring A is an optionally substituted 5- or 6-membered heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen and sulfur.
- Ring A is an optionally substituted 5- membered heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some embodiments of formula I-a, Ring A is an optionally substituted 5- membered heteroaryl ring having 2-3 nitrogen atoms. In some such embodiments of formula I- a, Ring A is selected from pyrazolyl, imidazolyl, and triazolyl.
- Ring A is an optionally substituted 5-membered heteroaryl ring having 4 nitrogen atoms. In some embodiments of formula I-a, Ring A is tetrazol-5-yl.
- Ring A is an optionally substituted 5- membered heteroaryl ring having 1 nitrogen atom and 1 additional heteroatom selected from oxygen and sulfur. In some such embodiments of formula I-a, Ring A is selected from oxazolyl and thiazolyl.
- Ring A is selected from:
- Ring A is selected from
- Ring A is an optionally substituted 6- membered heteroaryl ring having 1-4 heteroatoms independently selected nitrogen, oxygen and sulfur.
- Ring A is selected from 2-pyridyl. 3-pyridyl and 4-pyridyl.
- x is 0-3. In some embodiments of formula I-a, x is 0. In some embodiments of formula I-a, x is 1. In some embodiments of formula I-a, x is 2. In some embodiments of formula I-a, x is 3. In some embodiments of formula I-a, x is 0-1. In some embodiments of formula I-a, x is 1-2.
- the present disclosure provides a compound of formula
- Z is selected from -Cy, -(C l-3 aliphatic)-Cy or optionally substituted Ci -4 aliphatic;
- Cy is an optionally substituted group selected from phenyl, a 3-10 membered saturated or partially unsaturated carbocyclic ring, a 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 6-8 membered bridged bicyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 5-6 membered heteroaryl ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, an 8-10 membered bicyclic aryl ring, and an 8-10 membered bicyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen oxygen and sulfur;
- each of R 1 and R 2 is independently selected from halogen and Ci -4 aliphatic;
- R x is optionally substituted C l-4 aliphatic
- each of R a and R a is independently selected from hydrogen, halogen and optionally substituted Ci- aliphatic.
- Z is selected from -Cy, -(Ci aliphatic)-Cy or optionally substituted Ci -4 aliphatic.
- Cy is an optionally substituted group selected from phenyl, a 3-10 membered saturated or partially unsaturated carbocyclic ring, a 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 6-8 membered bridged bicyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 5-6 membered heteroaryl ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, an 8-10 membered bicyclic aryl ring, and an 8-10 membered bicyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen oxygen and sulfur.
- each of R 1 and R 2 is independently selected from halogen and Ci -4 aliphatic.
- R 1 is fluoro.
- R 1 is chloro.
- R 1 is methyl.
- R 2 is fluoro.
- R 2 is chloro.
- R 2 is methyl.
- R 1 is fluoro and R 2 is methyl.
- R 1 is fluoro and R 2 is fluoro.
- R 1 is chloro and R 2 is chloro.
- R 1 is methyl and R 2 is methyl.
- R x is optionally substituted Ci -4 aliphatic.
- R x is methyl.
- R x is ethyl.
- R x is isopropyl.
- R x is Ci. 4 aliphatic optionally substituted with -(CH 2 )o- 4 0R°, wherein R° is hydrogen or Ci -6 aliphatic.
- each of R a and R a is independently selected from hydrogen, halogen and optionally substituted Ci -4 aliphatic.
- R a is hydrogen.
- R a is optionally substituted Ci- 4 aliphatic.
- R a is C aliphatic optionally substituted with -(CH 2 ) 0- 4 OR 0 , wherein R° is hydrogen or Ci -6 aliphatic.
- R a is - CH7CH7OCH 3 .
- R a is methyl.
- R a is halogen.
- R a is chloro.
- R a is hydrogen. In some embodiments of formula II, R a is methyl. In some embodiments of formula II, R a is halogen. In some such embodiments of formula II, R a is chloro.
- Z is selected from -Cy, -(Ci -3 aliphatic)-Cy or optionally substituted C aliphatic.
- Z is optionally substituted C aliphatic.
- Z is methyl, ethyl, isopropyl, and /er/-butyl.
- Z is -Cy. In some such embodiments, Z is selected from the group consisting of:
- Z is -Cy. In some such embodiments, Z is selected from the group consisting of:
- Z is -Cy. In some such embodiments, Z is selected from the group consisting of:
- Z is -(Ci- 3 aliphatic)-Cy. In some such embodiments, Z is -CH 2 -Cy. In some such embodiments, Z is selected from the group consisting of:
- Z is -(Ci- 3 aliphatic)-Cy. In some such embodiments, Z is -CH 2 -Cy. In some such embodiments, Z is selected from the group consisting of:
- Cy is an optionally substituted group selected from phenyl, a 3-10 membered saturated or partially unsaturated carbocyclic ring, a 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 6-8 membered bridged bicyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 5-6 membered heteroaryl ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, an 8-10 membered bicyclic aryl ring, and an 8-10 membered bicyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen oxygen and sulfur.
- Cy is phenyl
- Cy is an optionally substituted 3-10 membered saturated or partially unsaturated carbocyclic ring. In some embodiments of formula II, Cy is an optionally substituted 3-10 membered saturated carbocyclic ring. In some such embodiments, Cy is an optionally substituted group selected from cyclopropyl, cyclobutyl, cyclopentyl, and cyclohexyl.
- Cy is an optionally substituted bicyclic carbocyclic ring. It will be appreciated that a bicyclic carbocyclic ring can be a bridged bicyclic ring. In some such embodiments, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some embodiments of formula II, Cy is a 5-membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from pyrazolyl, imidazolyl, and triazolyl.
- Cy is selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some embodiments, Cy is a 6-membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from pyridinyl. In some embodiments, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur.
- Cy is an optionally substituted 4-membered saturated heterocyclic group having 1 heteroatom independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is optionally substituted oxetanyl. In some such embodiments, Cy is optionally substituted oxetanyl or azetidinyl.
- Cy is an optionally substituted 5-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from tetrahydrofuranyl and pyrrolidinyl.
- Cy is an optionally substituted 6-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from tetrahydropyranyl and piperidinyl. In some such embodiments, Cy is an optionally substituted group selected from tetrahydropyranyl, piperidinyl, and piperazinyl.
- Cy is an optionally substituted 7-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. It will be appreciated that a 7-membered saturated heterocyclic ring can be a bridged bicyclic ring. In some such embodiments, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 8-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. It will be appreciated that an 8-membered saturated heterocyclic ring can be a bridged bicyclic ring. In some such embodiments, Cy is an optionally substituted group selected from:
- R 1 is fluoro and R 2 is chloro, thus forming a compound of formula Il-a:
- each of Z, R x , R a and x is as defined above and described in classes and subclasses herein.
- R 1 is fluoro
- R 2 is chloro
- R x is methyl
- each of Z, R a and R a is as defined above and described in classes and subclasses herein.
- R 1 is fluoro
- R 2 is chloro
- R x is methyl
- R a is hydrogen
- R a is hydrogen
- the present disclosure provides a compound of formula
- Z is selected from -Cy, -(C l-3 aliphatic)-Cy or optionally substituted Ci -4 aliphatic;
- Cy is an optionally substituted group selected from phenyl, a 3-10 membered saturated or partially unsaturated carbocyclic ring, a 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 6-8 membered bridged bicyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, and a 5-6 membered heteroaryl ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, an 8-10 membered bicyclic aryl ring, and an 8-10 membered bicyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen oxygen and sulfur;
- each of R 1 and R 2 is independently selected from halogen and Ci -4 aliphatic;
- R x is optionally substituted Ci -4 aliphatic.
- Z is selected from -Cy, -(Ci aliphatic)-Cy or optionally substituted Ci- aliphatic.
- Cy is an optionally substituted group selected from phenyl, a 3-10 membered saturated or partially unsaturated carbocyclic ring, a 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 6-8 membered bridged bicyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 5-6 membered heteroaryl ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, an 8-10 membered bicyclic aryl ring, and an 8-10 membered bicyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen oxygen and sulfur.
- each of R 1 and R 2 is independently selected from halogen and Ci -4 aliphatic.
- R 1 is fluoro.
- R 1 is chloro.
- R 1 is methyl.
- R 2 is fluoro.
- R 2 is chloro.
- R 2 is methyl.
- R 1 is fluoro and R 2 is methyl.
- R 1 is fluoro and R 2 is fluoro.
- R 1 is chloro and R 2 is chloro.
- R 1 is methyl and R 2 is methyl.
- R x is optionally substituted Ci -4 aliphatic.
- R x is methyl.
- R x is ethyl.
- R x is isopropyl.
- R x is Ci -4 aliphatic optionally substituted with -(CH 2 )o -4 OR°, wherein R° is hydrogen or Ci -6 aliphatic.
- Z is selected from -Cy, -(Ci-3 aliphatic)-Cy or optionally substituted Ci -4 aliphatic.
- Z is optionally substituted C 1- aliphatic.
- Z is methyl, ethyl, isopropyl, and /er/-butyl.
- Z is -Cy.
