WO2018200586A1 - Constructs specifically recognizing glypican 3 and uses thereof - Google Patents

Constructs specifically recognizing glypican 3 and uses thereof Download PDF

Info

Publication number
WO2018200586A1
WO2018200586A1 PCT/US2018/029221 US2018029221W WO2018200586A1 WO 2018200586 A1 WO2018200586 A1 WO 2018200586A1 US 2018029221 W US2018029221 W US 2018029221W WO 2018200586 A1 WO2018200586 A1 WO 2018200586A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
seq
gpc3
acid sequence
variant
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/029221
Other languages
English (en)
French (fr)
Other versions
WO2018200586A9 (en
Inventor
Pengbo Zhang
Yiyang XU
Javier Morales
Yoko Nakano
Hong Liu
Jingyi Xiang
Timothy ACKER
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Eureka Therapeutics Inc
Original Assignee
Eureka Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP18791195.3A priority Critical patent/EP3615574A4/en
Priority to IL319308A priority patent/IL319308A/en
Priority to KR1020197034685A priority patent/KR102663596B1/ko
Priority to AU2018258049A priority patent/AU2018258049B2/en
Priority to MX2019012133A priority patent/MX420947B/es
Priority to KR1020247014513A priority patent/KR20240067275A/ko
Priority to US16/608,377 priority patent/US11447564B2/en
Priority to SG11201909728X priority patent/SG11201909728XA/en
Priority to CA3059820A priority patent/CA3059820A1/en
Priority to MYPI2019006272A priority patent/MY201065A/en
Priority to CN201880027827.8A priority patent/CN110741019B/zh
Application filed by Eureka Therapeutics Inc filed Critical Eureka Therapeutics Inc
Priority to JP2019558615A priority patent/JP7295030B2/ja
Priority to IL270138A priority patent/IL270138B2/en
Publication of WO2018200586A1 publication Critical patent/WO2018200586A1/en
Priority to PH12019502412A priority patent/PH12019502412A1/en
Anticipated expiration legal-status Critical
Publication of WO2018200586A9 publication Critical patent/WO2018200586A9/en
Priority to ZA2020/00027A priority patent/ZA202000027B/en
Priority to US17/817,308 priority patent/US12479924B2/en
Priority to JP2023094432A priority patent/JP2023123540A/ja
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/00118Cancer antigens from embryonic or fetal origin
    • A61K39/001181Alpha-feto protein
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/32T-cell receptors [TCR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4261Proteoglycans, e.g. glypican, brevican or CSPG4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4264Cancer antigens from embryonic or fetal origin
    • A61K40/4265Alpha-feto protein
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/303Liver or Pancreas
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57525Immunoassay; Biospecific binding assay; Materials therefor for cancer of the liver or pancreas
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/5758Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
    • G01N33/5759Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5156Animal cells expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5158Antigen-pulsed cells, e.g. T-cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Definitions

  • This invention pertains to antibody constructs that specifically recognize Glypican 3 (GPC3), methods of making, and uses thereof including treating and diagnosing diseases.
  • GPC3 Glypican 3
  • Glypican 3 (GPC3, also known as SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2) is a cell surface protein that is overexpressed in multiple cancer types, including many solid tumors, such as hepatocellular carcinoma (HCC), melanoma (Nakatsura T et al, Clin Cancer Res. 2004), lung squamous cell carcinoma (Yu X et al., Genet Mol Res. 2015), ovarian carcinoma (Stadlmann S et al., Int J Gynecol Pathol. 2007), yolk sac tumor,
  • HCC hepatocellular carcinoma
  • melanoma Nakatsura T et al, Clin Cancer Res. 2004
  • lung squamous cell carcinoma Yu X et al., Genet Mol Res. 2015
  • ovarian carcinoma (Stadlmann S et al., Int J Gynecol Pathol. 2007), yolk sac
  • the GPC3 gene is located on the X chromosome and encodes a 70 kDa precursor protein of 580 amino acids (aa). This precursor protein can be cleaved by Furin between Arg 358 and Cys 359 and generate a 40 kDa N-terminal subunit and a 30 kDa C-terminal subunit linked by disulfide bonds.
  • the mature GPC3 is attached to the cell surface by a
  • GPC3 glycosylphosphatidylinositol anchor with two heparin sulfate (HS) chains on the C- terminal region close to the cell membrane.
  • HS heparin sulfate
  • GPC3 is an oncofetal protein that is widely expressed in human embryos, and regulates morphogenesis or growth through interaction with signaling factors, such as Wnt, hedgehog signaling, etc. GPC3 is not expressed in normal adult livers; however, during hepatic
  • GPC3 has been reported to be reactivated in HCC patients.
  • Yamauchi N et al. examined GPC3 expression in normal, non-neoplastic, and neoplastic liver tissues, and found that GPC3 was present in 84% (47/56) of HCC patients, but absent in normal adult liver, liver cirrhosis or hepatitis (Yamauchi N et al, Modern Pathology 2005). Similar results were reported by other groups (Nakatsura T et al, Biochem Biophys Res Commun. 2003; Baumhoer D et al, Am J Clin Pathol. 2008; Shirakawa H et al, Cancer Sci. 2009; Wang L et al, Hepatobiliary Pancreat Dis Int.
  • GPC3 could be released from cell surface to extracellular environment in different forms in HCC patients, but not in healthy donors. Therefore, GPC3 is currently used as a serum diagnostic marker for HCC (Hippo Y et al, Cancer Res. 2004; Capurro M et al, Gastroenterology 2003;
  • Hepatocellular carcinoma is the most common type of liver cancer, accounting for approximately 75% of all liver cancers. Liver cancer is the fifth most common cancer and the second most common cause of death from cancer in the world. Liver cancer incidence has more than tripled since 1980, and liver cancer death rates have increased by almost 3% per year since 2000 (https://www.cancer.org/cancer/liver-cancer/about/what-is-key-statistics.html). Prognosis for liver cancer is very poor with an overall ratio of mortality to incidence of 0.95.
  • liver cancer treatment is mainly limited to chemotherapy or surgery. However, the effect of chemotherapy is often limited because liver cells express ATP binding cassette (ABC) transporters which can export a large range of commonly used chemotherapeutic agents.
  • ABSC ATP binding cassette
  • the present application in one aspect provides anti-GPC3 constructs (such as isolated anti-GPC3 constructs) specifically recognizing a cell surface-bound GPC3 (referred to herein as a "native format GPC3,” or “native GPC3 (nGPC3)”).
  • the constructs include isolated anti-GPC3 constructs, specifically recognizing a cell surface-bound GPC3 (referred to herein as a "native format GPC3,” or “native GPC3 (nGPC3)”).
  • the constructs such as isolated anti-GPC3 constructs
  • anti-GPC3 constructs comprise an antibody moiety (referred to herein as an “anti-GPC3 antibody moiety”) specifically recognizing native format GPC3.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an antibody moiety specifically recognizing a cell surface-bound GPC3.
  • the antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity.
  • the K4 of the anti-GPC3 construct to the cell surface-bound GPC3 is about 0.1 nM to about 2 nM (e.g., about 0.1 nM to about 1 nM, or about 0.1 nM to about 1.5 nM).
  • the IC50 of a soluble GPC3 to compete binding between the anti-GPC3 construct and the cell surface-bound GPC3 is about 1 ⁇ g/ml to about 100 ⁇ g/ml (e.g., about 1 ⁇ g/ml to about 10 ⁇ g/ml, or about 2 ⁇ g/ml to about 5 ⁇ g/ml). In some
  • the cell surface-bound GPC3 comprises the amino acid sequence of SEQ ID NO: 460 or SEQ ID NO: 462. In some embodiments, the cell surface-bound GPC3 is GPC3 expressed on HepG2 cells. In some embodiments, the soluble GPC3 comprises the amino acid sequence of SEQ ID NO: 461 or SEQ ID NO: 463.
  • the antibody moiety specifically recognizes an epitope within human GPC3 comprising the amino acid sequence of SEQ ID NO: 460.
  • the antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461.
  • the antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 462.
  • the antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 463.
  • the antibody moiety specifically recognizes an epitope within the N-terminal fragment of GPC3. In some embodiments, the antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 464.
  • the antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3. In some embodiments, the antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain. [0016] In some embodiments according to any of the anti-GPC3 constructs (such as isolated anti-GPC3 constructs) described above, the antibody moiety does not specifically bind to the same or substantially the same GPC3 epitope competitively with GC33.
  • the antibody moiety does not bind to an epitope within the amino acid sequence of SEQ ID NO: 536. In some embodiments, the antibody moiety does not bind to a fragment comprising the amino acid sequence of SEQ ID NO: 536.
  • the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293.
  • GPC3 is expressed on the surface of a cancer cell.
  • the cancer cell is a liver cancer cell, such as hepatocellular carcinoma (HCC).
  • HCC hepatocellular carcinoma
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an antibody moiety specifically recognizing a cell surface-bound GPC3, wherein the antibody moiety comprises: i) a heavy chain variable domain (V H ) comprising a heavy chain complementarity determining region (HC-CDR) 1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, or a variant thereof comprising up to about 5 amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, or a variant thereof comprising up to about 5 amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133, or a variant thereof comprising up to about 5 amino acid substitutions; and ii) a light chain variable domain (V L ) comprising a light chain complementarity determining region (LC-CDR) 1 comprising the amino acid sequence of any
  • the antibody moiety comprises: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154-184, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 205-235, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 256-286.
  • the antibody moiety comprises: i) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337, or a variant thereof having at least about 95% sequence identify to any one of SEQ ID NOs: 307-337; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388, or a variant thereof having at least about 95% sequence identity to any one of SEQ ID NOs: 358-388.
  • the antibody moiety comprises: i) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388.
  • the present application in another aspect provides an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an antibody moiety specifically recognizing a cell surface-bound GPC3, wherein the antibody moiety comprises the HC-CDRs of V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337 and LC-CDRs of V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388 of an isolated anti-GPC3 construct.
  • an anti-GPC3 construct such as an isolated anti-GPC3 construct
  • an antibody moiety comprises the HC-CDRs of V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337 and LC-CDRs of V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388 of an isolated anti-GPC3 construct.
  • the present application in another aspect provides an isolated anti-GPC3 construct comprising an antibody moiety specifically recognizing GPC3, wherein the antibody moiety comprises: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, or a variant thereof comprising up to about 5 amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, or a variant thereof comprising up to about 5 amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153, or a variant thereof comprising up to about 5 amino acid substitutions; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 185-204, or a variant thereof comprising up to about 5 amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID
  • the antibody moiety comprises: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 185-204, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 236-255, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 287-306.
  • the antibody moiety comprises: i) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 338-357, or a variant thereof having at least about 95% sequence identify to any one of SEQ ID NOs: 338-357; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 389-408, or a variant thereof having at least about 95% sequence identity to any one of SEQ ID NOs: 389-408.
  • the antibody moiety comprises: i) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 338-357; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 389-408.
  • the present application in another aspect provides an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an antibody moiety specifically recognizing GPC3, wherein the antibody moiety comprises the HC-CDRs of V H comprising the amino acid sequence of any one of SEQ ID NOs: 338-357 and LC-CDRs of V L comprising the amino acid sequence of any one of SEQ ID NOs: 389-408 of an isolated anti-GPC3 construct.
  • the present application in another aspect provides an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an antibody moiety that specifically binds to GPC3 competitively with the isolated anti-GPC3 construct of any one of the anti-GPC3 constructs described above.
  • an anti-GPC3 construct such as an isolated anti-GPC3 construct
  • an antibody moiety that specifically binds to GPC3 competitively with the isolated anti-GPC3 construct of any one of the anti-GPC3 constructs described above.
  • the present application in another aspect provides an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an antibody moiety that specifically binds to the same, or substantially the same, GPC3 epitope competitively with the isolated anti-GPC3 construct of any one of the anti-GPC3 constructs described above.
  • an anti-GPC3 construct such as an isolated anti-GPC3 construct
  • an antibody moiety that specifically binds to the same, or substantially the same, GPC3 epitope competitively with the isolated anti-GPC3 construct of any one of the anti-GPC3 constructs described above.
  • the antibody moiety specifically recognizing GPC3 is chimeric, human, partially humanized, fully humanized, or semi -synthetic.
  • the antibody moiety specifically recognizing GPC3 is a full-length antibody, a Fab, a Fab', a F(ab')2, an Fv, or a single chain Fv (scFv). In some embodiments, the antibody moiety specifically recognizing GPC3 is an scFv. In some embodiments, the antibody moiety specifically recognizing GPC3 is a Fab or Fab' .
  • the antibody moiety specifically recognizing GPC3 is fused to an Fc fragment optionally via a linker.
  • the Fc fragment is an IgGl Fc fragment.
  • the isolated anti-GPC3 construct is a full-length antibody.
  • the isolated anti-GPC3 construct is monospecific.
  • the isolated anti-GPC3 construct is multispecific, such as bispecific.
  • the isolated anti-GPC3 construct is a tandem scFv, a diabody (Db), a single chain diabody (scDb), a dual-affinity retargeting (DART) antibody, a F(ab')2, a dual variable domain (DVD) antibody, a knob-into-hole (KiH) antibody, a dock and lock (DNL) antibody, a chemically cross-linked antibody, a heteromultimeric antibody, or a heteroconjugate antibody.
  • the isolated anti-GPC3 construct is a tandem scFv comprising two scFvs linked by a peptide linker.
  • the peptide linker comprises the amino acid sequence of TSGGGGS (SEQ ID NO: 474).
  • the isolated anti-GPC3 construct further comprises a second antibody moiety specifically recognizing a second antigen.
  • the second antigen is an antigen on the surface of a T cell, such as cytotoxic T cell, a helper T cell, or a natural killer T cell.
  • the second antigen is an antigen on the surface of a B cell, a natural killer cell, a dendritic cell, a macrophage, a monocyte, or a neutrophil.
  • the second antigen is selected from the group consisting of CD3y, CD35, CD3s, ⁇ 3 ⁇ , CD28, OX40, GITR, CD137, CD27, CD40L, and HVEM.
  • the second antigen is CD3s.
  • the isolated anti-GPC3 construct is a tandem scFv comprising an N-terminal scFv specifically recognizing GPC3 and a C-terminal scFv specifically recognizing CD3s.
  • the expression of the anti-GPC3 construct is induced by the activation of an engineered T cell.
  • the engineered T cell is a T cell comprising a chimeric antigen receptor (CAR).
  • the engineered T cell is a T cell comprising a chimeric antibody-T cell receptor (TCR) construct (caTCR).
  • the isolated anti-GPC3 construct is a chimeric antigen receptor (CAR) comprising: (a) an extracellular domain comprising the antibody moiety; (b) a transmembrane domain; and (c) an intracellular signaling domain.
  • the intracellular signaling domain comprises a CD3 ⁇ intracellular signaling sequence and a CD28 intracellular signaling sequence.
  • the isolated anti-GPC3 construct is a chimeric antibody- T cell receptor (TCR) construct (caTCR) comprising: (a) an extracellular domain comprising the antibody moiety; and (b) a T cell receptor module (TCRM) comprising a first TCR domain (TCRD) comprising a first TCR transmembrane domain (TCR-TM) and a second TCRD comprising a second TCR-TM, wherein the TCRM facilitates recruitment of at least one TCR- associated signaling molecule.
  • TCR chimeric antibody- T cell receptor
  • the first TCR-TM is derived from one of the transmembrane domains of a first naturally occurring TCR and the second TCR-TM is derived from the other transmembrane domain of the first naturally occurring TCR.
  • at least one of the TCR-TMs is non-naturally occurring.
  • the TCRM allows for enhanced recruitment of the at least one TCR-associated signaling molecule as compared to a TCRM comprising the first naturally occurring T cell receptor transmembrane domains.
  • the first naturally occurring TCR is a ⁇ / ⁇ TCR.
  • the first naturally occurring TCR is an ⁇ / ⁇ TCR.
  • the TCR-associated signaling molecule is selected from the group consisting of CD35s, CD3y8, and ⁇ (also known as CD3 ⁇ or CD3 ⁇ ).
  • the isolated anti-GPC3 construct is an immunoconjugate comprising the antibody moiety and an effector molecule.
  • the effector molecule is a therapeutic agent selected from the group consisting of a drug, a toxin, a radioisotope, a protein, a peptide, and a nucleic acid.
  • therapeutic agent is a drug or a toxin.
  • the effector molecule is a label.
  • the present application in another aspect provides an isolated nucleic acid encoding the polypeptide components of any one of the isolated anti-GPC3 constructs described above.
  • the present application in another aspect provides a vector comprising an isolated nucleic acid encoding the polypeptide components of any one of the isolated anti-GPC3 constructs described above.
  • the present application in another aspect provides an isolated host cell comprising any one of the anti-GPC3 constructs described above. [0039] The present application in another aspect provides an isolated host cell comprising an isolated nucleic acid encoding the polypeptide components of any one of the isolated anti-GPC3 constructs described above.
  • the present application in another aspect provides an isolated host cell comprising a vector comprising an isolated nucleic acid encoding the polypeptide components of any one of the isolated anti-GPC3 constructs described above.
  • the present application in another aspect provides an effector cell expressing any one of the isolated anti-GPC3 construct described above.
  • the effector cell is a T cell.
  • the present application in another aspect provides a pharmaceutical composition comprising any one of the anti-GPC3 construct (such as isolated anti-GPC3 construct) described above, and a pharmaceutically acceptable carrier.
  • kits comprising any one of the isolated anti-GPC3 constructs described above, an isolated nucleic acid encoding the polypeptide components of any one of the isolated anti-GPC3 constructs described above, a vector comprising an nucleic acid encoding the polypeptide components of any one of the isolated anti-GPC3 constructs described above, any one of the isolated cell described above, or any one of the effector cell described above.
  • the present application in another aspect provides a method of detecting GPC3 in a sample, comprising contacting the sample with any one of the isolated anti-GPC3
  • the sample comprises cells with cell surface-bound GPC3. In some embodiments, the sample comprises soluble GPC3.
  • the present application in another aspect provides a method of treating an individual having a GPC3-positive disease, comprising administering to the individual: a) an effective amount of any one of the pharmaceutical compositions described above; or b) an effective amount of any one of the effector cells described above.
  • the individual a) an effective amount of any one of the pharmaceutical compositions described above; or b) an effective amount of any one of the effector cells described above.
  • the administration is via intravenous or intratumoral route. In some embodiments, the administration is to an injection site distal to a first disease site. In some embodiments, the method of treating an individual having a GPC3-positive disease further comprising administering to the individual an additional therapy.
  • the GPC3-positive disease is cancer, such as HCC, melanoma, lung squamous cell carcinoma, ovarian carcinoma, yolk sac tumor, choriocarcinoma, neuroblastoma, hepatoblastoma, Wilms' tumor, testicular nonseminomatous germ cell tumor, gastric carcinoma, or liposarcoma.
  • the cancer is HCC, such as metastatic HCC.
  • the present application in another aspect provides a method of diagnosing an individual having a GPC3-positive disease, comprising: a) administering an effective amount of any one of the isolated anti-GPC3 immunoconjugates described above comprising an antibody moiety and a label; and b) determining the level of the label in the individual, wherein a level of the label above a threshold level indicates that the individual has the GPC3-positive disease.
  • the GPC3-positive disease is cancer, such as HCC, melanoma, lung squamous cell carcinoma, ovarian carcinoma, yolk sac tumor, choriocarcinoma, neuroblastoma, hepatoblastoma, Wilms' tumor, testicular nonseminomatous germ cell tumor, gastric carcinoma, or liposarcoma.
  • cancer such as metastatic HCC.
  • the present application in another aspect provides a method of diagnosing an individual having an GPC3-positive disease, comprising: a) contacting a sample derived from the individual with any one of the isolated anti-GPC3 immunoconjugates described above comprising an antibody moiety and a label; and b) determining the number of cells bound with the isolated anti-GPC3 construct in the sample, wherein a value for the number of cells bound with the isolated anti-GPC3 construct above a threshold level indicates that the individual has the GPC3-positive disease.
  • the GPC3-positive disease is cancer, such as HCC, melanoma, lung squamous cell carcinoma, ovarian carcinoma, yolk sac tumor, choriocarcinoma, neuroblastoma, hepatoblastoma, Wilms' tumor, testicular nonseminomatous germ cell tumor, gastric carcinoma, or liposarcoma.
  • cancer such as metastatic HCC.
  • FIGs. 1 A-1G show FACS analysis of the binding of 14 exemplary GPC3A phage clones to GPC3 + HepG2 cells.
  • the binding of helper phages to the GPC3 + HepG2 cells was used as a control.
  • FIGs. 2A-2E show FACS analysis of the binding of 5 exemplary GPC3 A phage clones to GPC3 + HepG2 cell line and HepG2 GPC3 -knockout cell lines (HepG2-GPC3-KO-2 and HepG2-GPC3-KO-3). Helper phages were used as a negative control.
  • FIGs. 3 A-3D show FACS analysis of the binding of 4 exemplary GPC3B phage clones to GPC3 + HepG2 cell line and HepG2-GPC3-KO-2 cell line. Helper phages were used as a negative control.
  • FIGs. 4A-4B show FACS analysis of the binding of exemplary GPC3A L2K bispecific antibodies (anti-GPC3 CD3 di-scFvs derived from GPC3A screen) to SK-Hepl-GPC3 cells and GPC3-negative SK-Hepl cells.
  • the y-axis shows median fluorescence intensity (MFI).
  • FIGs. 5A-5B show FACS analysis of the binding of exemplary GPC3A L2K bispecific antibodies (anti-GPC3 CD3 di-scFvs derived from GPC3A screen) to GPC3+ HepG2 cells.