- Z is -(Ci-3 aliphatic)-Cy. In some such embodiments, Z is -CH 2 -Cy. In some such embodiments, Z is selected from the group consisting of:
- Z is -(Ci- 3 aliphatic)-Cy. In some such embodiments, Z is -CH 2 -Cy. In some such embodiments, Z is selected from the group consisting of:
- Cy is an optionally substituted group selected from phenyl, a 3-10 membered saturated or partially unsaturated carbocyclic ring, a 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 6-8 membered bridged bicyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, a 5-6 membered heteroaryl ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur, an 8-10 membered bicyclic aryl ring, and an 8-10 membered bicyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen oxygen and sulfur.
- Cy is phenyl
- Cy is an optionally substituted 3-10 membered saturated or partially unsaturated carbocyclic ring. In some embodiments of formula III, Cy is an optionally substituted 3-10 membered saturated carbocyclic ring. In some such embodiments, Cy is an optionally substituted group selected from cyclopropyl, cyclobutyl, cyclopentyl, and cyclohexyl.
- Cy is an optionally substituted bicyclic carbocyclic ring. It will be appreciated that a bicyclic carbocyclic ring can be a bridged bicyclic ring. In some such embodiments, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some embodiments of formula III, Cy is a 5-membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from pyrazolyl, imidazolyl, and triazolyl.
- Cy is selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some embodiments, Cy is a 6-membered heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from pyridinyl. In some embodiments, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 3-10 membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur.
- Cy is an optionally substituted 4-membered saturated heterocyclic group having 1 heteroatom independently selected from nitrogen, oxygen and sulfur.
- Cy is optionally substituted oxetanyl.
- Cy is optionally substituted oxetanyl or azetidinyl.
- Cy is an optionally substituted 5-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from tetrahydrofuranyl and pyrrolidinyl.
- Cy is an optionally substituted 6-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. In some such embodiments, Cy is an optionally substituted group selected from tetrahydropyranyl and piperidinyl. In some such embodiments, Cy is an optionally substituted group selected from tetrahydropyranyl, piperidinyl, and piperazinyl.
- Cy is an optionally substituted 7-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. It will be appreciated that a 7-membered saturated heterocyclic ring can be a bridged bicyclic ring. In some such embodiments, Cy is an optionally substituted group selected from:
- Cy is an optionally substituted 8-membered saturated heterocyclic group having 1-2 heteroatoms independently selected from nitrogen, oxygen and sulfur. It will be appreciated that an 8-membered saturated heterocyclic ring can be a bridged bicyclic ring. In some such embodiments, Cy is an optionally substituted group selected from:
- R 1 is fluoro
- R 2 is chloro
- R x is methyl
- the present disclosure provides a compound, or a pharmaceutically acceptable salt thereof, selected from the compounds listed in Table 2:
- Histone acetylation and deacetylation are processes by which lysine residues within the N-terminal tail protruding from histone cores of the nucleosome are acetylated and deacetylated. Without wishing to be bound by any particular theory, it is believed that histone acetylation is a part of gene regulation.
- Histone Acetyltransferases also known as HATs, are a family of enzymes that acetylate the histone tails of the nucleosome among other nuclear and cytoplasmic non-histone targets. Some HATs acetylate a lysine residue, and such Lysine Acetyltransferases are also referred to as KATs.
- KATs can be divided into families based on their structure and sequence similarity.
- KAT families include, for example, the Gcn5-related N-acetyltransferase (GNAT) family, which includes GCN5 and PC F, the CREBBP/EP300 family and the MYST (MOZ, Ybf2/Sas3, Sas2, Tip60) family.
- GNAT Gcn5-related N-acetyltransferase
- MYST MYST
- the MYST family of HATs is named after its four founding members MOZ, Ybf2 (Sas3), Sas2, and Tip60.
- Other members include Esal, MOF, MORF, and HBOl.
- MYST histone 2A
- H3 histone 3
- H4 histone 4
- Lysine acetyltransferases are also referred to as KATs, and members of the MYST family of histone acetyltransferases include, for example, KAT-5 (also sometimes referred to as Tip60), KAT-6A (also sometimes referred to as MOZ, MYST3, RUNXBP2, or ZNF220), KAT-6B (also sometimes referred to as MORF, MYST4, or MOZ2), KAT-7 (also sometimes referred to as (HBOl, HBOa, or MYST2), and KAT-8 (also sometimes referred to as MOF, YBF2, SAS3, or MYST1).
- KAT-5 also sometimes referred to as Tip60
- KAT-6A also sometimes referred to as MOZ, MYST3, RUNXBP2, or ZNF220
- KAT-6B also sometimes referred to as MORF, MYST4, or MOZ2
- KAT-7 also sometimes referred to as (HBOl, HBOa, or MYST2)
- KATs may contain various other domains in addition to the HAT domain which facilitate interactions with other proteins, including reader domains for acetylation and other modifications. See , e.g., Farria et al. Oncogene (2015) 34, 4901-4913, incorporated herein by reference.
- Some KATs for example those in the GNAT and CREBBP/EP300 families, contain bromodomains. Bromodomains help KATs recognize and bind to acetylated lysine residues on histone substrates. Together these domains allow for specificity and diversity in KAT substrates. All KATs examined to date have important functions in cellular differentiation and embryo development. Several KATs have also been associated with oncogenesis.
- CREBBP/EP300 have been implicated in cancer development and progression. See , e.g. , Farria et al. Oncogene (2015) 34, 4901-4913; Lee et al. Nat. Rev. Mol. Cell Biol. 8 (4): 284-95; and Avvakumov et al. Oncogene (2007) 26, 5395-5407, the entire contents of each of which are incorporated herein by reference.
- KATs within the MYST family are grouped together on the basis of their close sequence similarities and their possession of a particular acetyl transferase homology region. The name is derived from the first four members identified: MOZ (KAT-6A), Ybf2/Sas3, Sas2, Tip60 (KAT-5). Additional KATs have also been identified, including MOF (KAT-8) and HBO-l (KAT-7).
- MOZ KAT-6A
- Additional KATs have also been identified, including MOF (KAT-8) and HBO-l (KAT-7).
- the MYST catalytic domain that defines the family has a C2HC zinc finger and an acetyl-CoA binding site. These enzymes are involved in transcription regulation, DNA replication, recombination, and repair. They are directly implicated in the development of a variety of diseases, including cancer.
- KAT-7 also known as Lysine Acetyltransferase 7, HBOl, HBOA, MYST2, and ZC2HC7
- KAT-7 coding region has been identified as a common retroviral integration site, and KAT-7 has been linked to numerous disease binding partners, including AR, the von Hippel-Lindau tumour suppressor, and ING4 and -5.
- Specific cancers that have been identified as being linked to KAT-7 inhibition include, for example, breast cancer, prostate cancer, and leukemia.
- KAT-7 protein sequences have been reported.
- Exemplary human KAT-7 protein sequences include, for example, and without limitation, the sequences provided below. Additional KAT-7 sequences, including KAT-7 sequences from other species and additional human KAT-7 sequences will be apparent to those of ordinary skill in the art, and include, for example, and without limitation, those KAT-7 sequences listed in the NCBI and ENSEMBL gene databases.
- NP 001186085.1 histone acetyltransferase KAT-7 isoform 3 [Homo sapiens] MPRRKRNAGS S SDGTED SDF STDLEHTD S SESDGT SRRS ARVTRS S ARL SQ S SQGHLT GK HERHF SIS GCPL YHNL S ADECK VRAQ SRDKQIEERML SHRQDDNNRH ATRHQ APTERQL RYKEK V AELRKKRN S GL SKEQKEK YMEHRQT Y GNTREPLLENLT SEYDLDLFRRAQ AR ASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYM KSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTL YYDVEPFLF YVMTEADNTGCHLIGYF SKEKN SFLNYNV
- NP 001333635.1 histone acetyltransferase KAT-7 isoform 6 [Homo sapiens] MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRGHLTGK HERHF SIS GCPL YHNL S ADECK VRAQ SRDKQIEERML SHRQDDNNRH ATRHQ APTERQL RYKEK V AELRKKRN S GL SKEQKEK YMEHRQT Y GNTREPLLENLT SEYDLDLFRRAQ AR ASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYM KSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLF
- the present disclosure provides inhibitors of MYST family KATs, e.g., of KAT-5, KAT-6A, KAT-7, and/or KAT-8, for use as histone acetyltransferase inhibitors, e.g., in vitro or in vivo.
- the present disclosure provides inhibitors of MYST family KATs, e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8, for use in treating diseases or disorders that are characterized by an abnormal MYST family KAT activity, e.g., certain cancers.
- Some aspects of this disclosure provide methods for modulating protein acetylation, e.g., histone acetylation, e.g., in a cell or tissue, by contacting a histone acetylase, e.g., KAT-5, KAT-6A, KAT-7, and/or KAT-8, or a cell or tissue expressing such a histone acetylase, with compounds of the present disclosure in an amount sufficient to modulate the activity of the histone acetylase, e.g., of KAT-5, KAT-6A, KAT-7, and/or KAT-8, e.g., as measured by a reduction in the acetylation of a target protein of the histone acetyltransferase, e.g., a histone acetylated by KAT-5, KAT-6A, KAT-7, and/or KAT-8 activity.
- a histone acetylase e.g., KAT-5, KAT
- the contacting is in vitro. In some embodiments, the contacting is in vivo, e.g., by administering the compounds of the present disclosure, or a pharmaceutically acceptable salt thereof, to a subject, e.g., a human subject. In some embodiments, the subject is a subject having or diagnosed with a cancer or a precancerous condition.
- Some aspects of this disclosure provide methods for selectively inhibiting at least one KAT. For example, in some embodiments, it is beneficial to be able to selectively inhibit a specific MYST family KAT or a combination of two or more MYST family KATs, while not inhibiting one or more different KATs, or while inhibiting one or more different KATs to a lesser extent.
- the term“selectively inhibiting” refers to inhibiting of a particular MYST family KAT, or a group of MYST family KATs, while inhibiting a different KAT or a group of KATs to a different extent.
- selectively inhibiting a MYST family KAT refers to inhibiting the activity of the MYST family KAT at a potency that is at least 2-fold, at least 5-fold, at least lO-fold, at least l5-fold, at least 20-fold, at least 25-fold, at least 50-fold, at least 75-fold, at least lOO-fold, at least 200-fold, at least 250-fold, at least 500-fold, at least 750- fold, at least lOOO-fold, at least 2000-fold, at least 2500-fold, at least 5000-fold, at least 7500- fold, or at least lOOOO-fold the potency at which a different KAT, e.g., a different MYST family KAT is inhibited.
- a potency that is at least 2-fold, at least 5-fold, at least lO-fold, at least l5-fold, at least 20-fold, at least 25-fold, at least 50-fold, at least 75-fold, at least l
- the potency of inhibition of a given KAT inhibitor can be determined, e.g., measured, by methods well known to those of skill in the art. Some exemplary methods are provided herein, and other suitable methods will be apparent to the skilled artisan based on the present disclosure and the general knowledge in the art.
- One exemplary suitable measure of inhibition potency is the IC50 value of a given KAT inhibitory compound with regard to a specific KAT enzyme, e.g., as exemplified for some compounds and some MYST family KATs elsewhere herein. Since the IC50 value is a measure of the concentration of a given inhibitor to achieve a certain level of inhibition, it will be understood that a lower IC 50 value indicates a more potent inhibition.
- a KAT-7 inhibitor would be said to inhibit KAT-7 at a potency that is lO-fold the potency at which it inhibits KAT-5, if the IC50 of that inhibitor with regard to KAT-7 is lO-fold lower than the IC50 of the inhibitor with regard to KAT-5.
- KAT-7 inhibitor would be said to inhibit KAT-7 at a potency that is lO-fold the potency at which it inhibits KAT- 5, if exposure of KAT-7 to the inhibitor results in a lO-fold greater inhibition of KAT-7 activity than the inhibition of KAT-5 activity that is achieved by exposure of KAT-5 to the inhibitor at the same concentration in the same assay.
- suitable measures to compare inhibition potency of a given inhibitor amongst different KATs are provided herein, as are suitable assays (e.g., biochemical or cellular assays) for determining inhibition potency of a given KAT inhibitor, and additional suitable measures and assays will be apparent to the person of ordinary skill in the art in view of the present disclosure and the knowledge in the art. The disclosure is not limited in this respect.
- the present disclosure provides compounds (e.g., compounds of formula I, formula I-a, formula II, formula Il-a, formula Il-b, formula Il-b, formula III, and/or formula III-a) and methods for selectively inhibiting a specific MYST family KAT, e.g., KAT-5, KAT-6A, KAT-7, or KAT-8, as compared to a different KAT, e.g., a different MYST family KAT.
- a specific MYST family KAT e.g., KAT-5, KAT-6A, KAT-7, or KAT-8
- the present disclosure provides compounds (e.g., compounds of formula G, formula I, formula I-a, formula II, formula Il-a, formula Il-b, formula II-c, formula III, and/or formula III-a) and methods for selectively inhibiting a specific MYST family KAT, e.g., KAT-5, KAT-6A, KAT-7, or KAT-8, as compared to a different KAT, e.g., a different MYST family KAT.
- a specific MYST family KAT e.g., KAT-5, KAT-6A, KAT-7, or KAT-8
- KAT-7 e.g., a different MYST family KAT.
- the present disclosure provides compounds and methods for selectively inhibiting KAT-7 as compared to KAT-5.
- the present disclosure provides compounds and methods for selectively inhibiting a group of MYST family KATs, e.g., KAT-7 and KAT-6A, as compared to a different KAT, e.g., a MYST family KAT, e.g., as compared to KAT-5.
- the present disclosure provides compounds and methods for selectively inhibiting KAT-7 and KAT-8 as compared to KAT-5.
- the present disclosure provides compounds and methods for selectively inhibiting KAT-7, KAT-6A, and KAT-8 as compared to KAT-5.
- the present disclosure provides compounds and methods for selectively inhibiting KAT-7 as compared to KAT-5 and KAT-6A.
- the present disclosure provides compounds and methods for selectively inhibiting KAT-7 as compared to KAT-5 and KAT-8. In some embodiments, the present disclosure provides compounds and methods for selectively inhibiting KAT-7 as compared to KAT-5, KAT-6A, and KAT-8.
- the present disclosure provides compounds and methods for selectively inhibiting KAT-7 and KAT-6A as compared to KAT-5 and KAT-8. In some embodiments, the present disclosure provides compounds and methods for selectively inhibiting KAT-7 and KAT-8 as compared to KAT-5 and KAT-6A.
- the present disclosure provides compounds that selectively inhibit a single MYST-family KAT, e.g., KAT-7.
- the present disclosure provides compounds that selectively inhibit two MYST-family KATs (dual inhibitors), e.g., KAT-7 and KAT-6A, or KAT-7 and KAT-8.
- the present disclosure provides compounds that selectively inhibit three MYST family KATs (triple inhibitors), e.g., KAT-7, KAT-6A, and KAT-8. It will be appreciated that the assays and experiments described below facilitate the characterization and/or identification of compounds that inhibit one or more MYST family KATs.
- the present disclosure provides, inter alia , compounds and compositions useful in the treatment of cancer, e.g., for the treatment of a tumor in a subject.
- the present disclosure provides a method of treating a disease or disorder associated with a MYST family KAT, e.g., with KAT-5, KAT-6A, KAT-7, and/or KAT-8.
- the disease or disorder is a KAT-7-mediated disorder.
- the disease or disorder is a KAT-6A-mediated disorder.
- the disease or disorder is a KAT-8-mediated disorder.
- the disease or disorder is a KAT-5-mediated disorder.
- Cancers that can be treated with the methods and compositions provided herein include, for example, adrenocortical carcinoma, astrocytoma, basal cell carcinoma, carcinoid, cardiac, cholangiocarcinoma, chordoma, chronic myeloproliferative neoplasms, craniopharyngioma, ductal carcinoma in situ, ependymoma, intraocular melanoma, gastrointestinal carcinoid tumor, gastrointestinal stromal tumor (GIST), gestational trophoblastic disease, glioma, histiocytosis, leukemia (e.g, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), hairy cell leukemia, myelogenous leukemia, and myeloid leukemia), lymphoma (e.g, ALL), acute myeloid leukemia (
- the present disclosure provides methods and compositions for treating a tumor in a subject.
- the tumor is a solid tumor.
- the tumor is a liquid or disperse tumor.
- the tumor is associated with a hematologic malignancy, including but not limited to, acute lymphoblastic leukemia, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myelogenous leukemia, hairy cell leukemia, AIDS-related lymphoma, Hodgkin lymphoma, non-Hodgkin lymphoma, follicular lymphoma, diffuse large B-cell lymphoma, Langerhans cell histiocytosis, multiple myeloma, or myeloproliferative neoplasms.
- a tumor comprises a solid tumor.
- solid tumors include but are not limited to tumors of the bladder, breast, central nervous system, cervix, colon, esophagus, endometrium, head and neck, kidney, liver, lung, ovary, pancreas, skin, stomach, uterus, or upper respiratory tract.
- a tumor that may be treated by the compositions and methods of the present disclosure is a breast tumor.
- a tumor that may be treated by the compositions and methods of the present disclosure is not a lung tumor.
- a tumor or cancer suitable for treatment with the methods and compositions provided herein includes, for example, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenal cortex cancer, adrenocortical carcinoma, AIDS-related cancer (e.g, Kaposi sarcoma, AIDS-related lymphoma, primary CNS lymphoma), anal cancer, appendix cancer, astrocytoma, atypical rhabdoid tumor, basal cell carcinoma, bile duct cancer, bladder cancer, bone cancer, brain tumor, breast cancer, bronchial tumor, Burkitt lymphoma, carcinoid tumor, carcinoma, cardiac (heart) tumor, central nervous system tumor, cervical cancer, cholangiocarcinoma, chordoma, chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), chronic myeloproliferative neoplasm, colorectal cancer, craniopharyngio
- ALL acute lymphoblastic
- the present disclosure provides a pharmaceutical composition comprising an inhibitor of a MYST family KAT, e.g., of KAT-5, KAT-6, KAT-7, and/or KAT-8, as described herein.
- the compounds of the present disclosure e.g., compounds of formula I, formula I-a, formula II, formula Il-a, formula Il-b, formula II-c, formula III, and/or formula Ill-a
- a subject e.g., to a human patient, alone, e.g., in the form of a pharmaceutically acceptable salt, a solvated or hydrated form of compounds of the present disclosure, and any polymorph or crystal form thereof.