  • the binding of a control L2K bispecific antibody to GPC3+ HepG2 cells was used as a negative control.
  • FIG. 6 shows FACS analysis of the binding of GPC3A L2K bispecific antibodies to GPC3+ HepG2 cells in a competition assay provided with or without soluble GPC3 antigen.
  • a negative control L2K bispecific antibody and a commercial anti-GPC3 (1G12) antibody were used for comparison purposes.
  • FIG. 7A shows T cell-mediated target cell killing by GPC3 A L2K bispecific antibodies, tested on GPC3+ HepG2 cells, GPC3-negative SK-Hepl cells, SK-Hepl-GPC3 cells, HepG2- GPC3-KO cells (#2 and #11).
  • FIG. 7B shows T cell-mediated target cell killing by GPC3B L2K bispecific antibodies, tested on GPC3+ HepG2 cells, GPC3 -negative SK-Hepl cells, SK-Hepl - GPC3 cells, and HepG2-GPC3-KO-2 cells.
  • FIG. 8 shows FACS analysis of HepG2 GPC3 -knockout cell lines using a commercial mouse anti-human GPC3 antibody (1G12), demonstrating successful generation of HepG2- GPC3-KO cell lines.
  • FIG. 9A shows FACS analysis of the binding of anti-human GPC3 (hGPC3)
  • FIG. 9B shows FACS analysis of the binding of anti-hGPC3 mlgGl to GPC3- negative SK-Hepl ceils.
  • FIG. 10 shows the FACS fluorescence intensity curves indicating competition for HepG2-binding of GPC3 L2K antibodies (GPC3B-87 L2K or GC33 L2K) by soluble GPC3.
  • FIG, 11 shows the FACS fluorescence intensity curves indicating the binding affinity of GPC3 LK.2 clones towards HepG2 cells.
  • FIG. 12 shows the ELISA analysis of reactivity of GPC3 mlgGl clones to rat GPC3 and human GPC3 (hGPC3).
  • FIG. 13 shows the GPC3 epitope binning analysis of GC33-mIgG, GPC3A-37 nilgG and GPC3A-55 mlgG using a linear format of epitope binning.
  • FIG. 14 shows the GPC3 epitope binning analysis of GC33-mIgG, GPC3A-37 mlgG and GPC3A-55 mlgG using a sandwich format of epitope binning.
  • FIGs. 15 A and 15B show the plotted data from single-cycle kinetics analysis of binding between GPC3 A L2K clones and GPC3 antigen.
  • FIG. 16 shows the LDH cytotoxicity analysis in GPC3-positive HepG2 cells, GPC3- negative SK-Hepl cells, SK-Hepl-GPC3 cells, and HepG2-GPC3-KO cells treated by GPC3A or GPC3B CAR-T cells and GC33 CAR-T ceils.
  • FIG. 17A shows the LDH cytotoxicity analysis in GPC3+ HepG2 cells, GPC3-negative SK-Hepl cells, SK-Hepl-GPC3 cells, and HepG2-GPC3-KO cells treated by GPC3A or GPC3B CAR-T cells and GC33 CAR-T cells.
  • FIG. 17B shows the LDH cytotoxicity analysis in GPC3- positive JHH5 cells, GPC3-negative A-498 cells, and GPC3-negative PANC-1 cells treated by GPC3A or GPC3B CAR-T cells and GC33 CAR-T cells.
  • FIG. 18 shows percent specific lysis from the killing of cancer cell lines HepG2 (AFP + /GPC3 + ) and HepG2-GPC3-KO (AFP + /GPC3 " ), mediated by T cells transduced with either anti-AFP158/HLA-A*2:01 caTCR alone or anti-AFP158/HLA-A*2:01 caTCR + anti- CD3/anti-GPC3 BsAb at the indicated percent caTCR positivity (5% to 40%).
  • FIG. 19 shows the concentration of cytokines (TL-2, IFN- ⁇ , and T F-a) found in the supernatant after in vitro killing of cancer cell lines HepG2 and HepG2-GPC3-KO, mediated by T cells transduced with either anti-AFP158/HLA-A*2:01 caTCR alone or anti-AFP 158/HLA- A*2:01 caTCR + anti-CD3/anti-GPC3 BsAb at the indicated percent caTCR positivity (5% to 40%).
  • cytokines TL-2, IFN- ⁇ , and T F-a
  • FIG. 20 shows the potentiation of target-specific cancer cell line killing mediated by anti-CD3/anti-GPC3 BsAbs released from activated anti-AFP 158/HLA-A*2:01 caTCR + anti- CD3/anti-GPC3 BsAb T cells.
  • the indicated transduced T cells and target cells were incubated together and separated from the indicated target cells and mock T cells by a membrane permeable to the BsAb, but not the T cells.
  • FIG. 21 shows percent specific lysis from the killing of cancer cell lines HepG2 (AFP + /GPC3 + ) and HepG2-GPC3.ko (AFP + /GPC3 " ), mediated by T cells transduced with anti- AFP 158/HLA-A*2:01 caTCR-1-0 alone, anti-GPC3 CSR alone, or anti-AFP 158/HLA-A*2:01 caTCR (1-0 and 1-TM5) + anti-GPC3 CSR.
  • FIG. 21 shows percent specific lysis from the killing of cancer cell lines HepG2 (AFP + /GPC3 + ) and HepG2-GPC3.ko (AFP + /GPC3 " ), mediated by T cells transduced with anti- AFP 158/HLA-A*2:01 caTCR-1-0 alone, anti-GPC3 CSR alone, or anti-AFP 158/HLA-A*2:01 caTCR (1-0 and 1-TM5) + anti-GPC3 CSR.
  • cytokines L-2, GM-CSF, IFN- ⁇ , and T F-a
  • concentration of cytokines L-2, GM-CSF, IFN- ⁇ , and T F-a
  • FIG. 23 shows the degranulation activity (as determined by CD 107a expression) in T cells transduced with anti-AFP 158/HLA-A*2:01 caTCR-1-0 alone, anti-GPC3 CSR alone, or anti-AFP158/HLA-A*2:01 caTCR (1-0 and 1-TM5) + anti-GPC3 CSR following stimulation with cancer cell line HepG2.
  • FIG. 24 shows the proliferation (as determined by CFSE dye dilution) of T cells transduced with anti-AFP158/HLA-A*2:01 caTCR- 1-0 alone, anti-GPC3 CSR alone, or anti- AFP 158/HLA-A*2:01 caTCR (1-0 and 1-TM5) + anti-GPC3 CSR following stimulation with cancer cell line HepG2.
  • FIG. 25 shows the tumor growth in a subcutaneous mouse model of HepG2 with mock treatment or with a single intratumoral injection of T cells transduced with an anti-AFP CAR, or an anti-AFP CAR in combination with an anti-GPC3 CSR.
  • anti- GPC3 constructs such as isolated anti-GPC3 construct
  • an antibody moiety referred to herein as an "anti-GPC3 antibody moiety”
  • nGPC3 native format GPC3
  • sGPC3 non-cell surface bound GPC3
  • non-native GPC3 such as circulating GPC3 protein or free GPC3 peptides in the serum.
  • the anti-GPC3 antibody moiety specifically redirected human T cells to kill GPC3 -expressing target cells (such as GPC3 -expressing cancer cells).
  • GPC3 -expressing target cells such as GPC3 -expressing cancer cells.
  • the anti-GPC3 antibody moiety allows for diagnosis and prognosis of GPC3-positive diseases or disorders with high sensitivity to changes in the number and distribution of cells expressing GPC3 on the cell surface (such as GPC3-positive tumor cells), a potentially more relevant measure of disease progression than circulating GPC3 levels.
  • the present application also provides anti-GPC3 constructs (such as isolated anti- GPC3 constructs) comprising an antibody moiety specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3). These constructs can also be armed as anti-CD3 bispecific antibodies or present in a CAR expressed by a T cell. GPC3 can be expressed on cell surface or released from cell surface to extracellular environment in different forms in cancer patients (such as HCC patients). Thus, these anti-GPC3 constructs can also be fused to a detectable moiety and used for diagnosis and prognosis purposes.
  • the present application thus provides constructs (such as isolated constructs) comprising an antibody moiety specifically recognizing GPC3, such as a cell surface-bound GPC3.
  • the construct can be, for example, anti-GPC3 scFv, anti-GPC3 Fc fusion protein, full- length anti-GPC3 antibodies, multi-specific (such as bispecific) anti-GPC3 molecules (e.g., tandem di-scFv bispecific T cell engager), anti-GPC3 chimeric antigen receptors (CARs), anti- GPC3 chimeric antibody-T cell receptors (caTCRs), and anti-GPC3 immunoconjugates.
  • CARs anti-GPC3 chimeric antigen receptors
  • caTCRs anti-GPC3 immunoconjugates.
  • nucleic acids encoding the anti-GPC3 constructs (such as isolated anti-GPC3 constructs) or the anti-GPC3 antibody moiety portion of the constructs (such as those specifically recognizing cell surface-bound GPC3).
  • compositions (such as pharmaceutical
  • compositions comprising an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an antibody moiety specifically recognizing GPC3 (such as a cell surface-bound GPC3).
  • the composition can be a pharmaceutical composition comprising an anti-GPC3 construct (such as a cell surface-bound GPC3) or an effector cell expressing or associated with the anti-GPC3 construct (for example a T cell expressing an anti-GPC3 CAR, a CAR
  • anti-GPC3 constructs such as isolated anti-GPC3 constructs, or cells expressing or associated with the anti-GPC3 constructs
  • methods of making and using the anti-GPC3 constructs for treatment or diagnostic purposes, as well as kits and articles of manufacture useful for such methods.
  • treatment is an approach for obtaining beneficial or desired results, including clinical results.
  • beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease), preventing or delaying the spread (e.g., metastasis) of the disease, preventing or delaying the recurrence of the disease, delay or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and/or prolonging survival.
  • treatment is a reduction of pathological consequence of cancer (such as, for example, tumor volume).
  • the methods of the invention contemplate any one or more of these aspects of
  • Activation refers to the state of a T cell that has been sufficiently stimulated to induce detectable cellular proliferation. Activation can also be associated with induced cytokine production, and detectable effector functions.
  • antibody moiety includes full-length antibodies and antigen-binding fragments thereof.
  • a full-length antibody comprises two heavy chains and two light chains.
  • the variable regions of the light and heavy chains are responsible for antigen binding.
  • the variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain (LC) CDRs including LC-CDR1, LC-CDR2, and LC- CDR3, heavy chain (HC) CDRs including HC-CDR1, HC-CDR2, and HC-CDR3).
  • CDRs complementarity determining regions
  • CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, Chothia, or Al-Lazikani (Al-Lazikani 1997; Chothia 1985; Chothia 1987; Chothia 1989; Kabat 1987; Kabat 1991).
  • the three CDRs of the heavy or light chains are interposed between flanking stretches known as framework regions (FRs), which are more highly conserved than the CDRs and form a scaffold to support the hypervariable loops.
  • FRs framework regions
  • the constant regions of the heavy and light chains are not involved in antigen binding, but exhibit various effector functions.
  • Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain.
  • the five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ heavy chains, respectively.
  • Several of the major antibody classes are divided into subclasses such as lgGl ( ⁇ heavy chain), lgG2 ( ⁇ 2 heavy chain), lgG3 ( ⁇ 3 heavy chain), lgG4 ( ⁇ 4 heavy chain), IgAl (al heavy chain), or lgA2 (a2 heavy chain).
  • antigen-binding fragment refers to an antibody fragment including, for example, a diabody, a Fab, a Fab', a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv'), a disulfide stabilized diabody (ds diabody), a single-chain Fv (scFv), an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure.
  • an antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment (e.g., a parent scFv) binds.
  • an antigen- binding fragment may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
  • epitope refers to the specific group of atoms or amino acids on an antigen to which an antibody or antibody moiety binds. Two antibodies or antibody moieties may bind the same epitope within an antigen if they exhibit competitive binding for the antigen.
  • a first antibody moiety "competes" for binding to a target GPC3 (e.g., nGPC3 and/or sGPC3) with a second antibody moiety when the first antibody moiety inhibits target GPC3 binding of the second antibody moiety by at least about 50% (such as at least about any of 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) in the presence of an equimolar concentration of the first antibody moiety, or vice versa.
  • a target GPC3 e.g., nGPC3 and/or sGPC3
  • a second antibody moiety when the first antibody moiety inhibits target GPC3 binding of the second antibody moiety by at least about 50% (such as at least about any of 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) in the presence of an equimolar concentration of the first antibody moiety, or vice versa.
  • the term “specifically binds,” “specifically recognizing,” or “is specific for” refers to measurable and reproducible interactions, such as binding between a target and an antibody or antibody moiety, that is determinative of the presence of the target in the presence of a heterogeneous population of molecules, including biological molecules.
  • an antibody or antibody moiety that specifically recognizes a target is an antibody or antibody moiety that binds this target with greater affinity, avidity, more readily, and/or with greater duration than its bindings to other targets.
  • an antibody or antibody moiety that specifically recognizes an antigen reacts with one or more antigenic determinants of the antigen (such as native format GPC3) with a binding affinity that is at least about 10 times its binding affinity for other targets (such as soluble GPC3).
  • An "isolated" anti-GPC3 construct as used herein refers to an anti-GPC3 construct that (1) is not associated with proteins found in nature, (2) is free of other proteins from the same source, (3) is expressed by a cell from a different species, or, (4) does not occur in nature.
  • isolated nucleic acid as used herein is intended to mean a nucleic acid of genomic, cDNA, or synthetic origin or some combination thereof, which by virtue of its origin the "isolated nucleic acid” (1) is not associated with all or a portion of a polynucleotide in which the "isolated nucleic acid” is found in nature, (2) is operably linked to a polynucleotide which it is not linked to in nature, or (3) does not occur in nature as part of a larger sequence.
  • CDR complementarity determining region
  • CDR complementarity determining region
  • V H CDR3 95-102 96-101 93-101 105-117 109-137
  • Residue numbering follows the nomenclature of Kabat et al. , supra
  • chimeric antibodies refer to antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit a biological activity of this invention (see U.S. Patent No. 4,816,567; and Morrison et al, Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)).
  • synthetic in reference to an antibody or antibody moiety means that the antibody or antibody moiety has one or more naturally occurring sequences and one or more non-naturally occurring (i.e., synthetic) sequences.
  • Fv is the minimum antibody fragment which contains a complete antigen-recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the heavy and light chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
  • Single-chain Fv also abbreviated as “sFv” or “scFv,” are antibody fragments that comprise the V H and V L antibody domains connected into a single polypeptide chain.
  • the scFv polypeptide further comprises a polypeptide linker between the V H and V L domains which enables the scFv to form the desired structure for antigen binding.
  • diabodies refers to small antibody fragments prepared by constructing scFv fragments (see preceding paragraph) typically with short linkers (such as about 5 to about 10 residues) between the V H and V L domains such that inter-chain but not intra-chain pairing of the V domains is achieved, resulting in a bivalent fragment, i.e., fragment having two antigen- binding sites.
  • Bispecific diabodies are heterodimers of two "crossover" scFv fragments in which the V H and V L domains of the two antibodies are present on different polypeptide chains.
  • Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al, Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
  • Humanized forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a
  • hypervariable region (HVR) of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
  • donor antibody such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
  • framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • polypeptide being compared after aligning the sequences considering any conservative substitutions as part of the sequence identity.
  • Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR), or MUSCLE software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared.
  • % amino acid sequence identity values are generated using the sequence comparison computer program MUSCLE (Edgar, R.C., Nucleic Acids Research 32(5): 1792-1797, 2004; Edgar, R.C., BMC Bioinformatics 5(1): 113, 2004).
  • an FcR of this invention is one that binds an IgG antibody (a ⁇ receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • FcyRII receptors include FcyRIIA (an “activating receptor”) and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
  • Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (IT AM) in its cytoplasmic domain.
  • Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITFM) in its cytoplasmic domain ⁇ see review M. in Daeron, Annu. Rev. Immunol. 15:203-234 (1997)).
  • the term includes allotypes, such as FcyRIIIA allotypes: FcYRIIIA-Phel58, FcYRIIIA-Vall58, FcyRIIA-R131 and/or FcyRIIA-H l .
  • FcRs are reviewed in Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991); Capel et al,
  • FcR neonatal receptor
  • FcRn refers to the neonatal Fc receptor (FcRn).
  • FcRn is structurally similar to major histocompatibility complex (MHC) and consists of an a-chain noncovalently bound to P2-microglobulin.
  • MHC major histocompatibility complex
  • FcRn plays a role in the passive delivery of immunoglobulin IgGs from mother to young and the regulation of serum IgG levels.
  • FcRn can act as a salvage receptor, binding and transporting pinocytosed IgGs in intact form both within and across cells, and rescuing them from a default degradative pathway.
  • the "CHI domain” of a human IgG Fc region (also referred to as "CI” of "HI” domain) usually extends from about amino acid 118 to about amino acid 215 (EU numbering system).
  • Hinge region is generally defined as stretching from Glu216 to Pro230 of human IgGl (Burton, Molec. Immunol.22: ⁇ 6 ⁇ -206 (1985)). Hinge regions of other IgG isotypes may be aligned with the IgGl sequence by placing the first and last cysteine residues forming inter- heavy chain S-S bonds in the same positions.
  • the "CH2 domain" of a human IgG Fc region usually extends from about amino acid 231 to about amino acid 340.
  • the CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. It has been speculated that the carbohydrate may provide a substitute for the domain- domain pairing and help stabilize the CH2 domain.
  • CH3 domain (also referred to as “C2" or “H3” domain) comprises the stretch of residues C-terminal to a CH2 domain in an Fc region (i.e. from about amino acid residue 341 to the C-terminal end of an antibody sequence, typically at amino acid residue 446 or 447 of an IgG).
  • a "functional Fc fragment” possesses an "effector function” of a native sequence Fc region.
  • exemplary "effector functions” include Clq binding; complement dependent
  • cytotoxicity CDC
  • Fc receptor binding antibody-dependent cell-mediated cytotoxicity
  • ADCC phagocytosis
  • B cell receptor BCR
  • effector functions generally require the Fc region to be combined with a binding domain (e.g. an antibody variable domain) and can be assessed using various assays known in the art.
  • An antibody with a variant IgG Fc with "altered" FcR binding affinity or ADCC activity is one which has either enhanced or diminished FcR binding activity (e.g., FcyR or FcRn) and/or ADCC activity compared to a parent polypeptide or to a polypeptide comprising a native sequence Fc region.
  • the variant Fc which "exhibits increased binding" to an FcR binds at least one FcR with higher affinity (e.g., lower apparent 3 ⁇ 4 or IC 50 value) than the parent polypeptide or a native sequence IgG Fc.
  • the improvement in binding compared to a parent polypeptide is about 3 fold, such as about any of 5, 10, 25, 50, 60, 100, 150, 200, or up to 500 fold, or about 25% to 1000% improvement in binding.
  • the polypeptide variant which "exhibits decreased binding" to an FcR binds at least one FcR with lower affinity (e.g., higher apparent K d or higher IC 50 value) than a parent polypeptide.
  • the decrease in binding compared to a parent polypeptide may be about 40% or more decrease in binding.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • FcRs Fc receptors
  • cytotoxic cells e.g., Natural Killer (NK) cells, neutrophils, and macrophages
  • NK Natural Killer
  • the antibodies “arm” the cytotoxic cells and are absolutely required for such killing.
  • ADCC activity of a molecule of interest is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991).
  • an in vitro ADCC assay such as that described in US Patent No. 5,500,362 or 5,821,337 may be performed.
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
  • the polypeptide comprising a variant Fc region which "exhibits increased ADCC" or mediates ADCC in the presence of human effector cells more effectively than a polypeptide having wild type IgG Fc or a parent polypeptide is one which in vitro or in vivo is substantially more effective at mediating ADCC, when the amounts of polypeptide with variant Fc region and the polypeptide with wild type Fc region (or the parent polypeptide) in the assay are essentially the same.
  • such variants will be identified using any in vitro ADCC assay known in the art, such as assays or methods for determining ADCC activity, e.g., in an animal model etc.
  • the variant is from about 5 fold to about 100 fold, e.g. from about 25 to about 50 fold, more effective at mediating ADCC than the wild type Fc (or parent polypeptide) .
  • CDC complement dependent cytotoxicity
  • Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (Clq) to antibodies (of the appropriate subclass) which are bound to their cognate antigen.
  • Clq first component of the complement system
  • a CDC assay e.g. as described in Gazzano-Santoro et al, J. Immunol. Methods 202: 163 (1996), may be performed.
  • Polypeptide variants with altered Fc region amino acid sequences and increased or decreased Clq binding capability are described in US patent No. 6, 194,551B 1 and W099/51642. The contents of those patent publications are specifically incorporated herein by reference. See also, Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
  • nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
  • the phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
  • operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
  • a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
  • a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
  • operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
  • homologous refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position.
  • the percent of homology between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared times 100. For example, if 6 of 10 of the positions in two sequences are matched or homologous then the two sequences are 60% homologous.
  • the DNA sequences ATTGCC and TATGGC share 50% homology. Generally, a comparison is made when two sequences are aligned to give maximum homology.
  • an “effective amount” of an anti-GPC3 construct or composition as disclosed herein is an amount sufficient to carry out a specifically stated purpose.
  • An “effective amount” can be determined empirically and by known methods relating to the stated purpose.
  • therapeutically effective amount refers to an amount of an anti-GPC3 construct or composition as disclosed herein, effective to "treat” a disease or disorder in an individual.
  • therapeutically effective amount of the anti-GPC3 construct or composition as disclosed herein can reduce the number of cancer cells; reduce the tumor size or weight; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer.