- the compounds of the present disclosure can be administered to a subject, e.g. , to a human patient, alone, e.g., in the form of a pharmaceutically acceptable salt, a solvated or hydrated form of compounds of the present disclosure, and any polymorph or crystal form thereof.
- the compounds of the present disclosure can be administered in the form of a pharmaceutical composition, e.g., where the compounds of the present disclosure are admixed with a suitable carrier or excipient.
- a pharmaceutical composition typically comprises or can be administered at a dose sufficient to treat or ameliorate a disease or condition in the recipient subject, e.g, to treat or ameliorate a cancer as described herein.
- a pharmaceutical composition is formulated in a manner suitable for administration to a subject, e.g., in that it is free from pathogens and formulated according to the applicable regulatory standards for administration to a subject, e.g., for administration to a human subject.
- a formulation for injection is typically sterile and essentially pyrogen-free.
- Compounds of the present disclosure can also be administered to a subject as a mixture with other agents, e.g., with one or more additional therapeutic agent(s), e.g, in a suitably formulated pharmaceutical composition.
- additional therapeutic agent(s) e.g, in a suitably formulated pharmaceutical composition.
- some aspects of the present disclosure relate to pharmaceutical compositions comprising a therapeutically effective dose of compounds of the present disclosure, or a pharmaceutically acceptable salt, hydrate, enantiomer or stereoisomer thereof; and a pharmaceutically acceptable diluent or carrier.
- compositions as provided herein are typically formulated for a suitable route of administration.
- suitable routes of administration may, for example, include enteral administration, e.g, oral, rectal, or intestinal administration; parenteral administration, e.g, intravenous, intramuscular, intraperitoneal, subcutaneous, or intramedullary injection, as well as intrathecal, direct intraventricular, or intraocular injections; topical delivery, including eyedrop and transdermal; and intranasal and other transmucosal delivery, or any suitable route provided herein or otherwise apparent to those of ordinary skill in the art.
- enteral administration e.g, oral, rectal, or intestinal administration
- parenteral administration e.g, intravenous, intramuscular, intraperitoneal, subcutaneous, or intramedullary injection, as well as intrathecal, direct intraventricular, or intraocular injections
- topical delivery including eyedrop and transdermal
- intranasal and other transmucosal delivery or any suitable route provided herein or otherwise
- compositions provided herein may be manufactured, e.g ., by mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping, or lyophilizing processes, or by any other suitable processes known to those of ordinary skill in the art.
- compositions for use in accordance with the present disclosure may be formulated using one or more physiologically acceptable carriers comprising excipients and auxiliaries which facilitate processing of compounds of the present disclosure into preparations which can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
- the agents of the disclosure may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks’ solution, Ringer’s solution, or physiological saline buffer.
- physiologically compatible buffers such as Hanks’ solution, Ringer’s solution, or physiological saline buffer.
- penetrants are used in the formulation appropriate to the barrier to be permeated. Such penetrants are generally known in the art.
- compounds of the present disclosure can be formulated readily by combining the compound with pharmaceutically acceptable carriers known in the art.
- Such carriers enable compounds of the present disclosure to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a patient to be treated.
- Pharmaceutical preparations for oral use can be obtained by combining the compounds of the present disclosure with a solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores.
- Suitable excipients include fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethylcellulose, and/or polyvinylpyrrolidone (PVP).
- disintegrating agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
- Dragee cores are provided with suitable coatings.
- suitable coatings may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures.
- Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of doses.
- compositions which can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol.
- the push-fit capsules can contain the active ingredient(s), e.g., compounds of the present disclosure, in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
- the compounds of the present disclosure may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols.
- stabilizers may be added.
- compositions may take the form of tablets or lozenges formulated in conventional manner.
- compounds of the present disclosure for use according to the present disclosure is conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebuliser, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- the dosage unit may be determined by providing a valve to deliver a metered amount.
- Capsules and cartridges of e.g., gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the compounds of the present disclosure and a suitable powder base such as lactose or starch.
- Suitable compound(s) of the present disclosure can be formulated for parenteral administration by injection, e.g, bolus injection or continuous infusion.
- Formulations for injection may be presented in unit dosage form, e.g., in ampoules, or in multi-dose containers, and, in some embodiments, may contain an added preservative.
- the compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- compositions for parenteral administration include aqueous solutions of compound(s) of the present disclosure in water-soluble form. Additionally, suspensions of compound(s) of the present disclosure may be prepared as appropriate injection suspensions, e.g, aqueous or oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes.
- Aqueous injection suspensions may contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran.
- the suspension may also contain suitable stabilizers or agents which increase the solubility of compound(s) of the present disclosure to allow for the preparation of highly concentrated solutions.
- the active ingredient(s), e.g ., compound(s) of the present disclosure may be in powder form for reconstitution before use with a suitable vehicle, e.g., sterile pyrogen- free water.
- a suitable vehicle e.g., sterile pyrogen- free water.
- Compound(s) of the present disclosure may also be formulated in rectal compositions such as suppositories or retention enemas, e.g. , containing conventional suppository bases, such as cocoa butter or other glycerides.
- compounds of the present disclosure may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example, subcutaneously or intramuscularly or by intramuscular injection).
- compounds of the present disclosure may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives (for example, as a sparingly soluble salt).
- hydrophobic pharmaceutical compound(s) of the present disclosure may be employed.
- Liposomes and emulsions are examples of delivery vehicles or carriers for hydrophobic drugs.
- Certain organic solvents such as dimethysulfoxide also may be employed.
- compounds of the present disclosure may be delivered using a sustained-release system, such as semi-permeable matrices of solid hydrophobic polymers containing the therapeutic agent.
- sustained-release materials have been established and are well known by those skilled in the art. Sustained-release capsules may, depending on their chemical nature, release the compound(s) of the present disclosure for a few hours, a few days, a few weeks, or a few months, e.g. , up to over 100 days.
- the pharmaceutical compositions may also comprise suitable solid or gel phase carriers or excipients.
- suitable solid or gel phase carriers or excipients include but are not limited to calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers, such as polyethylene glycols.
- suitable pharmaceutical compositions and processes and strategies for formulating a suitable compound of the present disclosure will be apparent to the skilled artisan based on the present disclosure. The disclosure is not limited in this respect.
- Some aspects of this disclosure provide methods for modulating protein acetylation, e.g., histone acetylation, in a subject in need thereof by administering compounds of the present disclosure to the subject in an amount sufficient to modulate acetylation of a target protein, e.g., a histone acetylated by a MYST family KAT, e.g., by KAT-5, KAT-6, KAT-7, and/or KAT-8, activity.
- a target protein e.g., a histone acetylated by a MYST family KAT, e.g., by KAT-5, KAT-6, KAT-7, and/or KAT-8, activity.
- the subject is a subject having or diagnosed with a cancer or a precancerous condition.
- a symptom of conditions and diseases such as cancers and precancerous conditions
- the course of which can be influenced by modulating the acetylation status of histones or other proteins that are acetylated by a MYST family KAT, e.g., by KAT-5, KAT-6, KAT-7, and/or KAT-8, wherein said acetylation status is mediated at least in part by the activity of CREBBP.
- Modulation of the acetylation status of histones can in turn influence the level of expression of target genes activated by acetylation, and/or target genes suppressed by acetylation.
- the method comprises the step of administering to a subject having a cancer or a precancerous condition compounds of the present disclosure, e.g., in the form of a pharmaceutical composition, at a therapeutically effective amount.
- compounds of the present disclosure inhibit histone acetyltransferase activity of a MYST family KAT, e.g., of KAT-5, KAT-6, KAT-7, and/or KAT- 8. In some embodiments, compounds of the present disclosure selectively inhibit histone acetyltransferase activity of a MYST family KAT, e.g., of KAT-5, KAT-6, KAT-7, and/or KAT- 8
- the subject is diagnosed with a disease or disorder known to be associated with a dysregulation of histone acetylation, e.g, with a dysfunction of a MYST family KAT, e.g., of KAT-5, KAT-6, KAT-7, and/or KAT-8.
- the subject is diagnosed with a disease or disorder mediated by a MYST family KAT, e.g., by KAT-5, KAT- 6, KAT-7, and/or KAT-8.
- the subject has been diagnosed with a cancer.
- Dysregulated histone acetylation has been reported to be involved in aberrant expression of certain genes in cancers and other diseases.
- Compounds described herein can be used to treat such histone acetylation-associated diseases, e.g., to inhibit histone acetylation mediated by a MYST family KAT, e.g., KAT-5-, KAT-6-, KAT-7-, and/or KAT-8-mediated histone acetylation in affected cells, tissues, or subjects.
- Modulators of histone acetylation can be used for modulating cell proliferation, e.g., of cells harboring a mutation resulting in aberrant histone acetylation, or for inducing cell death in cells depending on histone acetylation by a MYST family KAT, e.g., by KAT-5, KAT-6, KAT-7, and/or KAT-8, histone acetylation for survival or proliferation.
- diseases that may be treated with compound(s) of the present disclosure include hyperproliferative diseases, such as benign cell growth and malignant cell growth (cancer).
- Exemplary cancers that may be treated with a compound provided herein include, without limitation, lymphomas, including non-Hodgkin lymphoma, follicular lymphoma (FL) and diffuse large B-cell lymphoma (DLBCL); melanoma; leukemia, including CML; acute lymphoblastic leukemia; acute myeloid leukemia; adrenocortical carcinoma; AIDS-related cancers; AIDS-related lymphoma; anal cancer; astrocytoma, childhood cerebellar; basal cell carcinoma, see skin cancer (non-melanoma); bile duct cancer, extrahepatic; bladder cancer; bone cancer, osteosarcoma/malignant fibrous histiocytoma; brain stem glioma; brain tumor; brain tumor, cerebellar astrocytoma; brain tumor, cerebral astrocytoma/malignant glioma; brain tumor, ependymoma; brain tumor, medullob
- Any other disease in which histone acetylation mediated by a MYST family KAT, e.g., by KAT-5, KAT-6, KAT-7, and/or KAT-8, plays a role may be treatable or preventable using compounds and methods described herein.
- an active agent for use in accordance with the present disclosure is formulated, dosed, and/or administered in a therapeutically effective amount using pharmaceutical compositions and dosing regimens that are consistent with good medical practice and appropriate for the relevant agent(s) and subject(s).
- therapeutic compositions can be administered by any appropriate method known in the art, including, without limitation, oral, mucosal, by-inhalation, topical, buccal, nasal, rectal, or parenteral (e.g.
- a dosing regimen for a particular active agent may involve intermittent or continuous (e.g., by perfusion or other slow release system) administration, for example to achieve a particular desired pharmacokinetic profile or other pattern of exposure in one or more tissues or fluids of interest in the subject receiving therapy.
- different agents administered in combination may be administered via different routes of delivery and/or according to different schedules.
- one or more doses of a first active agent is administered substantially simultaneously with, and in some embodiments via a common route and/or as part of a single composition with, one or more other active agents.
- Factors to be considered when optimizing routes and/or dosing schedule for a given therapeutic regimen may include, for example, the particular indication being treated, the clinical condition of a subject (e.g., age, overall health, prior therapy received and/or response thereto) the site of delivery of the agent, the nature of the agent (e.g. small molecule, an antibody or other polypeptide-based compound), the mode and/or route of administration of the agent, the presence or absence of combination therapy, and other factors known to medical practitioners.
- relevant features of the indication being treated may include, for example, one or more of cancer type, stage, and location.
- one or more features of a particular pharmaceutical composition and/or of a utilized dosing regimen may be modified over time (e.g ., increasing or decreasing the amount of active agent in any individual dose, increasing or decreasing time intervals between doses), for example in order to optimize a desired therapeutic effect or response.
- type, amount, and frequency of dosing of active agents in accordance with the present disclosure are governed by safety and efficacy requirements that apply when one or more relevant agent(s) is/are administered to a mammal, preferably a human.
- such features of dosing are selected to provide a particular, and typically detectable, therapeutic response as compared to what is observed absent therapy.
- an exemplary desirable therapeutic response may involve, but is not limited to, inhibition of and/or decreased tumor growth, tumor size, metastasis, one or more of the symptoms and side effects that are associated with a tumor, as well as increased apoptosis of cancer cells, therapeutically relevant decrease or increase of one or more cell marker or circulating markers.
- Such criteria can be readily assessed by any of a variety of immunological, cytological, and other methods that are disclosed in the literature.
- an effective dose (and/or a unit dose) of an active agent may be at least about 0.01 pg/kg body weight, at least about 0.05 pg/kg body weight, at least about 0.1 pg/kg body weight, at least about 1 pg/kg body weight, at least about 2.5 pg/kg body weight, at least about 5 pg/kg body weight, and not more than about 100 pg/kg body weight. It will be understood by one of skill in the art that in some embodiments such guidelines may be adjusted for the molecular weight of the active agent.
- the dosage may also be varied for route of administration, the cycle of treatment, or consequently to dose escalation protocol that can be used to determine the maximum tolerated dose and dose limiting toxicity (if any) in connection to the administration of compounds of the present disclosure and/or an additional therapeutic agent at increasing doses. Consequently, the relative amounts of the each agent within a pharmaceutical composition may also vary, for example, each composition may comprise between 0.001 % and 100% (w/w) of the corresponding agent.
- a “therapeutically effective amount” or “therapeutically effective dose” is an amount of a compound of the present disclosure, or a combination of two or more compounds of the present disclosure, or a combination of compounds of the present disclosure with one or more additional therapeutic agent(s), which inhibits, totally or partially, the progression of the condition or alleviates, at least partially, one or more symptoms of the condition.
- a therapeutically effective amount can be an amount which is prophylactically effective.
- an amount which is therapeutically effective may depend upon a patient’s size and/or gender, the condition to be treated, severity of the condition and/or the result sought.
- a therapeutically effective amount refers to that amount of a compound of the present disclosure that results in amelioration of at least one symptom in a patient. In some embodiments, for a given patient, a therapeutically effective amount may be determined by methods known to those of skill in the art.
- toxicity and/or therapeutic efficacy of compounds of the present disclosure can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g ., for determining the maximum tolerated dose (MTD) and the ED 50 (effective dose for 50% maximal response).
- MTD maximum tolerated dose
- ED 50 effective dose for 50% maximal response
- the dose ratio between toxic and therapeutic effects is the therapeutic index; in some embodiments, this ratio can be expressed as the ratio between MTD and ED 50.
- Data obtained from such cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
- dosage may be guided by monitoring the effect of compounds of the present disclosure on one or more pharmacodynamic markers of enzyme inhibition (e.g, histone acetylation or target gene expression) in diseased or surrogate tissue.
- pharmacodynamic markers of enzyme inhibition e.g, histone acetylation or target gene expression
- cell culture or animal experiments can be used to determine the relationship between doses required for changes in pharmacodynamic markers and doses required for therapeutic efficacy can be determined in cell culture or animal experiments or early stage clinical trials.
- dosage of compounds of the present disclosure lies preferably within a range of circulating concentrations that include the ED 50 with little or no toxicity.
- dosage may vary within such a range, for example depending upon the dosage form employed and/or the route of administration utilized. The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient’s condition. In the treatment of crises or severe conditions, administration of a dosage approaching the MTD may be required to obtain a rapid response.
- dosage amount and/or interval may be adjusted individually, for example to provide plasma levels of an active moiety which are sufficient to maintain, for example a desired effect, or a minimal effective concentration (MEC) for a period of time required to achieve therapeutic efficacy.
- MEC minimal effective concentration
- MEC for particular compounds of the present disclosure can be estimated, for example, from in vitro data and/or animal experiments. Dosages necessary to achieve the MEC will depend on individual characteristics and route of administration.
- HPLC high pressure liquid chromatography
- bioassays can be used to determine plasma concentrations.
- dosage intervals can be determined using the MEC value.
- compound(s) of the present disclosure should be administered using a regimen which maintains plasma levels above the MEC for 10-90% of the time, preferably between 30-90% and most preferably between 50-90% until the desired amelioration of a symptom is achieved.
- different MEC plasma levels will be maintained for differing amounts of time.
- the effective local concentration of the drug may not be related to plasma concentration.
- compounds of the present disclosure can be used in combination with another therapeutic agent to treat diseases such as cancer.
- compounds of the present disclosure, or a pharmaceutical composition thereof can optionally be administered in combination with one or more additional therapeutic agents, such as a cancer therapeutic agent, e.g., a chemotherapeutic agent or a biological agent.
- An additional agent can be, for example, a therapeutic agent that is art-recognized as being useful to treat the disease or condition being treated by compounds of the present disclosure, e.g., an anti- cancer agent, or an agent that ameliorates a symptom associated with the disease or condition being treated.
- the additional agent also can be an agent that imparts a beneficial attribute to the therapeutic composition (e.g ., an agent that affects the viscosity of the composition).
- compounds of the present disclosure are administered to a subject who has received, is receiving, and/or will receive therapy with another therapeutic agent or modality (e.g., with a chemotherapeutic agent, surgery, radiation, or a combination thereof).
- Some embodiments of combination therapy modalities provided by the present disclosure provide, for example, administration of compounds of the present disclosure and additional agent(s) in a single pharmaceutical formulation. Some embodiments provide administration of compounds of the present disclosure and administration of an additional therapeutic agent in separate pharmaceutical formulations.
- chemotherapeutic agents examples include platinum compounds (e.g., cisplatin, carboplatin, and oxaliplatin), alkylating agents (e.g., cyclophosphamide, ifosfamide, chlorambucil, nitrogen mustard, thiotepa, melphalan, busulfan, procarbazine, streptozocin, temozolomide, dacarbazine, and bendamustine), antitumor antibiotics (e.g., daunorubicin, doxorubicin, idarubicin, epirubicin, mitoxantrone, bleomycin, mytomycin C, plicamycin, and dactinomycin), taxanes (e.g., paclitaxel and docetaxel), antimetabolites (e.g., 5-fluorouracil, cytarabine, premetrexed
- alkylating agents e.g., cyclophosp
- Examples of biological agents that can be used in the compositions and methods described herein include monoclonal antibodies (e.g ., rituximab, cetuximab, panetumumab, tositumomab, trastuzumab, alemtuzumab, gemtuzumab ozogamicin, bevacizumab, catumaxomab, denosumab, obinutuzumab, ofatumumab, ramucirumab, pertuzumab, ipilimumab, nivolumab, nimotuzumab, lambrolizumab, pidilizumab, siltuximab, BMS-936559, RG7446/MPDL3280A, MEDI4736, tremelimumab, or others known in the art), enzymes (e.g., L-asparaginase), cytokines (e.g., L-
- compounds of the present disclosure is administered to a subject in need thereof in combination with another agent for the treatment of cancer, either in the same or in different pharmaceutical compositions.