  • therapeutically effective amount is a growth inhibitory amount. In some embodiments, therapeutically effective amount is an amount that extends the survival of a patient. In some embodiments, therapeutically effective amount is an amount that improves progression free survival of a patient.
  • pharmaceutically acceptable or “pharmacologically compatible” is meant a material that is not biologically or otherwise undesirable, e.g., the material may be incorporated into a pharmaceutical composition administered to a patient without causing any significant undesirable biological effects or interacting in a deleterious manner with any of the other components of the composition in which it is contained.
  • Pharmaceutically acceptable carriers or excipients have preferably met the required standards of toxicological and
  • label when used herein refers to a detectable compound or composition which can be conjugated directly or indirectly to the anti-GPC3 antibody moiety.
  • the label may be detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
  • reference to "not" a value or parameter generally means and describes "other than” a value or parameter.
  • the method is not used to treat cancer of type X means the method is used to treat cancer of types other than X.
  • the present invention provides GPC3-specific constructs (such as isolated anti-GPC3 constructs) that comprise an antibody moiety that specifically binds to GPC3.
  • the specificity of the anti-GPC3 construct derives from an anti-GPC3 antibody moiety, such as a full-length antibody or antigen-binding fragment thereof, which specifically binds to GPC3.
  • reference to a moiety (such as an antibody moiety) that specifically binds to GPC3 means that the moiety binds to the GPC3 with an affinity that is at least about 10 times (including for example at least about any of 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) its binding affinity for non-target.
  • the non-target is an antigen that is not GPC3.
  • the non-target is a soluble GPC3.
  • the non-target is a cell surface-bound GPC3.
  • Binding affinity can be determined by methods known in the art, such as ELISA, fluorescence activated cell sorting (FACS) analysis, or radioimmunoprecipitation assay (RIA).
  • K d can be determined by methods known in the art, such as surface plasmon resonance (SPR) assay utilizing, for example, BIACORE i l instruments, or kinetic exclusion assay (KinExA) utilizing, for example, Sapidyne instruments.
  • SPR surface plasmon resonance
  • KinExA kinetic exclusion assay
  • Contemplated anti-GPC3 constructs include, for example, anti-GPC3 scFv, anti-GPC3 Fc fusion protein, full-length anti-GPC3 antibodies, multi-specific (such as bispecific) anti- GPC3 molecules (e.g., tandem di-scFv bispecific T cell engager), anti-GPC3 chimeric antigen receptors (CARs), anti-GPC3 chimeric antibody-T cell receptors (caTCRs), and anti-GPC3 immunoconjugates.
  • anti-GPC3 scFv anti-GPC3 Fc fusion protein
  • full-length anti-GPC3 antibodies full-length anti-GPC3 antibodies
  • multi-specific (such as bispecific) anti- GPC3 molecules e.g., tandem di-scFv bispecific T cell engager
  • CARs anti-GPC3 chimeric antigen receptors
  • caTCRs anti-GPC3 chimeric antibody-T cell receptors
  • anti-GPC3 constructs comprising an anti-GPC3 antibody moiety that contain human sequences (i.e., human heavy and light chain variable region sequences comprising human CDR sequences) are extensively discussed herein, the present invention also provides non-human anti-GPC3 constructs.
  • non-human antibody agents comprise human CDR sequences from an antibody agent as described herein and non-human framework sequences.
  • Non-human framework sequences include, in some embodiments, any sequence that can be used for generating synthetic heavy and/or light chain variable regions using one or more human CDR sequences as described herein, including, e.g., mammals, e.g., mouse, rat, rabbit, pig, bovine (e.g., cow, bull, buffalo), deer, sheep, goat, chicken, cat, dog, ferret, primate (e.g., marmoset, rhesus monkey), etc.
  • a provided antibody agent includes an antibody agent generated by grafting one or more human CDR sequences as described herein onto a non-human framework sequence (e.g., a mouse or chicken framework sequence).
  • provided antibody agents are human antibody agents (e.g., a human monoclonal antibody or fragment thereof, human antigen-binding protein or polypeptide, human multi-specific binding agent [e.g., a human bi-specific antibody], a human polypeptide having one or more structural components of a human immunoglobulin polypeptide).
  • human antibody agents e.g., a human monoclonal antibody or fragment thereof, human antigen-binding protein or polypeptide, human multi-specific binding agent [e.g., a human bi-specific antibody], a human polypeptide having one or more structural components of a human immunoglobulin polypeptide).
  • the anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprises an anti- GPC3 antibody moiety that specifically recognizes GPC3.
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 (referred to herein as "anti- nGPC3 antibody moiety").
  • the binding affinity of the anti-nGPC3 antibody moiety to nGPC3 is higher than that to an sGPC3.
  • the binding affinity of the anti-nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity.
  • the cell expressing GPC3 on its surface is HepG2, Hep3B, Huh7, JHH-7, or 293. In some embodiments, the cell presents on its surface abnormally high levels of GPC3.
  • the cell is a cancer cell. In some embodiments, the cancer cell is in a solid tumor (such as liver cancer, e.g. HCC). In some embodiments, the cancer cell is a metastatic cancer cell (such as metastatic HCC).
  • the anti-GPC3 antibody moiety specifically recognizes a soluble GPC3 (referred to herein as "anti-sGPC3 antibody moiety"). In some embodiments, the anti-GPC3 antibody moiety specifically recognizes both nGPC3 and sGPC3. Glypican 3 (GPC3)
  • Glypican 3 (GPC3) is an oncofetal antigen belonging to the heparin sulfate
  • GPC3 proteoglycan family existing on the surface of cells, which is involved in cell signaling at the cellular-extracellular matrix interface.
  • GPC3 is expressed in fetal liver and placenta during development and is down-regulated or silenced in normal adult tissues. This developmental stage- and tissue-specific expression manner suggests that GPC3 may be involved in
  • the GPC3 gene encodes a 70 kDa precursor protein of 580 amino acids.
  • the N-terminal signal peptide (SS; residues 1-24) and the C-terminal glycosylphosphatidylinositol (GPI) anchor addition signal (a predicted cleavage site: S 560 ) are removed and the latter is replaced with a GPI anchor.
  • the GPC3 precursor protein can be cleaved by Furin between Arg 358 and Ser 359 to generate a 40 kDa N- terminal subunit (Q 25 - R 358 ) and a 30 kDa C-terminal subunit (starting from S 359 ) linked by disulfide bonds.
  • the C-terminus of GPC3 links to the membrane through the GPI anchor and is post-translationally modified with two O-linked heparin sulfate (HS) side chains close to the cell surface.
  • HS heparin sulfate
  • the N- terminal and C-terminal subunits form the core protein of GPC3.
  • glycosaminoglycans can bind positively-charged growth factors, such as HGFs, fibroblast growth factors (FGFs), Wnts, Hedgehog and bone morphogenetic proteins.
  • HGFs fibroblast growth factors
  • FGFs fibroblast growth factors
  • the N-terminal subunit of GPC3 is an N-terminal peptide of GPC3 and of about 40 kDa, which is found in the soluble form of the GPC3 core protein.
  • the N- terminal subunit is a peptide of an amino acid sequence comprising from Met 1 to Arg 358 .
  • the N-terminal subunit is a peptide of an amino acid sequence comprising from Gin 25 to Arg 358 .
  • fragments of such N-terminal peptide may also be employed, referred to herein as GPC3 N-terminal fragment.
  • the anti-GPC3 antibody moiety specifically recognizes an epitope existing on the N-terminal subunit of the GPC3 protein.
  • the antibody moiety specifically recognizing the N- terminal subunit (or fragment thereof) of the GPC3 protein described herein specifically binds to the soluble format of GPC3.
  • the antibody moiety specifically recognizing the N-terminal subunit (or fragment thereof) of the GPC3 protein specifically binds to the native format of GPC3.
  • the antibody moiety specifically recognizing the N- terminal subunit (or fragment thereof) of the GPC3 protein can bind to both nGPC3 and sGPC3.
  • the C-terminal subunit of GPC3 is a C-terminal peptide of GPC3 and of about 30 kDa. Based on the cleavage site mentioned above, in some embodiments, the C-terminal subunit is a
  • the C-terminal subunit is a peptide of an amino acid sequence comprising from Ser 359 to Ser 560 .
  • fragments of such C-terminal peptide may also be employed, referred to herein as GPC3 C-terminal fragment.
  • the anti-GPC3 antibody moiety specifically recognizes an epitope existing on the C-terminal subunit of the GPC3 protein.
  • the antibody moiety specifically recognizing the C-terminal subunit (or fragment thereof) of the GPC3 protein described herein specifically binds to the soluble format of GPC3.
  • the antibody moiety specifically recognizing the C-terminal subunit (or fragment thereof) of the GPC3 protein specifically binds to the native format of GPC3. In some embodiments, the antibody moiety specifically recognizing the C-terminal subunit (or fragment thereof) of the GPC3 protein can bind to both nGPC3 and sGPC3.
  • the anti-GPC3 constructs described herein do not bind to the same epitope on GPC3 as known antibodies in the art, such as GC33 (Ishiguro et al., Cancer Res 2008; 68:9832-9838) (e.g., SEQ ID NO: 510).
  • the anti-GPC3 antibody moiety does not specifically bind to the same or substantially the same GPC3 epitope competitively with GC33.
  • the anti-GPC3 antibody moiety does not bind to an epitope within the amino acid sequence of SEQ ID NO: 536.
  • the anti-GPC3 antibody moiety does not bind to a fragment comprising the amino acid sequence of SEQ ID NO: 536.
  • GPC3 has been reported to be expressed in various cancers and, in particular, HCC, melanoma, lung squamous cell carcinoma, ovarian carcinoma, yolk sac tumor, choriocarcinoma, neuroblastoma, Wilms' tumor, and liposarcoma.
  • GPC3 may potentially serve as a therapeutic target for both antibody- and cell-based immunotherapy.
  • GPC3 is highly expressed in HCC, and is expressed in more than 70% of HCC tumors but not normal liver tissue, GPC3 can be a promising candidate for liver cancer therapy.
  • soluble format of GPC3 can be detected in the blood.
  • GPC3 soluble and native formats of GPC3 can both serve as useful biomarkers for cancer diagnosis, such as HCC diagnosis. It was found that GPC3 -positive HCC patients have a significantly lower 5-year survival rate than GPC3-negative HCC patients. GPC3 expression is therefore correlated with poor prognosis in HCC.
  • GPC3 cell surface localization is crucial for cell growth and Wnt activation in HCC.
  • GPC3 binds to Wnt through its core protein. It was hypothesized that GPC3 stimulates Wnt signaling by facilitating and/or stabilizing the interaction of Wnt with Frizzled (Fz), its signaling receptor. Interestingly, it was noted that approximately 50% of HCC patients have secreted GPC3 in the sera. However, it is unclear what form of GPC3 is present in the circulating blood of cancer patients. The extracellular lipase, Notum, may be responsible for cleaving GPC3 from tumor cells into the extracellular environment.
  • the anti-GPC3 antibody moiety described herein specifically recognizes an epitope within human GPC3.
  • the complete amino acid sequence of an exemplary human GPC3 has UniProt No. P51654 (SEQ ID NO: 460).
  • the anti-GPC3 antibody moiety specifically recognizes an epitope within human GPC3 comprising the amino acid sequence of SEQ ID NO: 460.
  • the anti-GPC3 antibody moiety specifically recognizes an epitope within amino acids 1-560 of SEQ ID NO: 460 (SEQ ID NO: 461).
  • the anti-GPC3 antibody moiety specifically recognizes an epitope within amino acids 25-580 of SEQ ID NO: 460 (SEQ ID NO: 462). In some embodiments, the anti-GPC3 antibody moiety specifically recognizes an epitope within amino acids 25-560 of SEQ ID NO: 460 (SEQ ID NO: 463). In some embodiments, the anti-GPC3 antibody moiety specifically recognizes an epitope within the N-terminal fragment of GPC3. In some embodiments, the anti-GPC3 antibody moiety specifically recognizes an epitope within amino acids 1-358 of SEQ ID NO: 460 (SEQ ID NO: 468).
  • the anti-GPC3 antibody moiety specifically recognizes an epitope within amino acids 25-358 of SEQ ID NO: 460 (SEQ ID NO: 464). In some embodiments, the anti-GPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3. In some
  • the anti-GPC3 antibody moiety specifically recognizes an epitope within amino acids 359-560 of SEQ ID NO: 460 (SEQ ID NO: 465). In some embodiments, the anti-GPC3 antibody moiety specifically recognizes an epitope within amino acids 359-580 of SEQ ID NO: 460 (SEQ ID NO: 466). In some embodiments, the anti-GPC3 antibody moiety specifically recognizes an epitope within GPC3 lacking heparin sulfate side chain. In some embodiments, the anti-GPC3 antibody moiety specifically recognizes an epitope within GPC3 carrying heparin sulfate side chain(s).
  • the anti-GPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain. In some embodiments, the anti-GPC3 antibody moiety specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467). In some embodiments, the anti- GPC3 antibody moiety specifically recognizes an epitope spanning the Furin cleavage site at amino acids R 358 /S 359 of SEQ ID NO: 460.
  • the anti-GPC3 antibody moiety can specifically bind to a full-length mature human GPC3 (e.g., amino acids 25-560 or 25-580 of SEQ ID NO: 460) but does not bind to an N-terminal fragment of human GPC3 (e.g., amino acids 25-358 of SEQ ID NO: 460) or to a C-terminal fragment of human GPC3 (e.g., amino acids 359-560 or 359-580 of SEQ ID NO: 460)
  • the anti-GPC3 antibody moiety specifically recognizes an epitope within a recombinant human GPC3.
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity.
  • the cell surface-bound GPC3 comprises (and in some embodiments consists of or consists essentially of) the amino acid sequence of SEQ ID NO: 460 or SEQ ID NO: 462.
  • the soluble GPC3 is circulating GPC3 protein or free GPC3 peptides in the serum.
  • the soluble GPC3 is a GPC3 protein or peptide present in a solution.
  • the soluble GPC3 comprises (and in some embodiments consists of or consists essentially of) the amino acid sequence of SEQ ID NO: 461 or SEQ ID NO: 463.
  • the anti-GPC3 antibody moiety may cross-react
  • the anti-GPC3 antibody moiety may be completely specific for one or more human GPC3 proteins and may not exhibit species or other types of non-human cross-reactivity.
  • the anti-GPC3 antibody moiety cross-reacts with at least one allelic variant of the GPC3 protein (or fragments thereof).
  • the allelic variant has up to about 30 (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, or 30) amino acid substitutions (such as a conservative substitution) when compared to the naturally occurring GPC3 (or fragments thereof).
  • the anti-GPC3 antibody moiety does not cross-react with any allelic variant of the GPC3 protein (or fragments thereof).
  • the anti-GPC3 antibody moiety cross-reacts with at least one interspecies variant of the GPC3 protein.
  • the GPC3 protein (or fragments thereof) is human GPC3 and the interspecies variant of the GPC3 protein (or fragments thereof) is a mouse or rat variant thereof.
  • the anti-GPC3 antibody moiety does not cross-react with any interspecies variant of the GPC3 protein.
  • the anti-GPC3 antibody moiety specifically recognizes GPC3 expressed on the cell surface of HepG2, Hep3B, Huh7, JHH-7, or 293 cells.
  • the anti-GPC3 antibody moiety specifically recognizes GPC3 expressed on the cell surface of a cancer cell (such as solid tumor).
  • the anti-GPC3 antibody moiety specifically recognizes GPC3 expressed on the cell surface of liver cancer (such as HCC), melanoma, lung squamous cell carcinoma, ovarian carcinoma, yolk sac tumor, choriocarcinoma, neuroblastoma, Wilms' tumor, hepatoblastoma, testicular nonseminomatous germ cell tumor, gastric carcinoma, or liposarcoma.
  • Binding affinity can be indicated by 3 ⁇ 4, K 0ff , K on , or K a .
  • K 0ff is intended to refer to the off-rate constant for dissociation of an antibody moiety from the antibody moiety/antigen complex, as determined from a kinetic selection set up.
  • K on is intended to refer to the on-rate constant for association of an antibody moiety to the antigen to form the antibody moiety/antigen complex.
  • equilibrium dissociation constant refers to the dissociation constant of a particular antibody moiety-antigen interaction, and describes the concentration of antigen required to occupy one half of all of the antibody -binding domains present in a solution of antibody molecules at equilibrium, and is equal to K 0ff /K on .
  • K d presupposes that all binding agents are in solution.
  • the corresponding equilibrium rate constant is expressed as EC 50 , which gives a good approximation of K d .
  • the affinity constant, K a is the inverse of the dissociation constant, K d .
  • the dissociation constant (K d ) is used as an indicator showing affinity of antibody moieties to antigens.
  • K d dissociation constant
  • easy analysis is possible by the Scatchard method using antibodies marked with a variety of marker agents, as well as by using BIACORE 1M (made by Amersham Biosciences), analysis of biomolecular interactions by surface plasmon resonance, according to the user's manual and attached kit.
  • the K d value that can be derived using these methods is expressed in units of M (Mols).
  • An antibody moiety that specifically binds to a target may have a K d of, for example, ⁇ 10 "7 M, ⁇ 10 "8 M, ⁇ 10 "9 M, ⁇ 10 "10 M, ⁇ 10 "11 M, ⁇ 10 "12 M, or ⁇ 10 "13 M.
  • Binding specificity of the antibody moiety can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to, Western blots, ELISA-, RIA-, ECL-, IRMA-, EIA-, BIACORETM -tests and peptide scans. In some embodiments, the binding affinity of the anti-GPC3 antibody moiety is measured by testing the binding affinity of the anti-GPC3 antibody moiety to cells expressing GPC3 on the surface (e.g., HepG2 cells).
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 (e.g., the binding affinity of the antibody moiety to the cell surface-bound GPC3 is higher than that to a soluble GPC3). In some embodiments, the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity. In some embodiments, the anti-nGPC3 antibody moiety specifically binds to a cell surface-bound GPC3 in a competitive binding assay with soluble GPC3 antigen, using e.g., flow cytometry.
  • the anti-nGPC3 antibody moiety specifically binds to a cell surface-bound GPC3 when the anti-nGPC3 antibody moiety has been pre-incubated with soluble GPC3 antigen in a competitive binding assay.
  • the anti-GPC3 construct comprising an anti-nGPC3 antibody moiety can be pre-incubated with various concentrations of soluble GPC3 antigen (e.g., a recombinant GPC3 fragment), then GPC3 + cells (e.g., HepG2 cells) can be added to the antibody/antigen mixture and incubated, cell surface-bound anti-GPC3 construct can then be detected: the binding of the soluble GPC3 pre-incubated anti-GPC3 construct to GPC3+ cells may not show significant differences when compared to that of anti-GPC3 construct to GPC3+ cells without soluble GPC3 pre-incubation, demonstrating that the anti-GPC3 antibody moiety can specifically recognize a cell surface
  • the anti-GPC3 antibody moiety specifically binds to a target GPC3 (e.g., nGPC3 and/or sGPC3) with a K d of about 10 "7 M to about 10 "13 M (such as about 10 " 7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • a target GPC3 e.g., nGPC3 and/or sGPC3
  • K d of about 10 "7 M to about 10 "13 M (such as about 10 " 7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the K d of the binding between the anti-nGPC3 antibody moiety and nGPC3, the K d of the binding between the anti-sGPC3 antibody moiety and sGPC3, or the K d of the binding between the anti-GPC3 antibody moiety and GPC3 is about 10 ⁇ 7 M to about 10 "13 M, about l lO "7 Mto about 5 10 "13 ⁇ , about 10 "7 Mto about 10 "12 M, about 10 "7 M to about 10 "U M, about 10 "7 M to about 10 "10 M, about 10 “7 M to about 10 "9 M, about 10 "8 M to about 10 "13 M, about l lO “8 Mto about 5 10 "13 ⁇ , about 10 "8 Mto about 10 "12 M, about 10 “8 M to about 10 "U M, about 10 “8 M to about 10 "10 M, about 10 “8 M to about 10 “9 M, about 5 ⁇ 10 "9 ⁇ to about lxl0 "
  • the K d of the binding between the anti-GPC3 antibody moiety and a non-target is more than the K d of the binding between the anti-GPC3 antibody moiety and the target, and is herein referred to in some embodiments as the binding affinity of the anti- GPC3 antibody moiety to the target (e.g., cell surface-bound GPC3) is higher than that to a non- target (e.g., soluble GPC3).
  • the non-target is an antigen that is not GPC3.
  • the non-target is a soluble GPC3.
  • the non-target is a cell surface-bound GPC3.
  • the K d of the binding between the anti-nGPC3 antibody moiety and a soluble GPC3 can be at least about 10 times, such as about 10-100 times, about 100-1000 times, about 10 3 -10 4 times, about 10 4 -10 5 times, about 10 5 -10 6 times, about 10 6 -10 7 times, about 10 7 - 10 8 times, about 10 8 -10 9 times, about 10 9 -10 10 times, about 10 10 -10 u times, or about 10 u -10 12 times of the K d of the binding between the anti-nGPC3 antibody moiety and a cell surface-bound GPC3.
  • the K d of the binding between the anti-sGPC3 antibody moiety and a cell surface-bound GPC3 can be at least about 10 times, such as about 10-100 times, about 100- 1000 times, about 10 3 -10 4 times, about 10 4 -10 5 times, about 10 5 -10 6 times, about 10 6 -10 7 times, about 10 7 -10 8 times, about 10 8 -10 9 times, about 10 9 -10 10 times, about 10 10 -10 u times, or about 10 u -10 12 times of the K d of the binding between the anti-sGPC3 antibody moiety and a soluble GPC3.