- the additional agent is an anticancer agent.
- the additional agent affects (e.g, inhibits) histone modifications, such as histone acetylation or histone methylation.
- an additional anticancer agent is selected from the group consisting of chemotherapeutics (such as 2CdA, 5-FU, 6-Mercaptopurine, 6-TG, AbraxaneTM, Accutane®, Actinomycin-D, Adriamycin®, Alimta®, all-trans retinoic acid, amethopterin, Ara-C, Azacitadine, BCNU, Blenoxane®, Camptosar®, CeeNU®, Clofarabine, ClolarTM, Cytoxan®, daunorubicin hydrochloride, DaunoXome®, Dacogen®, DIC, Doxil®, Ellence®, Eloxatin®, Emcyt®, etoposide phosphate, Fludara®, FETDR®, Gemzar®, Gleevec®, hexamethylmelamine, Hycamtin®, Hydrea®, Idamycin®, Ifex®, ixabepilone, Ixem
- additional agents that can be used in combination with compounds of the present disclosure as set forth above are for illustrative purposes and not intended to be limiting.
- the combinations embraced by this disclosure include, without limitation, one or more compounds of the present disclosure as provided herein and at least one additional agent selected from the lists above or otherwise provided herein.
- Compounds of the present disclosure can also be used in combination with one or with more than one additional agent, e.g ., with two, three, four, five, or six, or more, additional agents.
- treatment methods described herein are performed on subjects for which other treatments of the medical condition have failed or have had less success in treatment through other means, e.g., in subjects having a cancer refractory to standard-of-care treatment.
- the treatment methods described herein can be performed in conjunction with one or more additional treatments of the medical condition, e.g., in addition to or in combination with standard-of-care treatment.
- the method can comprise administering a cancer-therapeutic regimen, e.g., nonmyeloablative chemotherapy, surgery, hormone therapy, and/or radiation, prior to, substantially simultaneously with, or after the administration of compounds of the present disclosure described herein, or composition thereof.
- a subject to which compounds of the present disclosure described herein is administered can also be treated with antibiotics and/or one or more additional pharmaceutical agents.
- LC-MS (Agilent): [0288] LC: Agilent Technologies 1290 series, Binary Pump, Diode Array Detector. Agilent Poroshell 120 EC- C18, 2.7 pm, 4.6x50 mm column. Mobile phase: A: 0.05% Formic acid in water (v/v), B: 0.05% Formic acid in ACN (v/v). Flow Rate: 1 mL/min at 25 °C. Detector: 214 nm, 254 nm. Gradient stop time, 5 min. Timetable:
- MS G6120A, Quadrupole LC/MS, Ion Source: ES-API, TIC: 70-1000 m/z, Fragmentor: 60, Drying gas flow: 10 L/min, Nebulizer pressure: 35 psi, Drying gas temperature: 350 °C, Vcap: 3000V.
- Sample preparation samples were dissolved in ACN or methanol at -100 pg/mL, then filtered through a 0.22 pm filter membrane. Injection volume: 1-10 pL.
- Step 5 methyl 3-chloro-2-iluoro-5-(l-methyl-lH-imidazol-4-yl)benzoate
- the reaction mixture was cooled to room temperature, potassium fluoride (28.4 g, 489 mmol) and water (300 mL) were added and the mixture stirred for a further 30 min.
- the mixture was diluted with EtOAc (500 mL) and filtered.
- the organic layer was separated and the aqueous layer extracted with EtOAc (200 mL x 2).
- Step 1 cyclohexylmethyl methanesulfonate
- Methanesulfonyl chloride (5.0 g, 568 mmol) was added to a solution of cyclohexylmethanol (50 g, 437 mmol) and triethylamine (66.2 g, 655 mmol) in DCM (600 mL) at 0 °C under N 2.
- the reaction mixture was washed with 1 M HC1 (150 mL) and the aqueous layer was extracted with DCM (200 mL x 2).
- the combined organic layers were dried over Na 2 S0 4 and concentrated to afford the desired product (84 g, 99%) as a yellow oil.
- Step 2 S-(cyclohexylmethyl) ethanethioate
- Step 3 cyclohexylmethanesulfonyl chloride
- Step 5 N'-(3-chloro-2-fluoro-5-(l-methyl-lH-imidazol-4-yl)benzoyl)-l- cyclohexyl methanesulfonohydrazide
- Step 1 tert-butyl (3-bromophenyl)carbamate
- Step 2 tert-butyl (3-bromophenyl)(methyl)carbamate
- Step 3 tert-butyl (3-(benzylthio)phenyl)(methyl)carbamate
- Step 4 tert-butyl (3-(chlorosulfonyl)phenyl)(methyl)carbamate
- Step 5 tert-butyl (3-(hydrazinylsulfonyl)phenyl)(methyl)carbamate
- Step 7 N'-(3-chloro-2-fluoro-5-(l-methyl-lH-imidazol-4-yl)benzoyl)-3-
- Step 4 N'-(3-chloro-2-fluoro-5-(l-methyl-lH-imidazol-4-yl)benzoyl)-5-methoxy pyridine-2-sulfonohydrazide
- Step 1 benzyl(2-fluoro-4-methoxyphenyl)sulfane
- Step 3 N'-(3-chloro-2-fluoro-5-(l-methyl-lH-imidazol-4-yl)benzoyl)-2-fluoro-4- methoxybenzenesulfonohydrazide
- KAT-5 Enzyme assay buffer was 50 mM Tris pH 8.0, 0.002% Tween20, 0.005% bovine skin gelatin, and 1 mM dithiothreitol (DTT).
- DTT dithiothreitol
- compounds were serially diluted with 2% (v/v) DMSO in the final reaction, pre-incubating each dilution of each compound with 40 pL of assay buffer containing KAT-5 enzyme (9 nM final concentration). 10 pL of assay buffer containing 1 pM peptide substrate and 0.5 pM acetyl coenzyme A (final concentrations) was added. Reactions (50 pL total) were then carried out at 25°C for 90 minutes.
- KAT-6A Enzyme assay buffer was 50 mM Tris pH 8.0, 0.002% Tween20, 0.005% bovine skin gelatin, and 1 mM dithiothreitol (DTT).
- DTT dithiothreitol
- compounds were serially diluted with 2% (v/v) DMSO in the final reaction, pre-incubating each dilution of each compound with 40 pL of assay buffer containing KAT-6A enzyme (12.5 nM final concentration). 10 pL of assay buffer containing 1 pM peptide substrate and 1 pM acetyl coenzyme A (final concentrations) was added. Reactions (50 pL total) were then carried out at 25°C for 90 minutes.
- KAT-7 Enzyme assay buffer was 50 mM Tris pH 8.0, 0.002% Tween20, 0.005% bovine skin gelatin, and 1 mM dithiothreitol (DTT).
- DTT dithiothreitol
- compounds were serially diluted with 2% (v/v) DMSO in the final reaction, pre-incubating each dilution of each compound with 40 pL of assay buffer containing KAT-7 enzyme (6 nM final concentration). 10 pL of assay buffer containing 1 pM peptide substrate and 2 pM acetyl coenzyme A (final concentrations) was added. Reactions (50 pL total) were then carried out at 25°C for 120 minutes.
- KAT-8 Enzyme assay buffer was 50 mM Tris pH 8.0, 0.002% Tween20, 0.005% bovine skin gelatin, and 1 mM dithiothreitol (DTT).
- DTT dithiothreitol
- compounds were serially diluted with 2% (v/v) DMSO in the final reaction, pre-incubating each dilution of each compound with 40 pL of assay buffer containing KAT-8 enzyme (12.5 nM final concentration). 10 pL of assay buffer containing 1 pM peptide substrate and 5 pM acetyl coenzyme A (final concentrations) was added. Reactions (50 pL total) were then carried out at 25°C for 90 minutes.
- KAT7 KAT7-1-611-FLAG
- KAT-8 His-KAT-8-l-458-FLAG
- Table 4 shows the activity of selected compounds of this disclosure in KAT-5
- KAT-6A, KAT-7, and KAT-8 inhibition assays correspond to the compound numbers above.
- Compounds having an activity designated as“A” provided an IC 50 of ⁇ 10 mM; compounds having an activity designated as“B” provided an IC 50 of 10.01-50 pM; compounds having an activity designated as “C” provided an IC50 of 50.01-100 pM; andcompounds having an activity designated as "D” provided an IC50 of >100 pM.
- Table 5 shows the activity of selected compounds of this disclosure in KAT-5, KAT- 6A, KAT-7, and KAT-8 inhibition assays.
- the compound numbers correspond to the compound numbers above.
- Compounds having an activity designated as“A” provided an IC50 of ⁇ 10 mM; compounds having an activity designated as“B” provided an IC50 of 10.01-50 mM; compounds having an activity designated as“C” provided an IC50 of 50.01-100 pM; compounds having an activity designated as“D” provided an IC 50 of >100 pM; and compounds having an activity designated as ⁇ ” provided an IC 50 of ⁇ 1 pM.
- Table 6 provides data for certain comparative compounds A-D, in particular, the biochemical assay data for KAT-5, KAT-6A, KAT-7, and KAT-8 inhibition assays.
- Compounds having an activity designated as“A” provided an IC50 of ⁇ 10 mM
- compounds having an activity designated as“B” provided an IC50 10.01-50 pM
- compounds having an activity designated as “C” provided an IC50 of 50.01-100 pM
- compounds having an activity designated as "D” provided an IC 50 of >100 pM.
- the secondary antibody solution consisted of a 1 : 100 dilution of goat- Anti-rabbit IgG (H + L) Alexa Fluor 680 (Life Technologies catalog A21076; Lot: 1655809) and 1 : 1000 dilution of Donkey anti-mouse IgG (H+L) IRDye 800CW (Odyssey Catalog 926-32212) in Odyssey buffer with 0.1% Tween 20 (v/v) and incubated for 1 hour in the dark at room temperature. The plates were washed 3 times with 100 pL per well wash buffer (IX PBS with 0.05% Tween 20 (v/v)) and then filled with 100 pL per well of IX PBS. Plates were imaged on the Licor Odyssey instrument which measures integrated intensity at 680 nm and 800 nm wavelength. Both 680 nm and 800 nm channels were scanned.
- the ratio for each well was determined by: ( anti-histone total H 3 800 nm value ) Then, the average of the ratio values for each test well was calculated and used to determine the percent of H3K23Ac from vehicle for each test well in the plate:
- Figure 1 depicts a representative inhibition of acetylation of H3 K23 cells by compound A-30 in the CAL-120 cell line.
- Lons term proliferation assay A panel of multiple myeloma (MM) and acute myeloid leukemia (AML) cell lines were tested in l4-day proliferation assays. Exponentially growing cells were plated, in triplicate, in 96-well plates at the appropriate cell density in a final volume of 150 pL. Cells were incubated in the presence of increasing concentrations of compound A-30. Viable cell number was determined at 0, 4, 7, 11, and 14 days using Calcein staining and using an Accumen instrument to enumerate the number of cells. On days of cell counts, growth media and compound A-30 were replaced, and cells split back to initial density. Total cell number is expressed as split-adjusted viable cells per well.
- Articles such as“a,”“an,” and“the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include“or” between two or more members of a group are considered satisfied if one, more than one, or all of the group members are present, unless indicated to the contrary or otherwise evident from the context.
- the disclosure of a group that includes“or” between two or more group members provides embodiments in which exactly one member of the group is present, embodiments in which more than one members of the group are present, and embodiments in which all of the group members are present. For purposes of brevity those embodiments have not been individually spelled out herein, but it will be understood that each of these embodiments is provided herein and may be specifically claimed or disclaimed.
- any particular embodiment of the present disclosure may be explicitly excluded from any one or more of the claims. Where ranges are given, any value within the range may explicitly be excluded from any one or more of the claims. Any embodiment, element, feature, application, or aspect of the compositions and/or methods of the disclosure, can be excluded from any one or more claims. For purposes of brevity, all of the embodiments in which one or more elements, features, purposes, or aspects is excluded are not set forth explicitly herein.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Life Sciences & Earth Sciences (AREA)
- Epidemiology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Hematology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pyridine Compounds (AREA)
- Heterocyclic Carbon Compounds Containing A Hetero Ring Having Nitrogen And Oxygen As The Only Ring Hetero Atoms (AREA)
- Plural Heterocyclic Compounds (AREA)
- Nitrogen Condensed Heterocyclic Rings (AREA)
- Pyrrole Compounds (AREA)
- Heterocyclic Carbon Compounds Containing A Hetero Ring Having Oxygen Or Sulfur (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201880083981.7A CN111565717A (zh) | 2017-11-29 | 2018-11-29 | Myst家族组蛋白乙酰转移酶抑制剂 |
| KR1020207018039A KR20200103005A (ko) | 2017-11-29 | 2018-11-29 | Myst 패밀리 히스톤 아세틸트랜스페라제 저해제 |
| JP2020527906A JP2021504314A (ja) | 2017-11-29 | 2018-11-29 | Mystファミリーヒストンアセチルトランスフェラーゼ阻害剤 |
| MX2020007131A MX2020007131A (es) | 2017-11-29 | 2018-11-29 | Inhibidores de histona acetiltransferasa de la familia myst. |
| CA3083616A CA3083616A1 (en) | 2017-11-29 | 2018-11-29 | Myst family histone acetyltransferase inhibitors |
| BR112020010628-3A BR112020010628A2 (pt) | 2017-11-29 | 2018-11-29 | composto, composição, método de inibição da atividade de histona acetiltransferases, método para inibir seletivamente a atividade de acetiltransferase, método de tratamento de uma doença ou distúrbio, método de tratamento de um tumor e composto ou composição para uso |
| EA202091337A EA202091337A1 (ru) | 2017-11-29 | 2018-11-29 | Ингибиторы гистонацетилтрансфераз семейства myst |
| US16/766,890 US11685732B2 (en) | 2017-11-29 | 2018-11-29 | MYST family histone acetyltransferase inhibitors |
| SG11202004390VA SG11202004390VA (en) | 2017-11-29 | 2018-11-29 | Myst family histone acetyltransferase inhibitors |
| EP18883537.5A EP3716964A4 (en) | 2017-11-29 | 2018-11-29 | MYST FAMILY HISTONE ACETYLTRANSFERASE INHIBITORS |
| AU2018375724A AU2018375724A1 (en) | 2017-11-29 | 2018-11-29 | MYST family histone acetyltransferase inhibitors |
| IL274685A IL274685A (en) | 2017-11-29 | 2020-05-14 | MYST family histone acetyltransferase inhibitors |
| CONC2020/0007895A CO2020007895A2 (es) | 2017-11-29 | 2020-06-26 | Inhibidores de histona acetiltransferasa de la familia myst |
| US18/170,319 US20230357208A1 (en) | 2017-11-29 | 2023-02-16 | Myst family histone acetyltransferase inhibitors |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762592215P | 2017-11-29 | 2017-11-29 | |
| US62/592,215 | 2017-11-29 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/766,890 A-371-Of-International US11685732B2 (en) | 2017-11-29 | 2018-11-29 | MYST family histone acetyltransferase inhibitors |
| US18/170,319 Continuation US20230357208A1 (en) | 2017-11-29 | 2023-02-16 | Myst family histone acetyltransferase inhibitors |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019108824A1 true WO2019108824A1 (en) | 2019-06-06 |
Family
ID=66665802
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/063110 Ceased WO2019108824A1 (en) | 2017-11-29 | 2018-11-29 | Myst family histone acetyltransferase inhibitors |
Country Status (16)
| Country | Link |
|---|---|
| US (2) | US11685732B2 (https=) |
| EP (1) | EP3716964A4 (https=) |
| JP (1) | JP2021504314A (https=) |
| KR (1) | KR20200103005A (https=) |
| CN (1) | CN111565717A (https=) |
| AU (1) | AU2018375724A1 (https=) |
| BR (1) | BR112020010628A2 (https=) |
| CA (1) | CA3083616A1 (https=) |
| CL (1) | CL2020001447A1 (https=) |
| CO (1) | CO2020007895A2 (https=) |
| EA (1) | EA202091337A1 (https=) |
| IL (1) | IL274685A (https=) |
| MA (1) | MA51226A (https=) |
| MX (1) | MX2020007131A (https=) |
| SG (1) | SG11202004390VA (https=) |
| WO (1) | WO2019108824A1 (https=) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022081842A1 (en) * | 2020-10-16 | 2022-04-21 | The Broad Institute, Inc. | Substituted acyl sulfonamides for treating cancer |
| WO2022081807A1 (en) * | 2020-10-16 | 2022-04-21 | The Broad Institute, Inc. | Substituted acyl sulfonamides for treating cancer |
| WO2023016484A1 (zh) | 2021-08-10 | 2023-02-16 | 江苏恒瑞医药股份有限公司 | 磺酰胺衍生物、其制备方法及其在医药上的应用 |
| CN115715285A (zh) * | 2020-04-27 | 2023-02-24 | 奧土择破利悟 | 作为ubr盒结构域配体的化合物 |
| WO2024165035A1 (zh) | 2023-02-10 | 2024-08-15 | 江苏恒瑞医药股份有限公司 | 一种磺酰胺衍生物结晶形式及其制备方法 |