  • the K d of the binding between the anti-GPC3 antibody moiety (against nGPC3 and/or sGPC3) and a non-GPC3 target can be at least about 10 times, such as about 10-100 times, about 100-1000 times, about 10 3 -10 4 times, about 10 4 -10 5 times, about 10 5 - 10 6 times, about 10 6 -10 7 times, about 10 7 -10 8 times, about 10 8 -10 9 times, about 10 9 -10 10 times, about 10 10 -10 u times, or about 10 u -10 12 times of the K d of the binding between the anti-GPC3 antibody moiety and a target GPC3.
  • the K d of the binding between the anti-nGPC3 antibody moiety and a soluble GPC3 is at least about 10 times of the K d of the binding between the anti-nGPC3 antibody moiety and a cell surface-bound GPC3.
  • the anti-GPC3 antibody moiety binds to a non-target with a K d of about 10 _1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 " 5 M, or about 10 "2 M to about 10 "4 M).
  • the non-target is an antigen that is not GPC3.
  • the non-target is a soluble GPC3.
  • the non-target is a cell surface-bound GPC3.
  • the K d of the binding between the anti-GPC3 antibody moiety and a non-GPC3 target, the K d of the binding between the anti-nGPC3 antibody moiety and a soluble GPC3, or K d of the binding between the anti-sGPC3 antibody moiety and a cell surface-bound GPC3, is about 10 "1 M to about 10 "6 M, about 1 ⁇ 10 "1 M to about 5 10 "6 M, about 10 "1 M to about 10 "5 M, about 1 ⁇ 10 "1 M to about 5 10 "5 M, about 10 "1 M to about 10 "4 M, about 1 10 "1 M to about 5 ⁇ 10 "4 M, about 10 "1 M to about 10 "3 M, about 1 ⁇ 10 "1 M to about 5 ⁇ 10 "3 M, about 10 _1 M to about 10 "2 M, about 10 "2 M to about 10 "6 M, about 1 ⁇ 10 "2 ⁇ to about 5 ⁇ 10 "6 M, about 10 "2 M to about 10 "2 M to about 10
  • the K d of the binding between the anti-nGPC3 antibody moiety and a soluble GPC3 is about 10 "1 M to about 10 "6 M.
  • the anti-nGPC3 antibody moiety specifically recognizing a cell surface-bound GPC3 does not bind to a soluble GPC3.
  • the anti-GPC3 antibody moiety when refering to that the anti-GPC3 antibody moiety specifically recognizes a target GPC3 (e.g., cell surface-bound GPC3) at a high binding affinity and binds to a non-target (e.g., soluble GPC3) at a low binding affinity, the anti-GPC3 antibody moiety will bind to the target GPC3 (e.g., cell surface-bound GPC3) with a K d of about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M), and will bind to the non-target (e.g., soluble GPC3) with a K d of about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • a target GPC3
  • the binding affinity of the anti-GPC3 antibody moiety is compared to a control anti-GPC3 antibody, such as the monoclonal antibody GC33.
  • the K d of the binding between GC33 (e.g., SEQ ID NO: 510) and a cell surface-bound GPC3 can be at least about 2 times, such as about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 10-100 times, about 100-1000 times, about 10 3 -10 4 times, about 10 4 -10 5 times, about 10 5 -10 6 times, about 10 6 -10 7 times, about 10 7 -10 8 times, about 10 8 - 10 9 times, about 10 9 -10 10 times, about 10 10 -10 u times, or about 10 u -10 12 times of the K d of the binding between the anti-nGPC3 antibody moiety described herein and a cell surface-bound GPC3.
  • the K d of the anti-GPC3 construct to the cell surface-bound GPC3 is about 0.1 nM to about 2 nM, such as about 0.1 nM to about 0.5 nM, about 0.5 nM to about 1 nM, or about 1.5 to about 2 nM.
  • the K d of the binding between the anti- nGPC3 antibody moiety described herein and a soluble GPC3 can be at least about 2 times, such as about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 10-100 times, about 100-1000 times, about 10 3 -10 4 times, about 10 4 -10 5 times, about 10 5 -10 6 times, about 10 6 -10 7 times, about 10 7 -10 8 times, about 10 8 -10 9 times, about 10 9 -10 10 times, about 10 10 -10 u times, or about 10 u -10 12 times of the K d of the binding between GC33 (e.g., SEQ ID NO: 510) and a soluble GPC3.
  • GC33 e.g., SEQ ID NO: 510
  • the K d of the anti-GPC3 construct to the cell surface-bound GPC3 is about 10 nM to about 100 nM, such as about 10 nM to about 20 nM, about 20 nM to about 40 nM, about 40 nM to about 80 nM or about 80 nM to about 100 nM.
  • the IQ of the binding between a control anti-GPC3 antibody and a cell surface-bound GPC3 can be at least about 2 times, such as about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 10-100 times, about 100-1000 times, about 10 3 -10 4 times, about 10 4 -10 5 times, about 10 5 -10 6 times, about 10 6 -10 7 times, about 10 7 -10 8 times, about 10 8 -10 9 times, about 10 9 -10 10 times, about 10 10 -10 u times, or about 10 u -10 12 times of the K d of the binding between the anti-nGPC3 antibody moiety described herein and a cell surface-bound GPC3, wherein the control antibody comprises: i) a VH comprising the amino acid sequence of SEQ ID NO: 503, or a variant thereof having at least about 95% sequence identify to SEQ ID NO: 503; and ii) a VL comprising
  • the K d of the binding between the anti-nGPC3 antibody moiety described herein and a soluble GPC3 can be at least about 2 times, such as about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 10-100 times, about 100-1000 times, about 10 3 -10 4 times, about 10 4 -10 5 times, about 10 5 -10 6 times, about 10 6 -10 7 times, about 10 7 -10 8 times, about 10 8 -10 9 times, about 10 9 -10 10 times, about 10 10 - 10 11 times, or about 10 u -10 12 times of the K d of the binding between a control anti-GPC3 antibody and a soluble GPC3, wherein the control antibody comprises: i) a V H comprising the amino acid sequence of SEQ ID NO : 503, or a variant thereof having at least about 95% sequence identify to SEQ ID NO: 503; and ii) a VL comprising the amino
  • the K d of the binding between a control anti-GPC3 antibody and a cell surface-bound GPC3 can be at least about 2 times, such as about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 10-100 times, about 100-1000 times, about 10 3 -10 4 times, about 10 4 -10 5 times, about 10 5 -10 6 times, about 10 6 -10 7 times, about 10 7 -10 8 times, about 10 8 -10 9 times, about 10 9 - 10 10 times, about 10 10 -10 u times, or about 10 u -10 12 times of the K d of the binding between the anti-nGPC3 antibody moiety described herein and a cell surface-bound GPC3, wherein the control antibody comprises: i) a VH comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 497, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 498
  • the K D of the binding between the anti-nGPC3 antibody moiety described herein and a soluble GPC3 can be at least about 2 times, such as about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 10-100 times, about 100-1000 times, about 10 3 -10 4 times, about 10 4 -10 5 times, about 10 5 -10 6 times, about 10 6 -10 7 times, about 10 7 -10 8 times, about 10 8 -10 9 times, about 10 9 -10 10 times, about 10 10 -10 u times, or about 10 11 - 10 12 times of the K d of the binding between a control anti-GPC3 antibody and a soluble GPC3, wherein the control antibody comprises: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 497, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 498, and an HC-
  • the IC50 of a soluble GPC3 to compete binding between the anti-GPC3 construct and a cell surface-bound GPC3 is about 1 ⁇ g/ml to about 100 ⁇ g/ml, such as about 1 ⁇ g/ml to about 5 ⁇ g/ml, 1 ⁇ g/ml to about 10 ⁇ g/ml, about 10 ⁇ g/ml to about 20 ⁇ g/ml, about 20 ⁇ g/ml to about 50 ⁇ g/ml, or 50 ⁇ g/ml to about 100 ⁇ g/ml.
  • the IC50 of a soluble GPC3 to compete binding between the anti-GPC3 construct and a cell surface- bound GPC3 is at least about any one of 2x, 3x, 4x, 5x, lOx, 20x, 50x, lOOx, or more than the IC50 of a soluble GPC3 to compete binding between a control anti-GPC3 antibody (such as GC33) and the cell surface bound GPC3.
  • a control anti-GPC3 antibody such as GC33
  • the anti-GPC3 antibody moiety (against e.g., nGPC3 and/or sGPC3) described herein can be of any antibody or antigen-binding fragment format.
  • the anti-GPC3 antibody moiety (against e.g., nGPC3 and/or sGPC3) is a full-length antibody or immunoglobulin derivatives.
  • the anti- GPC3 antibody moiety is an antigen-binding fragment, for example an antigen-binding fragment selected from the group consisting of a Fab, a Fab', a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), or a single-chain Fv (scFv).
  • the anti-GPC3 antibody moiety is an scFv.
  • the anti-GPC3 antibody moiety is a Fab or Fab' .
  • the anti-GPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semi -synthetic.
  • the anti-GPC3 antibody moiety (against nGPC3 and/or sGPC3) is a semi-synthetic antibody moiety comprising fully human sequences and one or more synthetic regions.
  • the anti-GPC3 antibody moiety is a semi-synthetic antibody moiety comprising a fully human light chain variable domain and a semi -synthetic heavy chain variable domain comprising fully human FR1, HC-CDR1, FR2, HC-CDR2, FR3, and FR4 regions and a synthetic HC-CDR3.
  • the semi-synthetic heavy chain variable domain comprises a fully synthetic HC-CDR3 having a sequence from about 5 to about 25 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25) amino acids in length.
  • the semi-synthetic heavy chain variable domain or the synthetic HC-CDR3 is obtained from a semi-synthetic library (such as a semisynthetic human library) comprising fully synthetic HC-CDR3s having a sequence from about 5 to about 25 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25) amino acids in length, wherein each amino acid in the sequence is randomly selected from the standard human amino acids, minus cysteine.
  • the synthetic HC-CDR3 is from about 5 to about 19 (such as about any of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 or 19) amino acids in length.
  • the anti-GPC3 antibody moiety is a semi -synthetic antibody moiety comprising human CDRs and non-human framework sequences.
  • Non-human framework sequences include, in some embodiments, any sequence that can be used for generating synthetic heavy and/or light chain variable regions using one or more human CDR sequences as described herein, including, e.g., mammals, such as mouse, rat, rabbit, pig, bovine (e.g., cow, bull, buffalo), deer, sheep, goat, chicken, cat, dog, ferret, primate (e.g., marmoset, rhesus monkey), etc.
  • the anti-GPC3 antibody moiety is generated by grafting one or more human CDR sequences as described herein onto a non-human framework sequence (e.g., a mouse or chicken framework sequence).
  • the anti-GPC3 antibody moieties in some embodiments comprise specific sequences or certain variants of such sequences.
  • the amino acid substitutions in the variant sequences do not substantially reduce the ability of the anti-nGPC3 antibody moiety to specifically recognize a cell surface-bound GPC3, the ability of the anti-sGPC3 antibody moiety to specifically recognize soluble GPC3, or the ability of the anti-GPC3 antibody moiety to specifically recognize a target GPC3 (e.g., nGPC3 and/or sGPC3).
  • alterations that do not substantially reduce target GPC3 (e.g., nGPC3 and/or sGPC3) binding affinity may be made. Alterations that substantially improve target GPC3 binding affinity or affect some other property, such as specificity and/or cross-reactivity with related variants of the target GPC3, are also contemplated.
  • Exemplary antibody sequences are shown in Tables 6-9.
  • the exemplary CDR sequences in Tables 6 and 8 are predicted using the IgBLAST algorithm. See, for example, Ye J. et al. Nucleic Acids Research, 41 :W34-W40 (2013), the disclosure of which is incorporated herein by reference in its entirety.
  • IgBLAST IgBLAST algorithm
  • Anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 (anti-nGPC3 antibody moiety).
  • the binding affinity of the anti-nGPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity.
  • the anti-nGPC3 antibody moiety comprises i) a heavy chain variable domain (V H ) comprising an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain (V L ) comprising an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 256-286, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
  • V H heavy chain variable domain
  • V L light chain variable domain
  • the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; and ii) a V L comprising an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 256-286.
  • the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154-184, or a variant thereof comprising up to about 5 (such as about any of 1,
  • the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154-184, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of S
  • the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, an HC- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, and an HC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154-184, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 205-235, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 256-286; or a variant thereof comprising up to about 5 (
  • the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, an HC- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, and an HC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, wherein the amino acid substitutions are in HC-CDR1 or HC-CDR2; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154-184, an LC- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 205-235, and an LC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 256-2
  • the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, an HC- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, and an HC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154- 184, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 205-235, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 256-286.
  • the anti-nGPC3 antibody moiety comprises: a) V H comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, the amino acid sequence of any one of SEQ ID NOs: 52-82, and the amino acid sequence of any one of SEQ ID NOs: 103-133; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 154-184, the amino acid sequence of any one of SEQ ID NOs: 205-235, and the amino acid sequence of any one of SEQ ID NOs: 256-286.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising one, two or three CDRs of any one of SEQ ID NOs: 307-337, and b) a V L comprising one, two or three CDRs of any one of SEQ ID NOs: 358-388.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising HC-CDRl, HC-CDR2 and HC- CDR3 of the heavy chain variable domain of any one of SEQ ID NOs: 307-337, and b) a VL comprising LC-CDRl, LC-CDR2 and LC-CDR3 of the light chain variable domain of CDRs of any one of SEQ ID NOs: 358-388.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 307-337; and b) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 358-388.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337; and b) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388.
  • the anti-nGPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337, and the LC-CDRs of a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388.
  • the heavy and light chain variable domains can be combined in various pair-wise combinations to generate a number of anti-nGPC3 antibody moieties.
  • Exemplary anti-nGPC3 antibodies are provided in Tables 6 and 7.
  • GPC3A-045 11 GFTFSDYY 62 ISSSGSTI 113 ARASDLYGD 164 TSNIGTNT 215 SNN 266 AAWDDSLNGW
  • GPC3A-047 13 GYTFTGYY 64 INPNSGGT 115 ARSDYGSLYDK 166 RSNIASND 217 KKN 268 AAWDDNLSGYV
  • GPC3A-048 14 GFTFSSYA 65 ISYDGSNK 116 ARSSFVATDY 167 NIGSKS 218 YDS 269 QVWDSSSDRGV
  • GPC3A-049 15 GYTFTGYY 66 INPNSGGT 117 ARHGGIGSMRSFDQ 168 SSNIGSNY 219 RNN 270 AAWDDSLSG
  • GPC3A-050 16 GYSFTGYY 67 MNPRSGGT 118 ARSGYRWLDV 169 SSNIGSNT 220 SNN 271 AAWDDSLNGPV
  • GPC3A-051 17 GGAFSSYA 68 IIPIFGTA 119 ARMLYLSGRYYWDS 170 SSNIGAGYD 221 GNS 272 QSYDSSLSGYV
  • GPC3A-052 18 GYTFTGYY 69 INPNSGGT 120 ARSHSSGYDK 171 SSNIGSNY 222 RNN 273 AAWDDSLSGYV
  • GPC3A-054 20 GYTFTSYG 71 ISAYNGNT 122 ARIPMYSGSSDY 173 SSNIGSNY 224 RNN 275 AAWDDSLSGYV
  • GPC3A-055 21 GYTFTSYY 72 INPSGGST 123 ARWHGGPYDY 174 NIGSKS 225 YDS 276 QVWDSSSDHYV
  • GPC3A-056 22 GYSFNDYY 73 INPNNGDT 124 ARFSTHNWWWPTYDY 175 QSISSY 226 AAS 277 QQSYSTPIT
  • GPC3A-057 23 GFTFSSYA 74 ISGSGGST 125 ARYNYMSSGFYDR 176 NIGSKS 227 YDS 278 QVWDSSSDHW
  • GPC3A-058 24 GYTFASHG 75 ISPYTGNT 126 ARGKRTIASCFDY 177 NIGSKS 228 DDS 279 QVWDSSSDHV
  • GPC3A-059 25 GYTFTRYG 76 ISAYSDKT 127 ARSRWSYMDV 178 NIGSKS 229 YDS 280 QVWDSSSDHV
  • GPC3A-060 26 GYTFNSYA 77 ISAYNGNT 128 AREGYGSWAMDQ 179 NIGSES 230 DDD 281 QTWDSSTAI
  • GPC3A-061 27 GYTFTSYG 78 ISAYNGNT 129 ARKGSSQFDQ 180 NIGSKS 231 YDS 282 QVWDSSSDHYV
  • GPC3A-062 28 GGTFSSYA 79 IIPKIGTA 130 ARMYMDMGWGWGYWDW 181 SSNIGAGYD 232 GNS 283 QSYDSSLSGSYV
  • GPC3A-064 30 GYTFTIYG 81 ISPYNDNT 132 ARMGVGWGYAQDS 183 NIGSKS 234 DDT 285 QVWDRSSAHWV
  • GPC3A- 311 QVQLVQSGGGLVHPGGSLRLSCAGSGFTFSSY 362 SYVLTQPPSVSVAPGKTARITCGGNNIGSKS 039 AMHWVRQAPGKGLEWVSAIGTGGGTYYADSVK VHWYQQKPGQAPVLVIYYDSDRPSGIPERF
  • GPC3A- 312 QVQLVQSGAEVKKPGASVTVSCKASGYTFTGY 363 LPVLTQPPSASGTPGQRVTISCSGSSSNIGS 040 YMHWVRQAPGQGLEWMGWINPNSGGTNYAQ NYVYWYQQLPGTAPKLLIYSNNQRPSGVPD
  • GPC3A- 313 EVQLVQSGAEVKKPGASVKVSCKASGYTFTGY 364 QAVLTQPPSASQTPGQMVTISCSGTSSNIG 041 YMHWVRQAPGQGLEWMGWINPNSGGTNYAQ SNYVFWYQQLPGTAPKLLIYKNFQRPSGVP
  • GPC3A- 314 QVQLQQSGAEVKKPGASVKVSCKASGYSFTGY 365 SYVLTQPPSASGTPGQRVTISCFGSSSDIGS 042 YVYWMRQAPGKGLEWMGWMNPRSGGTNYAQ NSVFWYQQLPGAAPKLLIYSTQYRPSGVPD
  • GPC3A- 315 EVQLVQSGAEVKKPGATVKVSCKVSGYTFTDYY 366 QSVLTQPPSASGTPGQRVTISCSGSSSNIGT 043 MHWVQQAPGKGLEWMGLVDPEDGETIYAEKF NYVYWYQQLPGTAPKLIIYRNNQRPSGVPD
  • GPC3A- 316 QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGY 367 SYVLTQPPSVSVAPGKTARITCGGDNIGYKG 044 YWSWIRQPPGKGLEWIGEINHSGSTNYNPSLKS VHWYQQKPGQAPVLVVYDDSDRPSGIPER
  • GPC3A- 317 QMQLVQSGGGLVKPGGSLRLSCAASGFTFSDY 368 QSVLTQPPSVSGTPGQRVI ISCPGSTSNIGT 045 YMSWIRQAPGKGLEWVSYISSSGSTIYYADSVK NTVNWYQQFPGTAPKLLIYSNNQRPSGVPD
  • GPC3A- 320 EVQLVESGGGEVQPGRSLRLSCAASGFTFSSY 371 QPVLTQPPSVSVAPGKTARITCGGNNIGSKS 048 AMHWVRQAPGKGLEWVAVISYDGSNKYYADSV VHWYQQKPGQAPVLVIYYDSDRPSGIPERF
  • GPC3A- 321 QVQLVQSGAEVKEPGASVKVSCKASGYTFTGY 372 QAVLTQPSSASGTPGQRVTISCSGGSSNIG 049 YMHWVRQAPGQGLEWMGWINPNSGGTNYAQ SNYVYWYQQLPGTAPKLLIYRNNQRPSGVP
  • GPC3A- 322 QITLKESGAEVKKPGASVKVSCKASGYSFTGYY 373 QAVLTQPSSASGTPGQRVTISCSGSSSNIGS 050 VYWMRQAPGKGLEWMGWMNPRSGGTNYAQK NTVNWYQQLPGTAPKLLIYSNNQRPSGVPD
  • GPC3A- 324 EVQLVESGAEVKKPGASVKVSCKASGYTFTGYY 375 QAVLTQPSSASGTPGQRVTISCSGSSSNIGS 052 MHWVRQAPGQGLEWMGWINPNSGGTNYAQKF NYVYWYQQLSGTAPKLLIYRNNQRPSGVPD
  • GPC3A- 325 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSSY 376 QSVLTQPPSASAAPGQRVTISCSGTSSNIGS 053 YWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLKS NYVWWYQQLPGAAPRLLIYGNSNRPSGVP
  • GPC3A- 326 QMQLVQSGAEVKKPGASVKVSCKASGYTFTSY 377 SYELTQPPSASGTPGQRVTISCSGSSSNIGS 054 GISWVRQAPGQGLEWMGWISAYNGNTNYAQKL NYVYWYQQLPGTAPKLLIYRNNQRPSGVPD
  • GPC3A- 328 QVQLQQSGAEVKKFGASVKVSCKASGYSFNDY 379 DIQLTQSPSSLSASVGDRVTITCRASQSISSY 056 YIHWVRQAPGQGLEWMGWINPNNGDTKYEKK LNWYQQKPGKAPKLLIYAASSLQSGVPSRF
  • GPC3A- 329 EVQLVESGGGLIQPGGSLRLSCAASGFTFSSYA 380 EIVLTQSPSVSVAPGKTARITCGGNNIGSKS 057 MSWVRQAPGKGLEWVSAISGSGGSTYYADSVK VHWYQQKPGQAPVLVIYYDSDRPSGIPERF
  • GPC3A- 330 QVQLVQSGADVRKPGASVKVSCKASGYTFASH 381 QSVLTQPPSVSVAPGKTARITCGGNNIGSKS 058 GISWVRQAPGQGLEWLGWISPYTGNTNYAQKF VHWYQQKPGQAPVLVVYDDSDRPSGIPER
  • GPC3A- 331 QVQLVQSGAEVKKPGASVTVSCKASGYTFTRY 382 SYVLTQPPSVSVAPGKTARITCGGNNIGSKS 059 GITWVRQAPGQGLEWMGWISAYSDKTNYAQKL VYWYQQKPGQAPVLVIYYDSDRPSGIPERF
  • GPC3A- 332 QVQLVQSGGEVKKPGASVKVSCKASGYTFNSY 383 SYVLTQPPSVSVAPGKTARLTCGGNNIGSE 060 AISWVRQAPGQGLEWMGWISAYNGNTNYAQKL SVHWYQQKPGQAPLLVVYDDDDRPSGIPE
  • GPC3A- 333 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSY 384 QPVLTQPPSVSVAPGKTARITCGGNNIGSKS 061 GISWVRQTPGQGLEWMGWISAYNGNTNYAQKL VHWYQQKPGQAPVLVIYYDSDRPSGIPERF
  • GPC3A- 334 QMQLVQSGSELKKPGASVKVSCKASGGTFSSY 385 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGA 062 AISWVRQAPGQGLEWMGGIIPKIGTANYAQKFQ GYDVHWYQQLPGTAPKLLIYGNSNWPSGV
  • GPC3A- 335 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSY 386 QTVVTQPPSASGTPGQRVTISCSGSWSNIG 063 YMHWVRQAPGQGLEWMGI INPSGGSASYAQKF SYTVNWYQHLPGTAPKLLISGNNQRPSGVP
  • GPC3A- 336 QMQLVQSGAEVKKPGASVKVSCKASGYTFTIYG 387 LPVLTQPPSLSVAPGKTARLTCGGNN IGSKS 064 ISWVRQAPGQGLEWMGWISPYNDNTIYAQKVQ VHWYHQKPGQAPVLVVYDDTDRPSGIPERF
  • GPC3A- 337 EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSY 388 QSVLTQPPSVSVAPGKTARITCGGNNIGSKS 067 AISWVRQAPGQGLEWMGRIIPIFGITNYAQKFQG VHWYQQKPGQAPVLVIYYDSDRPSGIPERF
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 1, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 52, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 103, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDR
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 1, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 52, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 103; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 154, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 205, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 256; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 1, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 52, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 103; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 154, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 205, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 256.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 2, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 53, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 104, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 155, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 2, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 53, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 104; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 155, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 206, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 257; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 2, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 53, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 104; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 155, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 206, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 257.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 3, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 54, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 105, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 156, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDRl comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 3, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 54, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 105; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 156, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 207, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 258; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 3, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 54, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 105; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 156, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 207, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 258.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 4, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 55, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 106, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 157, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 4, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 55, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 106; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 157, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 208, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 259; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 4, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 55, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 106; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 157, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 208, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 259.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 5, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 56, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 107, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 158, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 5, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 56, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 107; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 158, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 209, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 260; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 5, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 56, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 107; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 158, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 209, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 260.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 6, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 57, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 108, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 159, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 6, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 57, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 108; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 159, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 210, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 261; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 6, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 57, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 108; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 159, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 210, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 261.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 7, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 58, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 109, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 160, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 7, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 58, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 109; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 160, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 211, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 262; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 7, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 58, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 109; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 160, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 211, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 262.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 8, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 59, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 110, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 161, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 8, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 59, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 110; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 161, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 212, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 263; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 8, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 59, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 110; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 161, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 212, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 263.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 9, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 60, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 111, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 162, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 9, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 60, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 111; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 162, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 213, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 264; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 9, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 60, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 111; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 162, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 213, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 264.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 10, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 61, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 112, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 163, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 10, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 61, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 112; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 163, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 214, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 265; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 10, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 61, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 112; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 163, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 214, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 265.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 11, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 62, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 113, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 164, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 11, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 62, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 113; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 164, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 215, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 266; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 11, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 62, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 113; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 164, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 215, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 266.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 12, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 63, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 114, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 165, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 12, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 63, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 114; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 165, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 216, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 267; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 12, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 63, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 114; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 165, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 216, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 267.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 13, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 64, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 115, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 166, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 13, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 64, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 115; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 166, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 217, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 268; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 13, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 64, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 115; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 166, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 217, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 268.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 14, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 65, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 116, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 167, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 14, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 65, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 116; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 167, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 218, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 269; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 14, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 65, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 116; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 167, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 218, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 269.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 66, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 117, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 168, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 15, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 66, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 117; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 168, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 219, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 270; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 15, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 66, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 117; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 168, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 219, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 270.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 67, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 118, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 169, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 16, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 67, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 118; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 169, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 220, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 271; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 16, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 67, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 118; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 169, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 220, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 271.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 68, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 119, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 170, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 17, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 68, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 119; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 170, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 221, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 272; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 17, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 68, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 119; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 170, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 221, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 272.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 18, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 69, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 120, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 171, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 18, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 69, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 120; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 171, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 222, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 273; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 18, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 69, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 120; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 171, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 222, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 273.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 19, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 70, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 121, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 172, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 19, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 70, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 121; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 172, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 223, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 274; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 19, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 70, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 121; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 172, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 223, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 274.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 20, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 71, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 122, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 173, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 20, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 71, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 122; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 173, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 224, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 275; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 20, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 71, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 122; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 173, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 224, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 275.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 21, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 72, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 123, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 174, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 21, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 72, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 123; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 174, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 225, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 276; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 21, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 72, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 123; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 174, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 225, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 276.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 22, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 73, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 124, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 175, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 22, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 73, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 124; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 175, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 226, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 277; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 22, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 73, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 124; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 175, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 226, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 277.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 23, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 74, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 125, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 176, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 23, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 74, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 125; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 176, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 227, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 278; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 23, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 74, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 125; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 176, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 227, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 278.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 24, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 75, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 126, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 177, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 24, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 75, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 126; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 177, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 228, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 279; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 24, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 75, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 126; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 177, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 228, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 279.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 25, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 76, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 127, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 178, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 25, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 76, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 127; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 178, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 229, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 280; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 25, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 76, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 127; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 178, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 229, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 280.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 26, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 77, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 128, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 179, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 26, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 77, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 128; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 179, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 230, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 281; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 26, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 77, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 128; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 179, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 230, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 281.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 27, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 78, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 129, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 180, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 27, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 78, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 129; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 180, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 231, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 282; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 27, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 78, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 129; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 180, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 231, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 282.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 28, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 79, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 130, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 181, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 28, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 79, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 130; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 181, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 232, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 283; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 28, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 79, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 130; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 181, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 232, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 283.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 29, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 80, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 131, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 29, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 80, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 131; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 182, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 233, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 284; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 29, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 80, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 131; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 182, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 233, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 284.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 30, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 81, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 132, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 183, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 30, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 81, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 132; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 183, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 234, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 285; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 30, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 81, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 132; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 183, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 234, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 285.
  • the anti-nGPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 31, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 82, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 133, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 184, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-nGPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 31, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 82, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 133; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 184, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 235, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 286; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-nGPC3 antibody moiety comprises i) a VH comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 31, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 82, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 133; and ii) a VL comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 184, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 235, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 286.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 307, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 307; and b) a VL comprising the amino acid sequence of SEQ ID NO : 358, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 358.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 307; and b) a VL comprising the amino acid sequence of SEQ ID NO: 358.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO : 307, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 358.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 308, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 308; and b) a VL comprising the amino acid sequence of SEQ ID NO : 359, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 359.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 308; and b) a VL comprising the amino acid sequence of SEQ ID NO: 359.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO : 308, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 359.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 309, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 309; and b) a V L comprising the amino acid sequence of SEQ ID NO: 360, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 360.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 309; and b) a V L comprising the amino acid sequence of SEQ ID NO: 360.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 309, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 360.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 310, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 310; and b) a VL comprising the amino acid sequence of SEQ ID NO: 361, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 361.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 3 10; and b) a VL comprising the amino acid sequence of SEQ ID NO: 361.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 310, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 361.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 31 1, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%)) sequence identity to SEQ ID NO: 31 1 ; and b) a VL comprising the amino acid sequence of SEQ ID NO: 362, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 362.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 3 1 1 ; and b) a VL comprising the amino acid sequence of SEQ ID NO: 362.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 31 1, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 362.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 312, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 312; and b) a V L comprising the amino acid sequence of SEQ ID NO: 363, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 363.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 3 12; and b) a V L comprising the amino acid sequence of SEQ ID NO: 363.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 312, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 363.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 313, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 313; and b) a VL comprising the amino acid sequence of SEQ ID NO: 364, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 364.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 3 13; and b) a VL comprising the amino acid sequence of SEQ ID NO: 364.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 313, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 364.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 314, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%)) sequence identity to SEQ ID NO: 314; and b) a VL comprising the amino acid sequence of SEQ ID NO: 365, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 365.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 3 14; and b) a VL comprising the amino acid sequence of SEQ ID NO: 365.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 314, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 365.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 315, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 315; and b) a V L comprising the amino acid sequence of SEQ ID NO: 366, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 366.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 3 15; and b) a V L comprising the amino acid sequence of SEQ ID NO: 366.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 315, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 366.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 316, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 316; and b) a VL comprising the amino acid sequence of SEQ ID NO: 367, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 367.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 3 16; and b) a VL comprising the amino acid sequence of SEQ ID NO: 367.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 316, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 367.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 317, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%)) sequence identity to SEQ ID NO: 317; and b) a VL comprising the amino acid sequence of SEQ ID NO: 368, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 368.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 3 17; and b) a VL comprising the amino acid sequence of SEQ ID NO: 368.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 317, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 368.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 318, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 318; and b) a V L comprising the amino acid sequence of SEQ ID NO: 369, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 369.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 3 18; and b) a V L comprising the amino acid sequence of SEQ ID NO: 369.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 318, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 369.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 319, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 319; and b) a VL comprising the amino acid sequence of SEQ ID NO: 370, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 370.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 3 19; and b) a VL comprising the amino acid sequence of SEQ ID NO: 370.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 319, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 370.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 320, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%)) sequence identity to SEQ ID NO: 320; and b) a VL comprising the amino acid sequence of SEQ ID NO: 371, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 371.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 320; and b) a VL comprising the amino acid sequence of SEQ ID NO: 371.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 320, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 371.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 321, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 321 ; and b) a V L comprising the amino acid sequence of SEQ ID NO: 372, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 372.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 321 ; and b) a V L comprising the amino acid sequence of SEQ ID NO: 372.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 321, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 372.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 322, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 322; and b) a VL comprising the amino acid sequence of SEQ ID NO: 373, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 373.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 322; and b) a VL comprising the amino acid sequence of SEQ ID NO: 373.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 322, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 373.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 323, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%)) sequence identity to SEQ ID NO: 323; and b) a VL comprising the amino acid sequence of SEQ ID NO: 374, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 374.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 323; and b) a VL comprising the amino acid sequence of SEQ ID NO: 374.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 323, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 374.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 324, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 324; and b) a V L comprising the amino acid sequence of SEQ ID NO: 375, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 375.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 324; and b) a V L comprising the amino acid sequence of SEQ ID NO: 375.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 324, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 375.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 325, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 325; and b) a VL comprising the amino acid sequence of SEQ ID NO: 376, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 376.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 325; and b) a VL comprising the amino acid sequence of SEQ ID NO: 376.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 325, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 376.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 326, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%)) sequence identity to SEQ ID NO: 326; and b) a VL comprising the amino acid sequence of SEQ ID NO: 377, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 377.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 326; and b) a VL comprising the amino acid sequence of SEQ ID NO: 377.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 326, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 377.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 327, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 327; and b) a V L comprising the amino acid sequence of SEQ ID NO: 378, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 378.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 327; and b) a V L comprising the amino acid sequence of SEQ ID NO: 378.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 327, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 378.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 328, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 328; and b) a VL comprising the amino acid sequence of SEQ ID NO: 379, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 379.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 328; and b) a VL comprising the amino acid sequence of SEQ ID NO: 379.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 328, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 379.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 329, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%)) sequence identity to SEQ ID NO: 329; and b) a VL comprising the amino acid sequence of SEQ ID NO: 380, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 380.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 329; and b) a VL comprising the amino acid sequence of SEQ ID NO: 380.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 329, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 380.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 330, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 330; and b) a V L comprising the amino acid sequence of SEQ ID NO: 381, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 381.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 330; and b) a V L comprising the amino acid sequence of SEQ ID NO: 381.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 330, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 381.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 331, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 331 ; and b) a VL comprising the amino acid sequence of SEQ ID NO: 382, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 382.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 331 ; and b) a VL comprising the amino acid sequence of SEQ ID NO: 382.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 331, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 382.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 332, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%)) sequence identity to SEQ ID NO: 332; and b) a VL comprising the amino acid sequence of SEQ ID NO: 383, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 383.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 332; and b) a VL comprising the amino acid sequence of SEQ ID NO: 383.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 332, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 383.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 333, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 333; and b) a V L comprising the amino acid sequence of SEQ ID NO: 384, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 384.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 333; and b) a V L comprising the amino acid sequence of SEQ ID NO: 384.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 333, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 384.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 334, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 334; and b) a VL comprising the amino acid sequence of SEQ ID NO: 385, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 385.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 334; and b) a VL comprising the amino acid sequence of SEQ ID NO: 385.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 334, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 385.
  • the anti-nGPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 335, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%)) sequence identity to SEQ ID NO: 335; and b) a VL comprising the amino acid sequence of SEQ ID NO: 386, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 386.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 335; and b) a VL comprising the amino acid sequence of SEQ ID NO: 386.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 335, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 386.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 336, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 336; and b) a V L comprising the amino acid sequence of SEQ ID NO: 387, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 387.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 336; and b) a V L comprising the amino acid sequence of SEQ ID NO: 387.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 336, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 387.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 337, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 337; and b) a V L comprising the amino acid sequence of SEQ ID NO: 388, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 388.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 337; and b) a V L comprising the amino acid sequence of SEQ ID NO: 388.
  • the anti-nGPC3 antibody moiety comprises the HC- CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 337, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 388.
  • the anti-nGPC3 antibody moiety competes for binding to a cell surface-bound GPC3 with a second anti-nGPC3 antibody moiety according to any of the anti- nGPC3 antibody moieties described herein. In some embodiments, the anti-nGPC3 antibody moiety binds to the same, or substantially the same, epitope as the second anti-nGPC3 antibody moiety.
  • binding of the anti-nGPC3 antibody moiety to a cell surface- bound GPC3 inhibits the binding of a second anti-nGPC3 antibody moiety to the same cell surface-bound GPC3 by at least about 70% (such as by at least about any of 75%, 80%, 85%, 90%, 95%, 98% or 99%), or vice versa.
  • the anti-nGPC3 antibody moiety and the second anti-nGPC3 antibody moiety cross-compete for binding to the cell surface-bound GPC3, i.e., each of the anti-nGPC3 antibody moieties competes with the other for binding to the cell surface-bound GPC3.
  • the anti-GPC3 antibody moiety specifically recognizes GPC3. In some embodiments, the anti-GPC3 antibody moiety specifically recognizes a cell surface- bound GPC3. In some embodiments, the anti-GPC3 antibody moiety specifically recognizes a soluble GPC3. In some embodiments, the binding affinity of the anti-sGPC3 antibody moiety to a soluble GPC3 is higher than that to a cell surface-bound GPC3. In some embodiments, the anti-sGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461.
  • the anti-sGPC3 antibody moiety specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467). In some embodiments, the anti-GPC3 antibody moiety specifically recognizes both cell surface- bound GPC3 and soluble GPC3.
  • the anti-GPC3 antibody moiety comprises i) a heavy chain variable domain (V H ) comprising an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a light chain variable domain (V L ) comprising an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 287-306, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions.
  • V H heavy chain variable domain
  • V L light chain variable domain
  • the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; and ii) a V L comprising an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 287-306.
  • the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83- 102, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 185-204, or a variant thereof comprising up to about 5 (such as about any of any of 1, 2, 3, 4, or
  • the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83- 102, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 185-204, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs:
  • the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, an HC- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, and an HC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 185-204, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 236-255, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 287-306; or a variant thereof comprising up to about
  • the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, an HC- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, and an HC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, wherein the amino acid substitutions are in HC-CDR1 or HC-CDR2; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 185-204, an LC- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 236-255, and an LC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 2
  • the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, an HC- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, and an HC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 185- 204, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 236-255, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 287-306.
  • the anti-GPC3 antibody moiety comprises: a) V H comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, the amino acid sequence of any one of SEQ ID NOs: 83-102, and the amino acid sequence of any one of SEQ ID NOs: 134-153; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 185-204, the amino acid sequence of any one of SEQ ID NOs: 236-255, and the amino acid sequence of any one of SEQ ID NOs: 287-306.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising one, two or three CDRs of any one of SEQ ID NOs: 338-357, and b) a V L comprising one, two or three CDRs of any one of SEQ ID NOs: 389-408.
  • the anti-nGPC3 antibody moiety comprises: a) a V H comprising HC-CDR1, HC-CDR2 and HC-CDR3 of the heavy chain variable domain of any one of SEQ ID NOs: 389-408, and b) a VL comprising LC- CDR1, LC-CDR2 and LC-CDR3 of the light chain variable domain of CDRs of any one of SEQ ID NOs: 358-388.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 338-357, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%), or 99%) sequence identity to any one of SEQ ID NOs: 338-357; and b) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 389-408, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 389-408.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 338-357; and b) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 389-408. [0245] In some embodiments, the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of any one of SEQ ID NOs: 338-357, and the LC-CDRs of a V L comprising the amino acid sequence of any one of SEQ ID NOs: 389-408.
  • the heavy and light chain variable domains can be combined in various pair-wise combinations to generate a number of anti-GPC3 antibody moieties.
  • Exemplary anti-GPC3 antibody moieties are provided in Tables 8 and 9.
  • GPC3B- 351 EVQLVQSGAEVKKPGASVKVSCKASGYTFSNYYM 402 QSVLTQPPSVSVSPGQTARITCSGETLAK 92 HWVRQAPGQGLEWMGIINPSGGTTTYAQKFQGR RYAHWYQQKPGQAPVLLIYRDTERPSGI
  • GPC3B- 352 EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYM 403 NFMLTQPHSVSESPGKTVTISCTGSSGSI 93 HWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGR ASNYVQWYQQRPGSAPTTVIYEDNQRPS
  • GPC3B- 353 EVQLVQSGAEVKKPGSSVKVSCQASGGTFTTYSI 404
  • QSVLTQPPSASGTPGQRVTVSCSGSSSN 110 NWVRQAPGQGLEWMGGIIPTFGTTNYAQNFQDR IGSNTVNWYQQLPGTAPKLLLYSSNQRP
  • GPC3B- 354 QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSM 405 SYELTQPPSASGTPGQRVTISCSGSSSNI 113 HWVRQAPGKGLEWMGGFDPEDGETIYAQKFQG GSNSVSWYQHLPGVAPKLLIYSNNQRPS
  • GPC3B- 355 QVQLVQSGAEVKRPGATIKVSCKTSGYTFTAYT 406 SYELTQPPSVSVAPGKTARITCGGNNIGS 115 HWVRQAPGQGLEWVGRINANTGGTDYAPKFRDR KSVHWYQQKPGQAPVLVVYDDSDRPSGI
  • GPC3B- 356 QVQLVQSGSELKKPGASVKVSCKASGYTFTSYAM 407 QSVVTQPPSVSAAPGQKVTISCSGSSSNI 119 NWVRQAPGQGLEWMGWINTNTGNPTYAQGFTG GNNYVSWYQQIPGTAPKLLIYDNNKRPS
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 32, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 83, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 134, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 185, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 32, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 83, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 134; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 185, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 236, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 287; or a variant
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 32, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 83, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 134; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 185, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 236, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 287.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 33, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 84, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 135, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 186, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 33, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 84, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 135; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 186, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 237, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 288; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 33, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 84, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 135; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 186, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 237, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 288.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 34, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 85, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 187, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 34, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 85, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 187, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 238, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 289; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 34, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 85, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 187, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 238, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 289.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 35, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 86, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 137, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 188, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 35, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 86, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 137; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 188, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 239, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 290; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 35, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 86, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 137; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 188, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 239, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 290.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 36, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 87, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 138, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 36, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 87, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 138; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 240, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 291; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 36, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 87, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 138; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 189, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 240, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 291.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 37, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDRl comprising the amino acid sequence of SEQ ID NO: 88, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 139, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 190, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 37, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 88, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 139; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 190, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 241, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 292; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 37, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 88, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 139; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 190, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 241, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 292.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 38, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 89, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 191, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 38, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 89, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 140; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 191, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 242, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 293; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2.