| US12091406B2 (en) | 2021-11-16 | 2024-09-17 | Insilico Medicine Ip Limited | Lysine acetyltransferase 6A (KAT6A) inhibitors and uses thereof |
| WO2024189598A3 (en) * | 2023-03-16 | 2025-01-16 | Olema Pharmaceuticals, Inc. | Acylsulfonamide kat6a inhibitors |
| US12357603B2 (en) | 2019-04-25 | 2025-07-15 | Bayer Aktiengesellschaft | Acyl sulfonamides for treating cancer |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112138162B (zh) * | 2020-09-29 | 2021-12-28 | 中国科学院动物研究所 | 降低kat7含量或活性的物质在预防衰老和治疗肝纤维化中的应用 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4735959A (en) * | 1981-01-10 | 1988-04-05 | Dr. Karl Thomae Gmbh | Carboxylic acid amides and pharmaceutical compositions containing them |
| US20020120007A1 (en) * | 1997-06-26 | 2002-08-29 | Beight Douglas Wade | Antithrombotic agents |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB201510019D0 (en) * | 2015-06-09 | 2015-07-22 | Cancer Therapeutics Crc Pty Ltd | Compounds |
| EP3548480A1 (en) * | 2016-11-29 | 2019-10-09 | Epizyme, Inc. | Compounds containing a sulfonic group as kat inhibitors |
-
2018
- 2018-11-29 MX MX2020007131A patent/MX2020007131A/es unknown
- 2018-11-29 KR KR1020207018039A patent/KR20200103005A/ko not_active Ceased
- 2018-11-29 SG SG11202004390VA patent/SG11202004390VA/en unknown
- 2018-11-29 CA CA3083616A patent/CA3083616A1/en active Pending
- 2018-11-29 AU AU2018375724A patent/AU2018375724A1/en not_active Abandoned
- 2018-11-29 EA EA202091337A patent/EA202091337A1/ru unknown
- 2018-11-29 CN CN201880083981.7A patent/CN111565717A/zh active Pending
- 2018-11-29 WO PCT/US2018/063110 patent/WO2019108824A1/en not_active Ceased
- 2018-11-29 EP EP18883537.5A patent/EP3716964A4/en not_active Withdrawn
- 2018-11-29 JP JP2020527906A patent/JP2021504314A/ja active Pending
- 2018-11-29 BR BR112020010628-3A patent/BR112020010628A2/pt not_active IP Right Cessation
- 2018-11-29 US US16/766,890 patent/US11685732B2/en active Active
- 2018-11-29 MA MA051226A patent/MA51226A/fr unknown
-
2020
- 2020-05-14 IL IL274685A patent/IL274685A/en unknown
- 2020-05-29 CL CL2020001447A patent/CL2020001447A1/es unknown
- 2020-06-26 CO CONC2020/0007895A patent/CO2020007895A2/es unknown
-
2023
- 2023-02-16 US US18/170,319 patent/US20230357208A1/en not_active Abandoned
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4735959A (en) * | 1981-01-10 | 1988-04-05 | Dr. Karl Thomae Gmbh | Carboxylic acid amides and pharmaceutical compositions containing them |
| US20020120007A1 (en) * | 1997-06-26 | 2002-08-29 | Beight Douglas Wade | Antithrombotic agents |
Non-Patent Citations (1)
| Title |
|---|
| DATABASE PUBCHEM SUBSTANCE [online] 12 September 2005 (2005-09-12), XP055618901, retrieved from NCBI Database accession no. 5798273 * |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12357603B2 (en) | 2019-04-25 | 2025-07-15 | Bayer Aktiengesellschaft | Acyl sulfonamides for treating cancer |
| CN115715285A (zh) * | 2020-04-27 | 2023-02-24 | 奧土择破利悟 | 作为ubr盒结构域配体的化合物 |
| US12509420B2 (en) | 2020-04-27 | 2025-12-30 | Autotac Inc. | Compound as a UBR box domain ligand |
| JP2023523200A (ja) * | 2020-04-27 | 2023-06-02 | オートタック インコーポレーテッド | Ubrボックスドメインリガンドとしての化合物 |
| US12559455B2 (en) | 2020-04-27 | 2026-02-24 | Autotac Inc. | Compound as a UBR box domain ligand |
| JP7677584B2 (ja) | 2020-04-27 | 2025-05-15 | オートタック インコーポレーテッド | Ubrボックスドメインリガンドとしての化合物 |
| CN115715285B (zh) * | 2020-04-27 | 2025-09-09 | 奧土择破利悟 | 作为ubr盒结构域配体的化合物 |
| WO2022081842A1 (en) * | 2020-10-16 | 2022-04-21 | The Broad Institute, Inc. | Substituted acyl sulfonamides for treating cancer |
| WO2022081807A1 (en) * | 2020-10-16 | 2022-04-21 | The Broad Institute, Inc. | Substituted acyl sulfonamides for treating cancer |
| WO2023016484A1 (zh) | 2021-08-10 | 2023-02-16 | 江苏恒瑞医药股份有限公司 | 磺酰胺衍生物、其制备方法及其在医药上的应用 |
| US12091406B2 (en) | 2021-11-16 | 2024-09-17 | Insilico Medicine Ip Limited | Lysine acetyltransferase 6A (KAT6A) inhibitors and uses thereof |
| WO2024165035A1 (zh) | 2023-02-10 | 2024-08-15 | 江苏恒瑞医药股份有限公司 | 一种磺酰胺衍生物结晶形式及其制备方法 |
| EP4663635A1 (en) | 2023-02-10 | 2025-12-17 | Jiangsu Hengrui Pharmaceuticals Co., Ltd. | Crystalline form of sulfonamide derivative and preparation method therefor |
| US12428379B2 (en) | 2023-03-16 | 2025-09-30 | Olema Pharmaceuticals, Inc. | Acylsulfonamide KAT6A inhibitors |
| WO2024189598A3 (en) * | 2023-03-16 | 2025-01-16 | Olema Pharmaceuticals, Inc. | Acylsulfonamide kat6a inhibitors |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3716964A1 (en) | 2020-10-07 |
| IL274685A (en) | 2020-06-30 |
| EP3716964A4 (en) | 2021-08-25 |
| US20220162197A1 (en) | 2022-05-26 |
| US20230357208A1 (en) | 2023-11-09 |
| US11685732B2 (en) | 2023-06-27 |
| MA51226A (fr) | 2020-10-07 |
| EA202091337A1 (ru) | 2020-08-24 |
| KR20200103005A (ko) | 2020-09-01 |
| JP2021504314A (ja) | 2021-02-15 |
| CO2020007895A2 (es) | 2020-10-30 |
| BR112020010628A2 (pt) | 2020-11-10 |
| SG11202004390VA (en) | 2020-06-29 |
| CA3083616A1 (en) | 2019-06-06 |
| CN111565717A (zh) | 2020-08-21 |
| AU2018375724A1 (en) | 2020-07-16 |
| CL2020001447A1 (es) | 2021-02-26 |
| MX2020007131A (es) | 2021-01-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2019108824A1 (en) | Myst family histone acetyltransferase inhibitors | |
| EP3548480A1 (en) | Compounds containing a sulfonic group as kat inhibitors | |
| EP2782570B1 (en) | Heterocyclic inhibitors of glutaminase | |
| EP3423443B1 (en) | Cyano-substituted indole compounds and uses thereof as lsd1 inhibitors | |
| JP7307744B2 (ja) | がん治療のための1-(ピペリジノカルボニルメチル)-2-オキソピペラジン誘導体 | |
| KR20150091389A (ko) | 글루타미나제의 헤테로사이클릭 억제제에 의한 암 치료 | |
| ES2841452T3 (es) | Macrociclos de piridazinona como inhibidores de IRAK y sus usos | |
| JP2020514254A (ja) | がん治療のための組成物および方法 | |
| RS65319B1 (sr) | 8-cijano-5-piperidino-hinolini kao tlr7/8 antagonisti i njihova upotreba u lečenju imunoloških poremećaja | |
| WO2024035921A1 (en) | Degraders of son of sevenless homolog 1 | |
| JP2019513120A (ja) | がんを処置するためのリシルオキシダーゼ阻害剤としてのメチルアミン誘導体 | |
| BR112021014977A2 (pt) | Derivados de acetamido como inibidores de dna polimerase teta | |
| CZ293825B6 (cs) | ChinoxalinyŹ způsob jejich výroby a jejich použití a farmaceutické prostředky tyto látky obsahující | |
| JP2022174752A (ja) | Crebbp関連癌の治療法 | |
| US20160166576A1 (en) | Substituted amidopyrazole inhibitors of interleukin receptor-associated kinases (irak-4) | |
| CN111971278A (zh) | 用作irak抑制剂的喹啉化合物及其用途 | |
| CN109336829B (zh) | 含1,2,3-三氮唑结构的芳基甲酰胺类化合物及其用途 | |
| US20240197738A1 (en) | Compound 7ai in treating ewing sarcoma by inhibiting otud7a | |
| AU2023418787A1 (en) | Naphthylamide compound, and preparation method therefor and use thereof | |
| HK40043591B (zh) | 用作ii型irak抑制剂的杂芳基化合物及其用途 | |
| NZ625913B2 (en) | Heterocyclic inhibitors of glutaminase | |
| HK1201266B (en) | Fused tetra or penta-cyclic pyridophthalazinones as parp inhibitors |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18883537 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2020527906 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3083616 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20207018039 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2020/0007895 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 2018883537 Country of ref document: EP Effective date: 20200629 |
|
| ENP | Entry into the national phase |
Ref document number: 2018375724 Country of ref document: AU Date of ref document: 20181129 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020010628 Country of ref document: BR |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2020/0007895 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 112020010628 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200527 |
|
| WWG | Wipo information: grant in national office |
Ref document number: NC2020/0007895 Country of ref document: CO |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: NC2020/0007895 Country of ref document: CO Ref document number: 764070 Country of ref document: NZ |