  • the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 38, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 89, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 140; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 191, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 242, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 293.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 39, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 90, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 141, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 192, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 39, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 90, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 141; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 192, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 243, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 294; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 39, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 90, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 141; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 192, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 243, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 294.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 40, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 91, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 142, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 193, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 40, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 91, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 142; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 193, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 244, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 295; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 40, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 91, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 142; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 193, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 244, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 295.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 41, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 92, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 143, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 194, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 41, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 92, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 143; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 194, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 245, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 296; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 41, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 92, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 143; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 194, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 245, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 296.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 42, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 93, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 144, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 195, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 42, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 144; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 195, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 246, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 297; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 42, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 144; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 195, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 246, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 297.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 43, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 94, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 196, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 43, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 94, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 196, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 247, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 298; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 43, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 94, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 196, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 247, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 298.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 44, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 95, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 146, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 197, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 44, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 95, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 146; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 197, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 248, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 299; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 44, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 95, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 146; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 197, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 248, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 299.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 45, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDRl comprising the amino acid sequence of SEQ ID NO: 96, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 198, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 45, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 96, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 198, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 249, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 300; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 45, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 96, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 198, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 249, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 300.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 46, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 97, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 148, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 199, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 46, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 97, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 148; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 199, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 250, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 301; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 46, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 97, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 148; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 199, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 250, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 301.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 47, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 98, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 149, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 200, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 47, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 149; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 200, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 251, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 302; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 47, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 149; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 200, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 251, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 302.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 48, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 99, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 150, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 201, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 48, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 99, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 150; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 201, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 252, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 303; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 48, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 99, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 150; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 201, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 252, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 303.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 49, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 100, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 151, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 202, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 49, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 100, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 151; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 202, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 253, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 304; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 49, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 100, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 151; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 202, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 253, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 304.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 50, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 101, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 152, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 203, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 50, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 101, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 152; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 203, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 254, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 305; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 50, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 101, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 152; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 203, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 254, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 305.
  • the anti-GPC3 antibody moiety comprises: i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 51, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of SEQ ID NO: 102, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 153, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 204, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an LC- CDR2 comprising the amino acid sequence of SEQ ID NO:
  • the anti-GPC3 antibody moiety comprises: (1) i) a V H comprising an HC-CDRl comprising the amino acid sequence of SEQ ID NO: 51, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 102, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 153; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of SEQ ID NO: 204, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 255, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 306; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the LC-CDR sequences.
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, the anti-GPC3 antibody moiety comprises i) a V H comprising an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 51, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 102, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 153; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 204, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 255, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 306.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 338, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 338; and b) a V L comprising the amino acid sequence of SEQ ID NO: 389, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 389.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 338; and b) a V L comprising the amino acid sequence of SEQ ID NO: 389.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 338, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 389.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 339, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 339; and b) a V L comprising the amino acid sequence of SEQ ID NO: 390, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 390.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 339; and b) a V L comprising the amino acid sequence of SEQ ID NO: 390.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 339, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 390.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 340, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 340; and b) a V L comprising the amino acid sequence of SEQ ID NO: 391, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 391.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 340; and b) a V L comprising the amino acid sequence of SEQ ID NO: 391.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 340, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 391.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 341, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 341; and b) a V L comprising the amino acid sequence of SEQ ID NO: 392, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 392.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 341; and b) a V L comprising the amino acid sequence of SEQ ID NO: 392.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 341, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 392.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 342, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 342; and b) a V L comprising the amino acid sequence of SEQ ID NO: 393, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 393.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 342; and b) a V L comprising the amino acid sequence of SEQ ID NO: 393.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 342, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 393.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 343, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 343; and b) a V L comprising the amino acid sequence of SEQ ID NO: 394, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 394.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 343; and b) a V L comprising the amino acid sequence of SEQ ID NO: 394.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 343, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 394.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 344, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 344; and b) a V L comprising the amino acid sequence of SEQ ID NO: 395, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 395.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 344; and b) a V L comprising the amino acid sequence of SEQ ID NO: 395.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 344, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 395.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 345, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 345; and b) a V L comprising the amino acid sequence of SEQ ID NO: 396, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 396.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 345; and b) a V L comprising the amino acid sequence of SEQ ID NO: 396.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 345, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 396.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 346, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 346; and b) a V L comprising the amino acid sequence of SEQ ID NO: 397, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 397.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 346; and b) a V L comprising the amino acid sequence of SEQ ID NO: 397.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 346, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 397.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 347, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 347; and b) a V L comprising the amino acid sequence of SEQ ID NO: 398, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 398.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 347; and b) a V L comprising the amino acid sequence of SEQ ID NO: 398.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 347, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 398.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 348, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 348; and b) a V L comprising the amino acid sequence of SEQ ID NO: 399, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 399.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 348; and b) a V L comprising the amino acid sequence of SEQ ID NO: 399.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 348, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 399.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 349, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 349; and b) a V L comprising the amino acid sequence of SEQ ID NO: 400, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 400.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 349; and b) a V L comprising the amino acid sequence of SEQ ID NO: 400.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 349, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 400.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 350, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 350; and b) a V L comprising the amino acid sequence of SEQ ID NO: 401, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 401.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 350; and b) a V L comprising the amino acid sequence of SEQ ID NO: 401.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 350, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 401.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 351, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 351; and b) a V L comprising the amino acid sequence of SEQ ID NO: 402, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 402.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 351; and b) a V L comprising the amino acid sequence of SEQ ID NO: 402.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 351, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 402.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 352, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 352; and b) a V L comprising the amino acid sequence of SEQ ID NO: 403, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 403.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 352; and b) a V L comprising the amino acid sequence of SEQ ID NO: 403.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 352, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 403.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 353, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 353; and b) a V L comprising the amino acid sequence of SEQ ID NO: 404, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 404.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 353; and b) a V L comprising the amino acid sequence of SEQ ID NO: 404.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 353, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 404.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 354, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 354; and b) a V L comprising the amino acid sequence of SEQ ID NO: 405, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 405.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 354; and b) a V L comprising the amino acid sequence of SEQ ID NO: 405.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 354, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 405.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 355, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 355; and b) a V L comprising the amino acid sequence of SEQ ID NO: 406, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 406.
  • the anti-GPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 355; and b) a VL comprising the amino acid sequence of SEQ ID NO: 406.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a V H comprising the amino acid sequence of SEQ ID NO: 355, and the LC-CDRs of a V L comprising the amino acid sequence of SEQ ID NO: 406.
  • the anti-GPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 356, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 356; and b) a VL comprising the amino acid sequence of SEQ ID NO: 407, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 407.
  • the anti-GPC3 antibody moiety comprises: a) a V H comprising the amino acid sequence of SEQ ID NO: 356; and b) a VL comprising the amino acid sequence of SEQ ID NO: 407.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 356, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 407.
  • the anti-GPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 357, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 357; and b) a VL comprising the amino acid sequence of SEQ ID NO: 408, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 408.
  • the anti-GPC3 antibody moiety comprises: a) a VH comprising the amino acid sequence of SEQ ID NO: 357; and b) a VL comprising the amino acid sequence of SEQ ID NO: 408.
  • the anti-GPC3 antibody moiety comprises the HC-CDRs of a VH comprising the amino acid sequence of SEQ ID NO: 357, and the LC-CDRs of a VL comprising the amino acid sequence of SEQ ID NO: 408.
  • the anti-GPC3 antibody moiety competes for binding to a target GPC3 (e.g., nGPC3 and/or sGPC3) with a second anti-GPC3 antibody moiety according to any of the anti-GPC3 antibody moieties described herein.
  • the anti- GPC3 antibody moiety binds to the same, or substantially the same, epitope as the second anti- GPC3 antibody moiety.
  • binding of the anti-GPC3 antibody moiety to the target GPC3 inhibits binding of the second anti-GPC3 antibody moiety to the target GPC3 by at least about 70% (such as by at least about any of 75%, 80%, 85%, 90%, 95%, 98% or 99%), or vice versa.
  • the anti-GPC3 antibody moiety and the second anti-GPC3 antibody moiety cross-compete for binding to the target GPC3, i.e., each of the anti-GPC3 antibody moieties competes with the other for binding to the target GPC3.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3, wherein the anti-nGPC3 antibody moiety can be any one of the anti- nGPC3 antibody moieties described herein.
  • an anti- GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing GPC3 ⁇ e.g., nGPC3 and/or sGPC3), wherein the anti-GPC3 antibody moiety can be any one of the anti-GPC3 antibody moieties described herein.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3 (referred to herein as "anti-nGPC3 antibody moiety"; e.g., the binding affinity of the antibody moiety to the cell surface-bound GPC3 is higher than that to a soluble GPC3, or the antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity).
  • anti-nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within human GPC3 comprising the amino acid sequence of SEQ ID NO: 460. In some embodiments, the anti- nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 462. In some embodiments,
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 463. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the N-terminal fragment of GPC3. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 1-358 of SEQ ID NO: 460 (SEQ ID NO: 468). In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 464. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3.
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 359-560 of SEQ ID NO: 460 (SEQ ID NO: 465). In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 359-580 of SEQ ID NO: 460 (SEQ ID NO: 466). In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467). In some embodiments, the anti-nGPC3 antibody moiety
  • the anti-nGPC3 antibody moiety can specifically bind to a full-length mature human GPC3 (e.g., amino acids 25-560 or 25-580 of SEQ ID NO: 460) but does not bind to an N-terminal fragment of human GPC3 (e.g., amino acids 25-358 of SEQ ID NO: 460) or to a C-terminal fragment of human GPC3 (e.g., amino acids 359-560 or 359-580 of SEQ ID NO: 460).
  • a full-length mature human GPC3 e.g., amino acids 25-560 or 25-580 of SEQ ID NO: 460
  • an N-terminal fragment of human GPC3 e.g., amino acids 25-358 of SEQ ID NO: 460
  • C-terminal fragment of human GPC3 e.g., amino acids 359-560 or 359-580 of SEQ ID NO: 460.
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-nGPC3 antibody moiety that competes for binding to nGPC3 with any one of the anti-GPC3 constructs described herein.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-nGPC3 antibody moiety that specifically binds to the same, or substantially the same, nGPC3 epitope competitively with any one of the anti-GPC3 constructs described herein.
  • the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293. In some embodiments, the GPC3 is expressed on the surface of a cancer cell (such as liver cancer cell, e.g., HCC).
  • the anti-GPC3 construct is non-naturally occurring. In some embodiments, the anti-GPC3 construct is a Fab, a Fab', a F(ab')2, an Fv, or an scFv. In some embodiments, the anti-GPC3 construct is a Fab or a Fab' . In some embodiments, the anti-GPC3 construct is an scFv.
  • the anti- GPC3 construct comprising an anti-GPC3 antibody moiety fused to an Fc fragment (e.g., IgGl Fc fragment) optionally via a linker.
  • the anti-GPC3 construct is a full- length antibody (e.g., monoclonal antibody).
  • the anti-GPC3 construct is a multi-specific (such as bispecific) molecule, such as tandem di-scFv anti-GPC3 T cell engager (tandem di-scFv anti-GPC3 xCD38).
  • the anti-GPC3 construct is a CAR.
  • the anti-GPC3 construct is a caTCR.
  • the anti- GPC3 construct is an immunoconjugate. In some embodiments, the anti-GPC3 construct is monospecific. In some embodiments, the anti-GPC3 construct is multispecific (e.g., bispecific). In some embodiments, the 3 ⁇ 4 of the binding between the anti-nGPC3 antibody moiety and nGPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 " M, or about 10 " M to about 10 " M).
  • the 3 ⁇ 4 of the binding between the anti-nGPC3 antibody moiety and an sGPC3 can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti- nGPC3 antibody moiety and nGPC3.
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 is about lO ⁇ M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the anti-nGPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semi-synthetic.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3, comprising: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDR1 comprising
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3, comprising: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154-184, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 205-235, and an LC-CDR
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3, comprising: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154-184, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3, comprising: i) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 307-337; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 358-388.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3, comprising: i) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3, comprising the HC-CDRs of a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337, and the LC-CDRs of a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-nGPC3 antibody moiety that competes for binding to nGPC3 with any one of the anti-GPC3 constructs described herein.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-nGPC3 antibody moiety that specifically binds to the same, or substantially the same, nGPC3 epitope competitively with any one of the anti-GPC3 constructs described herein.
  • the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293.
  • the GPC3 is expressed on the surface of a cancer cell (such as liver cancer cell, e.g., HCC).
  • the anti-GPC3 construct is non-naturally occurring.
  • the anti-GPC3 construct is a Fab, a Fab', a F(ab')2, an Fv, or an scFv. In some embodiments, the anti-GPC3 construct is a Fab or a Fab' . In some embodiments, the anti-GPC3 construct is an scFv. In some embodiments, the anti-GPC3 construct comprising an anti-GPC3 antibody moiety fused to an Fc fragment (e.g., IgGl Fc fragment) optionally via a linker. In some embodiments, the anti-GPC3 construct is a full-length antibody (e.g., monoclonal antibody).
  • the anti-GPC3 construct is a multi-specific (such as bispecific) molecule, such as tandem di-scFv anti-GPC3 T cell engager (tandem di-scFv anti-GPC3 > ⁇ CD38).
  • the anti-GPC3 construct is a CAR.
  • the anti-GPC3 construct is a caTCR.
  • the anti-GPC3 construct is an immunoconjugate.
  • the anti-GPC3 construct is monospecific.
  • the anti- GPC3 construct is multispecific (e.g., bispecific).
  • the K d of the binding between the anti-nGPC3 antibody moiety and nGPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-nGPC3 antibody moiety and nGPC3.
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 is about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the anti-nGPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semi -synthetic.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3).
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing GPC3, comprising: i) a VH comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of any one of
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing GPC3, comprising: i) a V H comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions in the HC-CDR sequences; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 185- 204, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 236-255, and an LC-CDR3 comprising
  • the amino acid substitutions are in HC-CDRl or HC-CDR2. In some embodiments, the amino acid substitutions are in LC-CDRl or LC-CDR2. In some embodiments, there is provided an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically
  • a V H comprising an HC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; and ii) a V L comprising an LC-CDRl comprising the amino acid sequence of any one of SEQ ID NOs: 185-204, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 236-255, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 287-306.
  • an anti- GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing GPC3, comprising: i) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 338-357, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 338-357; and ii) a VL comprising the amino acid sequence of any one of SEQ ID NOs: 389-408, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 389-408.
  • an anti- GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing GPC3, comprising: i) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 338-357; and ii) a VL comprising the amino acid sequence of any one of SEQ ID NOs: 389-408.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety specifically recognizing GPC3, comprising the HC-CDRs of a V H comprising the amino acid sequence of any one of SEQ ID NOs: 338-357, and the LC-CDRs of a VL comprising the amino acid sequence of any one of SEQ ID NOs: 389-408.
  • an anti- GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety that competes for binding to GPC3 (e.g., nGPC3 and/or sGPC3) with any one of the anti- GPC3 constructs described herein.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3 antibody moiety that specifically binds to the same, or substantially the same, GPC3 epitope competitively with any one of the anti-GPC3 constructs described herein.
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3.
  • the binding affinity of the anti-nGPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3.
  • the anti-nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity.
  • the anti-GPC3 antibody moiety specifically recognizes a soluble GPC3.
  • the binding affinity of the anti-sGPC3 antibody moiety to a soluble GPC3 is higher than that to a cell surface-bound GPC3.
  • the anti-sGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461. In some embodiments, the anti-sGPC3 antibody moiety specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467). In some embodiments, the anti-GPC3 antibody moiety specifically recognizes both cell surface-bound GPC3 and soluble GPC3. In some embodiments, the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293. In some embodiments, the GPC3 is expressed on the surface of a cancer cell (such as liver cancer cell, e.g., HCC).
  • a cancer cell such as liver cancer cell, e.g., HCC
  • the anti-GPC3 construct is non-naturally occurring. In some embodiments, the anti-GPC3 construct is a Fab, a Fab', a F(ab')2, an Fv, or an scFv. In some embodiments, the anti-GPC3 construct is a Fab or a Fab' . In some
  • the anti-GPC3 construct is an scFv.
  • the anti-GPC3 construct comprising an anti-GPC3 antibody moiety fused to an Fc fragment (e.g., IgGl Fc fragment) optionally via a linker.
  • the anti-GPC3 construct is a full-length antibody (e.g., monoclonal antibody).
  • the anti-GPC3 construct is a multi- specific (such as bispecific) molecule, such as tandem di-scFv anti-GPC3 T cell engager (tandem di-scFv anti-GPC3 > ⁇ CD38).
  • the anti-GPC3 construct is a CAR.
  • the anti-GPC3 construct is a caTCR. In some embodiments, the anti- GPC3 construct is an immunoconjugate. In some embodiments, the anti-GPC3 construct is monospecific. In some embodiments, the anti-GPC3 construct is multispecific (e.g., bispecific). In some embodiments, the K d of the binding between the anti-GPC3 antibody moiety and a target GPC3 (e.g., nGPC3 and/or sGPC3) is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • a target GPC3 e.g., nGPC3 and/or sGPC3
  • the K d of the binding between the anti-GPC3 antibody moiety and a non-target can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-GPC3 antibody moiety and the target GPC3.
  • the K d of the binding between the anti-GPC3 antibody moiety and a non-target is about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the anti-GPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semi -synthetic.
  • anti-GPC3 constructs (such as isolated anti-GPC3 constructs) in some embodiment
  • embodiments are scFvs (hereinafter referred to as "anti-GPC3 scFv") comprising an anti-GPC3 antibody moiety described herein (targeting e.g., nGPC3 and/or sGPC3).
  • the anti-GPC3 scFv specifically recognizes a cell surface-bound GPC3.
  • the anti-GPC3-scFv can comprise any one of the anti-GPC3 antibody moieties described herein (see “anti-GPC3 antibody moiety” section).
  • the anti-GPC3 scFv (targeting e.g., nGPC3 and/or sGPC3) can have the configuration of (from N-terminus to C-terminus) V L (GPC3)-L-V H (GPC3), or V H (GPC3)-L- V L (GPC3), wherein L is a linker (such as peptide linker).
  • the anti-GPC3 scFv is chimeric, human, partially humanized, fully humanized, or semi-synthetic. Exemplary anti-GPC3 scFv sequences are shown in Tables 10-11.
  • GPC3A-047 421 LPVLTQPPSASGTPGQRVTISCSGSRSNIASNDVYWYQQLPGTAPKRLIYKKNQRPSGVPDRFSASKS
  • GPC3A-048 422 QPVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGN
  • GPC3A-049 423 QAVLTQPSSASGTPGQRVTISCSGGSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKS
  • GPC3A-050 424 QAVLTQPSSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKS
  • GPC3A-051 425 QAVLTQPSSASGAPGQRVTISCTGGSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSK
  • GPC3A-052 426 QAVLTQPSSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLSGTAPKLLIYRNNQRPSGVPDRFSGSKS
  • GPC3A-053 427 QSVLTQPPSASAAPGQRVTISCSGTSSNIGSNYVWWYQQLPGAAPRLLIYGNSNRPSGVPDRFSGSKS
  • GPC3A-054 428 SYELTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKS
  • GPC3A-055 429 QPVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGN
  • GPC3A-056 430 DIQLTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGT
  • GPC3A-057 431 EIVLTQSPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNT
  • GPC3A-058 432 QSVLTQPPSVSVAPGKTARITCGGNN IGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGN
  • GPC3A-059 433 SYVLTQPPSVSVAPGKTARITCGGNN IGSKSVYWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNT
  • GPC3A-061 435 QPVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGN
  • GPC3A-062 436 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNWPSGVPDRFSGSK
  • GPC3A-063 437 QTVVTQPPSASGTPGQRVTISCSGSWSNIGSYTVNWYQHLPGTAPKLLISGNNQRPSGVPGRFSGSKS
  • GPC3A-064 438 LPVLTQPPSLSVAPGKTARLTCGGNNIGSKSVHWYHQKPGQAPVLVVYDDTDRPSGIPERFSGSNSGN
  • GPC3A-067 439 QSVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGN
  • GPC3B-54 440 QSVLTQPPSASGTPGQRVTISCSGSNSNIGSDTVNWYQQLPGTAPKLLIYRDNQRPSGVPDRFSGSKSGT
  • GPC3B-60 441 SYVLTQPPSVSVSPGQTATIACSGDNLENKFVYWYHQKPGQSPVLVMYEDNKRPSGIPERFSGSNSGNT
  • GPC3B-63 442 EIVLTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSG
  • GPC3B-66 443 QAVLTQPPSVSVAPGKTASITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTA
  • GPC3B-68 444 QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNIKRPSGIPDRFSGSKSGTS
  • GPC3B-71 445 SYVLTQPPSVSVAPGKTARVTCGGNN IGSKSVHWYQQKPGQAPVLVMYYDSDRPSGIPERFSGSNSGNT
  • GPC3B-76 446 QSVVTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGT
  • GPC3B-78 447 LPVLTQPPSVSVSPGQTASITCSGDKLGDKYAYWYQQKPGQSPVLVIYQDNKRPSGIPERFSGSNSGNTA
  • GPC3B-80 448 QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGT
  • GPC3B-81 449 SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTA
  • GPC3B-82 450 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGFDVHWYQQLPGTAPKLLIYDNNNRPSGVPDRFSGSKSD
  • GPC3B-85 451 QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGT
  • GPC3B-87 452 DVVMTQSPLSLPVTPGEPASVSCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSG
  • GPC3B-92 453 QSVLTQPPSVSVSPGQTARITCSGETLAKRYAHWYQQKPGQAPVLLIYRDTERPSGIPERFSGSSSGTTIT
  • GPC3B-93 454 NFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSS
  • GPC3B-110 455 QSVLTQPPSASGTPGQRVTVSCSGSSSNIGSNTVNWYQQLPGTAPKLLLYSSNQRPSGVPDRFSGSRSG
  • GPC3B-113 456 SYELTQPPSASGTPGQRVTISCSGSSSN IGSNSVSWYQHLPGVAPKLLIYSNNQRPSGVPDRFSGSKTGT
  • GPC3B-115 457 SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTA
  • GPC3B-119 458 QSVVTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQIPGTAPKLLIYDNNKRPSGIPDRFSGSRSGTS
  • GPC3B-125 459 QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWFQQHPGKAPKLI IYEVSNRPSGVSDRFSGSKSG
  • linker comprises the amino acid sequence of
  • the linker is or comprises a (GGGGS) n sequence (SEQ ID NO: 471), wherein n is equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more.
  • the linker comprises the amino acid sequence of TSGGGGS (SEQ ID NO: 474).
  • the linker comprises the amino acid sequence of GEGTSTGSGGSGGSGGAD (SEQ ID NO: 490).
  • an anti-GPC3 construct ⁇ e.g., isolated anti- GPC3 construct) comprising an scFv specifically recognizing a cell surface-bound GPC3
  • anti-nGPC3 scFv (referred to herein as "anti-nGPC3 scFv"; e.g., the binding affinity of the anti-nGPC3 scFv to the cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti-nGPC3 scFv specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity).
  • the anti-nGPC3-scFv e.g., the binding affinity of the anti-nGPC3 scFv to the cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti-nGPC3 scFv specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity.
  • the anti-nGPC3-scFv specifically recognizes an epitope within human GPC3 comprising the amino acid sequence of SEQ ID NO: 460.
  • the anti-nGPC3-scFv specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461.
  • the anti- nGPC3-scFv specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 462.
  • the anti-nGPC3-scFv specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 463.
  • the anti-nGPC3-scFv specifically recognizes an epitope within the N-terminal fragment of GPC3.
  • the anti-nGPC3-scFv specifically recognizes an epitope within amino acids 1-358 of SEQ ID NO: 460 (SEQ ID NO: 468). In some embodiments, the anti-nGPC3-scFv
  • the anti-nGPC3-scFv specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 464. In some embodiments, the anti-nGPC3-scFv specifically recognizes an epitope within the C-terminal fragment of GPC3. In some embodiments, the anti-nGPC3-scFv specifically recognizes an epitope within amino acids 359-560 of SEQ ID NO: 460 (SEQ ID NO: 465). In some
  • the anti-nGPC3-scFv specifically recognizes an epitope within amino acids 359- 580 of SEQ ID NO: 460 (SEQ ID NO: 466). In some embodiments, the anti-nGPC3-scFv specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain. In some embodiments, the anti-nGPC3-scFv specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467). In some embodiments, the anti-nGPC3-scFv specifically recognizes an epitope spanning the Furin
  • the anti- nGPC3-scFv can specifically bind to a full-length mature human GPC3 (e.g., amino acids 25- 560 or 25-580 of SEQ ID NO: 460) but does not bind to an N-terminal fragment of human GPC3 (e.g., amino acids 25-358 of SEQ ID NO: 460) or to a C-terminal fragment of human GPC3 (e.g., amino acids 359-560 or 359-580 of SEQ ID NO: 460).
  • a full-length mature human GPC3 e.g., amino acids 25- 560 or 25-580 of SEQ ID NO: 460
  • an N-terminal fragment of human GPC3 e.g., amino acids 25-358 of SEQ ID NO: 460
  • C-terminal fragment of human GPC3 e.g., amino acids 359-560 or 359-580 of SEQ ID NO: 460.
  • the anti-nGPC3-scFv specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-nGPC3-scFv (e.g., the binding affinity of the anti-nGPC3-scFv to the cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti-nGPC3-scFv specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity) that competes for binding to nGPC3 with any one of the anti-GPC3 constructs described herein.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-nGPC3-scFv (e.g., the binding affinity of the anti-nGPC3-scFv to the cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti-nGPC3-scFv specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity) that specifically binds to the same, or substantially the same, nGPC3 epitope competitively with any one of the anti-GPC3 constructs described herein.
  • an anti-nGPC3-scFv e.g., the binding affinity of the anti-nGPC3-scFv to the cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti-nGPC3-scFv specifically recognizes a cell surface-bound GPC3 at a high binding affinity
  • the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293. In some embodiments, the GPC3 is expressed on the surface of a cancer cell (such as liver cancer cell, e.g., HCC). In some embodiments, the anti- GPC3 construct is non-naturally occurring. In some embodiments, the K d of the binding between the anti-nGPC3-scFv and nGPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M). In some embodiments, the K d of the binding between the anti-nGPC3-scFv and nGPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to
  • the K d of the binding between the anti-nGPC3-scFv and an sGPC3 can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-nGPC3-scFv and nGPC3.
  • the K d of the binding between the anti-nGPC3-scFv and an sGPC3 is about 10 _1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the anti-nGPC3-scFv is chimeric, human, partially humanized, fully humanized, or semi-synthetic.
  • the VH of the anti-nGPC3-scFv is N-terminal to the VL of the anti-nGPC3-scFv.
  • the V H of the anti-nGPC3-scFv is C-terminal to the VL of the anti-nGPC3-scFv.
  • the linker between VH and VL of the anti- nGPC3-scFv comprises the amino acid sequence of SRGGGGSGGGGSGGGGSLEMA (SEQ ID NO: 473).
  • the linker between VH and VL of the anti-nGPC3-scFv is or comprises a (GGGGS) n sequence (SEQ ID NO: 471), wherein n is equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more.
  • the linker between VH and VL of the anti-nGPC3-scFv comprises the amino acid sequence of GEGTSTGSGGSGGSGGAD (SEQ ID NO: 490).
  • the anti-nGPC3 scFv further comprises a tag (e.g., a peptide tag for purification purpose).
  • the tag is N-terminal to the anti-nGPC3 scFv.
  • the tag is C-terminal to the anti-nGPC3 scFv. In some embodiments, the tag comprises a His-tag and an HA-tag. In some embodiments, the tag comprises the amino acid sequence of TSGQAGQHHHHHHGAYPYD VPDYAS (SEQ ID NO: 477).
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing a cell surface- bound GPC3.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing a cell surface-bound GPC3, comprising: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs:
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing a cell surface-bound GPC3, comprising: i) a VH comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154-184, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 205-235, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 256-286.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing a cell surface-bound GPC3, comprising: i) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing a cell surface-bound GPC3, comprising the HC- CDRs of a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337, and the LC-CDRs of a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-nGPC3-scFv that competes for binding to nGPC3 with any one of the anti-GPC3 constructs described herein.
  • an anti- GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-nGPC3-scFv that specifically binds to the same, or substantially the same, nGPC3 epitope competitively with any one of the anti-GPC3 constructs described herein.
  • the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293.
  • the GPC3 is expressed on the surface of a cancer cell (such as liver cancer cell, e.g., HCC).
  • the anti-GPC3 construct is non-naturally occurring.
  • the 3 ⁇ 4 of the binding between the anti-nGPC3-scFv and nGPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the 3 ⁇ 4 of the binding between the anti-nGPC3-scFv and an sGPC3 can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-nGPC3 antibody moiety and nGPC3.
  • the K d of the binding between the anti- nGPC3-scFv and an sGPC3 is about 10 -1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the anti-nGPC3-scFv is chimeric, human, partially humanized, fully humanized, or semi-synthetic.
  • the V H of the anti-nGPC3-scFv is N-terminal to the V L of the anti- nGPC3-scFv.
  • the V H of the anti-nGPC3-scFv is C-terminal to the V L of the anti-nGPC3-scFv.
  • the linker between V H and V L of the anti-nGPC3- scFv comprises the amino acid sequence of SRGGGGS GGGGS GGGGSLEM A (SEQ ID NO: 473).
  • the linker between VH and VL of the anti-nGPC3-scFv is or comprises a (GGGGS) n sequence (SEQ ID NO: 471), wherein n is equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more.
  • the linker between V H and V L of the anti-nGPC3-scFv comprises the amino acid sequence of GEGTSTGSGGSGGSGGAD (SEQ ID NO: 490).
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing a cell surface-bound GPC3, wherein the anti-nGPC3 scFv comprises the amino acid sequence of any one of SEQ ID NOs: 409-439.
  • the anti-nGPC3 scFv further comprises a tag (e.g., a peptide tag for purification purpose).
  • the tag is N-terminal to the anti-nGPC3 scFv. In some embodiments, the tag is C-terminal to the anti-nGPC3 scFv. In some embodiments, the tag comprises a His-tag and an HA-tag. In some embodiments, the tag comprises the amino acid sequence of TSGQAGQHHHHHHGAYPYDVPDYAS (SEQ ID NO: 477).
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3).
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising: i) a VH comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii)
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; and ii) a VL comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 185- 204, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 236-255, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 287
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising: i) a VH comprising the amino acid sequence of any one of SEQ ID NOs: 338-357; and ii) a VL comprising the amino acid sequence of any one of SEQ ID NOs: 389-408.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising the HC-CDRs of a VH comprising the amino acid sequence of any one of SEQ ID NOs: 338-357, and the LC-CDRs of a VL comprising the amino acid sequence of any one of SEQ ID NOs: 389-408.
  • GPC3 e.g., nGPC3 and/or sGPC3
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv that competes for binding to GPC3 (e.g., nGPC3 and/or sGPC3) with any one of the anti-GPC3 constructs described herein.
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv that specifically binds to the same, or substantially the same, GPC3 epitope competitively with any one of the anti-GPC3 constructs described herein.
  • the anti-GPC3-scFv specifically recognizes a cell surface-bound GPC3.
  • the binding affinity of the anti-GPC3-scFv to a cell surface-bound GPC3 is higher than that to a soluble GPC3.
  • the anti- GPC3-scFv specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity.
  • the anti-GPC3-scFv specifically recognizes a soluble GPC3.
  • the binding affinity of the anti- GPC3-scFv to a soluble GPC3 is higher than that to a cell surface-bound GPC3.
  • the anti-sGPC3-scFv specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461. In some embodiments, the anti-sGPC3-scFv specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467). In some embodiments, the anti-GPC3-scFv specifically recognizes both cell surface-bound GPC3 and soluble GPC3. In some embodiments, the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293.
  • the GPC3 is expressed on the surface of a cancer cell (such as liver cancer cell, e.g., HCC).
  • the anti-GPC3 construct is non-naturally occurring.
  • the K d of the binding between the anti-GPC3-scFv and a target GPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the K d of the binding between the anti-GPC3-scFv and a non-target can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-GPC3-scFv and the target GPC3.
  • the K d of the binding between the anti-GPC3-scFv and a non-target is about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the anti-GPC3-scFv is chimeric, human, partially humanized, fully humanized, or semi -synthetic.
  • the V H of the anti-GPC3-scFv is N-terminal to the V L of the anti-GPC3- scFv.
  • the V H of the anti-GPC3-scFv is C-terminal to the V L of the anti- GPC3-scFv.
  • the linker between V H and V L of the anti-GPC3-scFv comprises the amino acid sequence of SRGGGGS GGGGS GGGGSLEM A (SEQ ID NO: 473).
  • the linker between V H and V L of the anti-GPC3-scFv is or comprises a (GGGGS)n sequence (SEQ ID NO: 471), wherein n is equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more.
  • the linker between V H and V L of the anti-GPC3-scFv comprises the amino acid sequence of GEGTSTGSGGSGGSGGAD (SEQ ID NO: 490).
  • an anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprising an anti-GPC3-scFv specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), wherein the anti-GPC3 scFv comprises the amino acid sequence of any one of SEQ ID NOs: 440-459.
  • the anti-GPC3-scFv further comprises a tag (e.g., a peptide tag for purification purpose).
  • the tag is N-terminal to the anti-GPC3-scFv.
  • the tag is C-terminal to the anti-GPC3-scFv.
  • the tag comprises a His-tag and an HA-tag.
  • the tag comprises the amino acid sequence of TSGQAGQHHHHHHGAYPYD VPDYAS (SEQ ID NO: 477).
  • anti-GPC3 constructs (such as isolated anti-GPC3 constructs) in some embodiment
  • embodiments are Fc fusion proteins (hereinafter referred to as "anti-GPC3-Fc fusion protein") comprising an anti-GPC3 antibody moiety described herein fused to an Fc fragment (such as IgGl Fc fragment).
  • the anti-GPC3 antibody moiety is fused to an Fc fragment via a linker (such as peptide linker).
  • the anti-GPC3-Fc fusion protein comprises an antibody comprising an Fc fragment.
  • the anti- GPC3-Fc fusion protein is a full-length antibody. Any of the anti-GPC3 antibody moieties described in the "anti-GPC3 antibody moiety section" can be employed in the anti-GPC3 Fc fusion protein.
  • Fc region refers to a C-terminal non-antigen binding region of an immunoglobulin heavy chain that contains at least a portion of the constant region.
  • the term includes native Fc regions and variant Fc regions.
  • a human IgG heavy chain Fc region extends from Cys226 to the carboxyl-terminus of the heavy chain.
  • the C-terminal lysine (Lys447) of the Fc region may or may not be present, without affecting the structure or stability of the Fc region.
  • numbering of amino acid residues in the IgG or Fc region is according to the EU numbering system for antibodies, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
  • the Fc fragment comprises an immunoglobulin IgG heavy chain constant region comprising a hinge region (starting at Cys226), an IgG CH2 domain and CH3 domain.
  • the term "hinge region” or “hinge sequence” as used herein refers to the amino acid sequence located between the linker and the CH2 domain.
  • the fusion protein comprises an Fc fragment comprising a hinge region.
  • the hinge region comprises the amino acid sequence CPPCP (SEQ ID NO: 478), a sequence found in the native IgGl hinge region, to facilitate dimerization.
  • the Fc fragment of the fusion protein starts at the hinge region and extends to the C-terminus of the IgG heavy chain.
  • the fusion protein comprises an Fc fragment that does not comprise the hinge region.
  • the fusion protein comprises an Fc fragment selected from the group consisting of Fc fragments from IgG, IgA, IgD, IgE, IgM, and combinations and hybrids thereof.
  • the Fc fragment is derived from a human IgG.
  • the Fc fragment comprises the Fc region of human IgGl, IgG2, IgG3, IgG4, or a combination or hybrid IgG.
  • the Fc fragment is an IgGl Fc fragment.
  • the Fc fragment comprises the CH2 and CH3 domains of IgGl .
  • the Fc fragment is an IgG4 Fc fragment.
  • the Fc fragment comprises the CH2 and CH3 domains of IgG4.
  • IgG4 Fc is known to exhibit less effector activity than IgGl Fc, and thus may be desirable for some applications.
  • the Fc fragment is derived from of a mouse immunoglobulin.
  • the IgG CH2 domain starts at Ala231. In some embodiments, the CH3 domain starts at Gly341. It is understood that the C-terminus Lys residue of human IgG can be optionally absent. It is also understood that conservative amino acid substitutions of the Fc region without affecting the desired structure and/or stability of Fc is contemplated within the scope of the invention.
  • anti-GPC3-Fc fusion proteins comprising any of the Fc variants described below, or combinations thereof, are contemplated.
  • the Fc fragment comprises sequence that has been altered or otherwise changed so that it has enhanced antibody dependent cellular cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC) effector function.
  • ADCC antibody dependent cellular cytotoxicity
  • CDC complement dependent cytotoxicity
  • each chain of the Fc fragment is fused to the same entity.
  • the anti-GPC3-Fc fusion protein comprises two identical anti-GPC3 antibody moieties described herein (specifically recognizing e.g., nGPC3 and/or sGPC3), each fused with one chain of the Fc fragment. In some embodiments, the two chains of the Fc fragment are identical.
  • the anti-GPC3-Fc fusion protein (including anti- GPC3-Fc fusion proteins comprising an antibody) comprising the Fc fragment is a homodimer.
  • each chain of the Fc fragment is fused to a different entity.
  • the fusion protein comprises two different anti-GPC3 antibody moieties, each fused to one chain of the Fc fragment.
  • the two anti-GPC3 antibody moieties are different but both specifically recognize nGPC3.
  • the two anti-GPC3 antibody moieties are different but both specifically recognize sGPC3.
  • one anti-GPC3 antibody moiety specifically recognizes nGPC3, and the other anti-GPC3 antibody moiety specifically recognizes sGPC3.
  • the anti- GPC3-Fc fusion protein is monovalent, i.e., only one anti-GPC3 antibody moiety is fused to one chain of the Fc fragment, and the second chain of the Fc fragment is not fused to an anti-GPC3 antibody moiety.
  • the anti-GPC3-Fc fusion protein (including anti-GPC3- Fc fusion proteins comprising an antibody) comprising the Fc fragment is a heterodimer.
  • Heterodimerization of non-identical polypeptides in the anti-GPC3-Fc fusion protein can be facilitated by methods known in the art, including without limitation, heterodimerization by the knob-into-hole technology.
  • the structure and assembly method of the knob-into-hole technology can be found in, e.g., US5,821,333, US7,642,228, US 201 1/0287009 and PCT/US2012/059810, hereby incorporated by reference in their entireties.
  • one chain of the Fc fragment in the fusion protein comprises a knob
  • the second chain of the Fc fragment comprises a hole
  • the preferred residues for the formation of a knob are generally naturally occurring amino acid residues and are preferably selected from arginine (R), phenylalanine (F), tyrosine (Y) and tryptophan (W). Most preferred are tryptophan and tyrosine.
  • the original residue for the formation of the knob has a small side chain volume, such as alanine, asparagine, aspartic acid, glycine, serine, threonine or valine.
  • substitutions in the CH3 domain for forming the knob include without limitation the T366W, T366Y or F405W substitution.
  • the preferred residues for the formation of a hole are usually naturally occurring amino acid residues and are preferably selected from alanine (A), serine (S), threonine (T) and valine (V).
  • the original residue for the formation of the hole has a large side chain volume, such as tyrosine, arginine, phenylalanine or tryptophan.
  • Exemplary amino acid substitutions in the CH3 domain for generating the hole include without limitation the T366S, L368A, F405A, Y407A, Y407T and Y407V substitutions.
  • the knob comprises T366W substitution
  • the hole comprises the T366S/L368A/Y 407V substitutions. It is understood that other modifications to the Fc region known in the art that facilitate heterodimerization are also contemplated and encompassed by the instant application.
  • anti-GPC3 Fc fusion protein variants such as variants of isolated anti-GPC3-Fc fusion protein, e.g., a full-length anti-GPC3 antibody variant
  • variants described herein e.g., Fc variants, effector function variants, glycosylation variants, cysteine engineered variants
  • anti-GPC3 variants See "anti-GPC3 variants" section for all applicable variations for the anti-GPC3 Fc fusion protein (e.g., full-length anti- GPC3 antibody).
  • the anti-GPC3-Fc fusion proteins described herein comprise an anti-GPC3 antibody moiety described herein fused to an Fc fragment via a linker.
  • the length, the degree of flexibility and/or other properties of the linker used in the anti-GPC3-Fc fusion proteins may have some influence on properties, including but not limited to the affinity, specificity or avidity for the anti-GPC3 antibody moiety, and/or one or more particular antigens or epitopes of the anti-GPC3-Fc fusion protein (such as an antibody comprising an Fc fragment and an anti-GPC3 antibody moiety).
  • longer linkers may be selected to ensure that two adjacent antibody moieties do not sterically interfere with one another.
  • a linker (such as peptide linker) comprises flexible residues (such as glycine and serine) so that the adjacent antibody moieties are free to move relative to each other.
  • a glycine-serine doublet can be a suitable peptide linker.
  • the linker is a non-peptide linker.
  • the linker is a peptide linker.
  • the linker is a non-cleavable linker.
  • the linker is a cleavable linker.
  • linker considerations include the effect on physical or pharmacokinetic properties of the resulting anti-GPC3-Fc fusion protein, such as solubility, lipophilicity, hydrophilicity, hydrophobicity, stability (more or less stable as well as planned degradation), rigidity, flexibility, immunogenicity, modulation of antibody moiety binding, the ability to be incorporated into a micelle or liposome, and the like.
  • any one or all of the linkers described herein can be accomplished by any chemical reaction that will bind the two molecules so long as the components or fragments retain their respective activities, i.e. binding to target GPC3 ⁇ e.g., nGPC3 and/or sGPC3), binding to FcR, or ADCC/CDC.
  • This linkage can include many chemical mechanisms, for instance covalent binding, affinity binding, intercalation, coordinate binding and complexation.
  • the binding is covalent binding.
  • Covalent binding can be achieved either by direct condensation of existing side chains or by the incorporation of external bridging molecules.
  • Many bivalent or polyvalent linking agents are useful in coupling protein molecules, such as an Fc fragment to the anti-GPC3 antibody moiety of the present invention.
  • representative coupling agents can include organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes and hexamethylene diamines.
  • organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes and hexamethylene diamines.
  • non-peptide linkers used herein include: (i) EDC (l-ethyl-3-(3-dimethylamino-propyl) carbodiimide hydrochloride; (ii) SMPT (4-succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pridyl-dithio)- toluene (Pierce Chem.
  • linkers described above contain components that have different attributes, thus leading to anti-GPC3-Fc fusion proteins with differing physio-chemical properties.
  • sulfo-NHS esters of alkyl carboxylates are more stable than sulfo-NHS esters of aromatic carboxylates.
  • NHS-ester containing linkers are less soluble than sulfo-NHS esters.
  • the linker SMPT contains a sterically hindered disulfide bond, and can form fusion protein with increased stability.
  • Disulfide linkages are in general, less stable than other linkages because the disulfide linkage is cleaved in vitro, resulting in less fusion protein available.
  • Sulfo-NHS in particular, can enhance the stability of carbodimide couplings.
  • Carbodimide couplings (such as EDC) when used in conjunction with sulfo-NHS, forms esters that are more resistant to hydrolysis than the carbodimide coupling reaction alone.
  • any one or all of the linkers described herein can be peptide linkers.
  • the peptide linker may have a naturally occurring sequence, or a non-naturally occurring sequence.
  • a sequence derived from the hinge region of heavy chain only antibodies may be used as the linker. See, for example, WO 1996/34103.
  • the peptide linker comprises the amino acid sequence of CPPCP (SEQ ID NO: 478), a sequence found in the native IgGl hinge region.
  • the peptide linker can be of any suitable length.
  • the peptide linker is at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more amino acids (aa) long.
  • the peptide linker is no more than about any of 100, 75, 50, 40, 35, 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5 or fewer amino acids long.
  • the length of the peptide linker is any of about 1 aa to about 10 aa, about 1 aa to about 20 aa, about 1 aa to about 30 aa, about 5 aa to about 15 aa, about 10 aa to about 25 aa, about 5 aa to about 30 aa, about 10 aa to about 30 aa, about 30 aa to about 50 aa, about 50 aa to about 100 aa, or about 1 aa to about 100 aa.
  • peptide linker does not comprise any polymerization activity.
  • the characteristics of a peptide linker, which comprise the absence of the promotion of secondary structures, are known in the art and described, e.g., in Dall'Acqua et al. (Biochem. (1998) 37, 9266-9273), Cheadle et al. (Mol Immunol (1992) 29, 21-30) and Raag and Whitlow (FASEB (1995) 9(1), 73-80).
  • a particularly preferred amino acid in context of the "peptide linker” is Gly.
  • peptide linkers that also do not promote any secondary structures are preferred.
  • the linkage of the molecules to each other can be provided by, e.g., genetic engineering.
  • Methods for preparing fused and operatively linked antibody constructs and expressing them in mammalian cells or bacteria are well-known in the art ⁇ e.g. WO 99/54440, Ausubel, Current Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N. Y. 1989 and 1994 or Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N. Y., 2001).
  • the peptide linker is a stable linker, which is not cleavable by protease, such as by Matrix metalloproteinases (MMPs).
  • MMPs Matrix metalloproteinases
  • the peptide linker tends not to adopt a rigid three-dimensional structure, but rather provide flexibility to a polypeptide (e.g., first and/or second components), such as providing flexibility between the anti-GPC3 antibody moiety and the Fc fragment.
  • the peptide linker is a flexible linker.
  • Exemplary flexible linkers include glycine polymers (G) n , glycine-serine polymers (including, for example, (GS) n (SEQ ID NO: 469), (GSGGS)n (SEQ ID NO: 470), (GGGGS) n (SEQ ID NO: 471), and (GGGS) n (SEQ ID NO: 472), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between components.
  • an anti-GPC3-Fc fusion protein can include linkers that are all or partially flexible, such that the linker can include a flexible linker portion as well as one or more portions that confer less flexible structure to provide a desired fusion protein structure.
  • the anti-GPC3 antibody moiety and the Fc fragment are linked together by a linker of sufficient length to enable the anti-GPC3-Fc fusion protein to fold in such a way as to permit binding to target GPC3 (e.g., nGPC3 and/or sGPC3), as well as to FcR.
  • the linker comprises the amino acid sequence of
  • the linker is or comprises a (GGGGS) n sequence (SEQ ID NO: 471), wherein n is equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more.
  • the linker comprises the amino acid sequence of TSGGGGS (SEQ ID NO: 474).
  • the linker comprises the amino acid sequence of GEGTSTGSGGSGGSGGAD (SEQ ID NO: 490).
  • Natural linkers adopt various conformations in secondary structure, such as helical, ⁇ - strand, coil/bend and turns, to exert their functions.
  • Linkers in an a-helix structure might serve as rigid spacers to effectively separate protein domains, thus reducing their unfavorable interactions.
  • Non-helical linkers with Pro-rich sequence could increase the linker rigidity and function in reducing inter-domain interference.
  • the anti-GPC3 antibody moiety specifically recognizing e.g., nGPC3 and/or sGPC3
  • the Fc fragment or an antibody comprising an Fc fragment
  • the anti-GPC3 construct (such as an isolated anti-GPC3 construct) is an anti-GPC3-Fc fusion protein comprising an anti-GPC3 antibody moiety fused to an Fc fragment (such as IgGl Fc fragment) optionally via a linker (such as peptide linker).
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3.
  • the binding affinity of the anti-nGPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3.
  • the anti- nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity. In some embodiments, the anti- GPC3 antibody moiety specifically recognizes a soluble GPC3. In some embodiments, the binding affinity of the anti-sGPC3 antibody moiety to a soluble GPC3 is higher than that to a cell surface-bound GPC3. In some embodiments, the anti-GPC3 antibody moiety specifically recognizes both cell surface-bound GPC3 and soluble GPC3.
  • the anti- GPC3 antibody moiety (targeting e.g., nGPC3 and/or sGPC3) is a Fab, a Fab', an Fc, or an scFv.
  • the anti-GPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semi-synthetic.
  • the anti-GPC3-Fc fusion protein is a full-length antibody.
  • the full-length anti-GPC3 antibody is a monoclonal antibody.
  • the anti-GPC3-Fc fusion protein (such as a full-length anti- GPC3 antibody) is monospecific.
  • the anti-GPC3-Fc fusion protein is monovalent. In some embodiments, the anti-GPC3-Fc fusion protein (such as a full-length anti- GPC3 antibody) is multivalent. In some embodiments, the anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) is multispecific.
  • the linker comprises the amino acid sequence of (GGGGS) n (SEQ ID NO: 471), wherein n is equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. In some embodiments, the linker comprises the amino acid sequence of CPPCP (SEQ ID NO: 478).
  • an anti-GPC3-Fc fusion protein comprising: a) an anti-GPC3 antibody moiety specifically recognizing a cell surface- bound GPC3 (e.g., the binding affinity of the anti-GPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity); and b) an Fc fragment.
  • an anti-GPC3 antibody moiety specifically recognizing a cell surface- bound GPC3 (e.g., the binding affinity of the anti-GPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity); and b) an Fc
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within human GPC3 comprising the amino acid sequence of SEQ ID NO: 460. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 462. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 463. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the N-terminal fragment of GPC3.
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 1-358 of SEQ ID NO: 460 (SEQ ID NO: 468). In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 464. In some embodiments, the anti- nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 359-560 of SEQ ID NO: 460 (SEQ ID NO: 465). In some
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 359-580 of SEQ ID NO: 460 (SEQ ID NO: 466). In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467). In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope spanning the Furin cleavage site at amino acids R /S of SEQ ID NO: 460.
  • the anti-nGPC3 antibody moiety can specifically bind to a full-length mature human GPC3 (e.g., amino acids 25-560 or 25-580 of SEQ ID NO: 460) but does not bind to an N-terminal fragment of human GPC3 (e.g., amino acids 25-358 of SEQ ID NO: 460) or to a C- terminal fragment of human GPC3 (e.g., amino acids 359-560 or 359-580 of SEQ ID NO: 460).
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain.
  • an anti-GPC3-Fc fusion protein comprising: a) an anti-nGPC3 antibody moiety that competes for binding to nGPC3 with any one of the anti-GPC3 constructs described herein (e.g., the binding affinity of the anti-GPC3 antibody moiety to a cell surface- bound GPC3 is higher than that to a soluble GPC3, or the anti-GPC3 antibody moiety
  • an anti-GPC3-Fc fusion protein comprising an anti-nGPC3 antibody moiety that specifically binds to the same, or substantially the same, nGPC3 epitope competitively with any one of the anti-GPC3 constructs described herein (e.g., the binding affinity of the anti-GPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti- GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity); and b) an Fc fragment.
  • the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293. In some embodiments, the GPC3 is expressed on the surface of a cancer cell (such as liver cancer cell, e.g., HCC).
  • the anti- nGPC3 antibody moiety and the Fc fragment are connected via a linker (such as peptide linker).
  • the linker comprises the amino acid sequence of (GGGGS) n (SEQ ID NO: 471), wherein n is equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more.
  • the linker comprises the amino acid sequence of CPPCP (SEQ ID NO: 478).
  • the Fc fragment comprises an IgGl Fc sequence.
  • the Fc fragment comprises a human IgGl Fc sequence.
  • the Fc fragment comprises a mouse IgGl Fc sequence.
  • the anti-GPC3-Fc fusion protein is a full-length antibody.
  • the full-length anti-GPC3 antibody is a monoclonal antibody.
  • the anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) is monospecific.
  • the anti-GPC3-Fc fusion protein is monovalent. In some embodiments, the anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) is multivalent. In some embodiments, the anti-GPC3-Fc fusion protein (such as a full-length anti- GPC3 antibody) is multispecific. In some embodiments, the anti-nGPC3 antibody moiety is a Fab or a Fab' . In some embodiments, the anti-nGPC3 antibody moiety is an scFv. In some embodiments, the anti-GPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semi-synthetic.
  • the K d of the binding between the anti- nGPC3 antibody moiety and nGPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-nGPC3 antibody moiety and nGPC3.
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 is about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • an anti-GPC3-Fc fusion protein comprising: a) an anti-nGPC3 antibody moiety comprising: i) a VH comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a VL comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs:
  • an anti-GPC3-Fc fusion protein comprising: a) an anti-nGPC3 antibody moiety comprising: i) a VH comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154-184, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 205-235, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 256-286; and b) an Fc fragment.
  • an anti-GPC3-Fc fusion protein comprising: a) an anti-nGPC3 antibody moiety comprising: i) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388; and b) an Fc fragment.
  • an anti-GPC3-Fc fusion protein comprising: a) an anti-nGPC3 antibody moiety comprising: i) the HC-CDRs of a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337; and ii) the LC-CDRs of a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388; and b) an Fc fragment.
  • an anti-GPC3-Fc fusion protein comprising a) an anti-nGPC3 antibody moiety that competes for binding to nGPC3 with any one of the anti-GPC3 constructs described herein; and b) an Fc fragment.
  • an anti-GPC3-Fc fusion protein comprising a) an anti-nGPC3 antibody moiety that specifically binds to the same, or
  • the K d of the binding between the anti-nGPC3 antibody moiety and nGPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-nGPC3 antibody moiety and nGPC3.
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 is about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the anti-nGPC3 antibody moiety and the Fc fragment are connected via a linker (such as peptide linker).
  • the linker comprises the amino acid sequence of (GGGGS) n (SEQ ID NO: 471), wherein n is equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more.
  • the linker comprises the amino acid sequence of CPPCP (SEQ ID NO: 478).
  • the Fc fragment comprises an IgGl Fc sequence.
  • the Fc fragment comprises a human IgGl Fc sequence.
  • the Fc fragment comprises a mouse IgGl Fc sequence.
  • the anti-GPC3-Fc fusion protein is a full-length antibody. In some embodiments, the full-length anti-GPC3 antibody is a monoclonal antibody. In some embodiments, the anti- GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) is monospecific. In some embodiments, the anti-GPC3-Fc fusion protein is monovalent. In some embodiments, the anti- GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) is multivalent. In some embodiments, the anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) is multispecific.
  • the anti-nGPC3 antibody moiety is a Fab or a Fab'. In some embodiments, the anti-nGPC3 antibody moiety is an scFv. In some embodiments, the anti- nGPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semisynthetic.
  • the anti-GPC3-Fc fusion protein (such as a full-length anti- GPC3 antibody) comprising an anti-nGPC3 antibody moiety competes for binding to a cell surface-bound GPC3 with a second anti-GPC3-Fc fusion protein (such as a second full-length anti-GPC3 antibody) comprising an anti-nGPC3 antibody moiety according to any of the anti- GPC3-Fc fusion proteins (such as a full-length anti-GPC3 antibody) described herein.
  • a second anti-GPC3-Fc fusion protein such as a second full-length anti-GPC3 antibody
  • the anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) comprising an anti-nGPC3 antibody moiety binds to the same, or substantially the same, epitope as the second anti-GPC3-Fc fusion protein (such as a second full-length anti-GPC3 antibody) comprising an anti-nGPC3 antibody moiety.
  • binding of the anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) comprising an anti-nGPC3 antibody moiety to the cell surface-bound GPC3 inhibits binding of the second anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) comprising an anti-nGPC3 antibody moiety to the same cell surface-bound GPC3 by at least about 70% (such as by at least about any of 75%, 80%, 85%, 90%, 95%, 98% or 99%), or vice versa.
  • the anti-GPC3- Fc fusion protein (such as a full-length anti-GPC3 antibody) comprising an anti-nGPC3 antibody moiety and the second anti-GPC3-Fc fusion protein (such as a second full-length anti-GPC3 antibody) comprising an anti-nGPC3 antibody moiety cross-compete for binding to the cell surface-bound GPC3, i.e., each of the anti-GPC3-Fc fusion proteins (such as full-length anti- GPC3 antibodies) competes with the other for binding to the cell surface-bound GPC3.
  • each of the anti-GPC3-Fc fusion proteins (such as full-length anti- GPC3 antibodies) competes with the other for binding to the cell surface-bound GPC3.
  • an anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety specifically recognizing GPC3 ⁇ e.g., nGPC3 and/or sGPC3), comprising: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3,
  • an anti-GPC3-Fc fusion protein comprising: a) an anti-GPC3 antibody moiety specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; and ii) a VL comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 185-204, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 236-255, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 287-306; and b
  • an anti-GPC3-Fc fusion protein comprising: a) an anti-GPC3 antibody moiety specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising: i) a VH comprising the amino acid sequence of any one of SEQ ID NOs: 338-357; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 389-408; and b) an Fc fragment.
  • GPC3 e.g., nGPC3 and/or sGPC3
  • an anti-GPC3-Fc fusion protein comprising: a) an anti-GPC3 antibody moiety specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising: i) the HC-CDRs of a VH comprising the amino acid sequence of any one of SEQ ID NOs: 338-357; and ii) the LC-CDRs of a V L comprising the amino acid sequence of any one of SEQ ID NOs: 389-408; and b) an Fc fragment.
  • GPC3 e.g., nGPC3 and/or sGPC3
  • an anti-GPC3-Fc fusion protein comprising a) an anti-GPC3 antibody moiety that competes for binding to GPC3 (e.g., nGPC3 and/or sGPC3) with any one of the anti-GPC3 constructs described herein; and b) an Fc fragment.
  • an anti-GPC3-Fc fusion protein comprising a) an anti-GPC3 antibody moiety that specifically binds to the same, or substantially the same, GPC3 epitope competitively with any one of the anti-GPC3 constructs described herein; and b) an Fc fragment.
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3. In some embodiments, the binding affinity of the anti-nGPC3 antibody moiety to a cell surface- bound GPC3 is higher than that to a soluble GPC3. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity. In some embodiments, the anti-GPC3 antibody moiety specifically recognizes a soluble GPC3. In some embodiments, the binding affinity of the anti-sGPC3 antibody moiety to a soluble GPC3 is higher than that to a cell surface-bound GPC3. In some embodiments, the anti-sGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461. In some embodiments, the binding affinity of the anti-nGPC3 antibody moiety to a cell surface- bound GPC3 is higher than that to a soluble GPC
  • the anti-sGPC3 antibody moiety specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467). In some embodiments, the anti-GPC3 antibody moiety specifically recognizes both cell surface-bound GPC3 and soluble GPC3. In some embodiments, the K d of the binding between the anti-GPC3 antibody moiety and target GPC3 (e.g., nGPC3 and/or sGPC3) is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • target GPC3 e.g., nGPC3 and/or sGPC3
  • the K d of the binding between the anti-GPC3 antibody moiety and non-target can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-GPC3 antibody moiety and target GPC3.
  • 10 times such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times
  • the K d of the binding between the anti-GPC3 antibody moiety and non-target is about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the anti-GPC3 antibody moiety and the Fc fragment are connected via a linker (such as peptide linker).
  • the linker comprises the amino acid sequence of (GGGGS) n (SEQ ID NO: 471), wherein n is equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more.
  • the linker comprises the amino acid sequence of CPPCP (SEQ ID NO: 478).
  • the Fc fragment comprises an IgGl Fc sequence. In some embodiments, the Fc fragment comprises a human IgGl Fc sequence. In some embodiments, the Fc fragment comprises a mouse IgGl Fc sequence.
  • the anti-GPC3-Fc fusion protein is a full-length antibody. In some embodiments, the full-length anti-GPC3 antibody is a monoclonal antibody. In some embodiments, the anti- GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) is monospecific. In some embodiments, the anti-GPC3-Fc fusion protein is monovalent.
  • the anti- GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) is multivalent. In some embodiments, the anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) is multispecific. In some embodiments, the anti-GPC3 antibody moiety is a Fab or a Fab' . In some embodiments, the anti-GPC3 antibody moiety is an scFv. In some embodiments, the anti-GPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semi-synthetic.
  • the anti-GPC3-Fc fusion protein (such as a full-length anti- GPC3 antibody) comprising an anti-GPC3 antibody moiety competes for binding to a target GPC3 (e.g., nGPC3 and/or sGPC3) with a second anti-GPC3-Fc fusion protein (such as a second full-length anti-GPC3 antibody) comprising an anti-GPC3 antibody moiety according to any of the anti-GPC3-Fc fusion proteins (such as a full-length anti-GPC3 antibody) described herein.
  • a target GPC3 e.g., nGPC3 and/or sGPC3
  • a second anti-GPC3-Fc fusion protein such as a second full-length anti-GPC3 antibody
  • the anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) comprising an anti-GPC3 antibody moiety binds to the same, or substantially the same, epitope as the second anti-GPC3-Fc fusion protein (such as a second full-length anti-GPC3 antibody) comprising an anti-GPC3 antibody moiety.
  • binding of the anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) comprising an anti-GPC3 antibody moiety to the target GPC3 (e.g., nGPC3 and/or sGPC3) inhibits binding of the second anti- GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) comprising an anti-GPC3 antibody moiety to the target GPC3 by at least about 70% (such as by at least about any of 75%, 80%, 85%, 90%, 95%, 98% or 99%), or vice versa.
  • the target GPC3 e.g., nGPC3 and/or sGPC3
  • the anti-GPC3-Fc fusion protein (such as a full-length anti-GPC3 antibody) comprising an anti-GPC3 antibody moiety and the second anti-GPC3-Fc fusion protein (such as a second full-length anti-GPC3 antibody) comprising an anti-GPC3 antibody moiety cross-compete for binding to the target GPC3 (e.g., nGPC3 and/or sGPC3), i.e., each of the anti-GPC3-Fc fusion proteins (such as full- length anti-GPC3 antibodies) competes with the other for binding to the target GPC3.
  • the target GPC3 e.g., nGPC3 and/or sGPC3
  • a full-length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3 (e.g., the binding affinity of the anti-GPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti- GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity); and b) an Fc fragment.
  • an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3 (e.g., the binding affinity of the anti-GPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti- GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3
  • the Fc fragment comprises an IgGl Fc sequence (e.g., human or mouse IgGl Fc sequence).
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within human GPC3 comprising the amino acid sequence of SEQ ID NO: 460.
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461.
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 462.
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 463.
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within the N-terminal fragment of GPC3. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 1-358 of SEQ ID NO: 460 (SEQ ID NO: 468). In some embodiments, the anti- nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 464. In some embodiments, the anti-nGPC3 antibody moiety specifically
  • the anti- nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3.
  • the anti- nGPC3 antibody moiety specifically recognizes an epitope within amino acids 359-560 of SEQ ID NO: 460 (SEQ ID NO: 465).
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 359-580 of SEQ ID NO: 460 (SEQ ID NO: 466).
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain.
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467). In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope spanning the Furin cleavage site at amino
  • the anti-nGPC3 antibody moiety can specifically bind to a full-length mature human GPC3 (e.g., amino acids 25-560 or 25-580 of SEQ ID NO: 460) but does not bind to an N-terminal fragment of human GPC3 (e.g., amino acids 25-358 of SEQ ID NO: 460) or to a C-terminal fragment of human GPC3 (e.g., amino acids 359-560 or 359-580 of SEQ ID NO: 460.
  • a full-length mature human GPC3 e.g., amino acids 25-560 or 25-580 of SEQ ID NO: 460
  • an N-terminal fragment of human GPC3 e.g., amino acids 25-358 of SEQ ID NO: 460
  • C-terminal fragment of human GPC3 e.g., amino acids 359-560 or 359-580 of SEQ ID NO: 460.
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain.
  • a full-length anti-GPC3-Fc fusion protein comprising: a) an anti-nGPC3 antibody moiety that competes for binding to nGPC3 with any one of the anti-GPC3 constructs described herein (e.g., the binding affinity of the anti-GPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity); and b) an Fc fragment.
  • a full-length anti-GPC3-Fc fusion protein comprising a) an anti-nGPC3 antibody moiety (e.g., the binding affinity of the anti-GPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti- GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity) that specifically binds to the same, or substantially the same, nGPC3 epitope competitively with any one of the anti-GPC3 constructs described herein; and b) an Fc fragment.
  • an anti-nGPC3 antibody moiety e.g., the binding affinity of the anti-GPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti- GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to
  • the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293. In some embodiments, the GPC3 is expressed on the surface of a cancer cell (such as liver cancer cell, e.g., HCC).
  • the full-length anti-GPC3 antibody is non-naturally occurring. In some embodiments, the full-length anti-GPC3 antibody is monoclonal. In some embodiments, the full-length anti-GPC3 antibody is monospecific. In some embodiments, the full-length anti-GPC3 antibody is multispecific (e.g., bispecific).
  • the K4 of the binding between the anti-nGPC3 antibody moiety and nGPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-nGPC3 antibody moiety and nGPC3.
  • the K d of the binding between the anti- nGPC3 antibody moiety and an sGPC3 is about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the anti-nGPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semi-synthetic.
  • the full-length anti-GPC3 antibody comprises a mouse IgGl heavy cahin constant domain (CH) comprising the amino acid sequence of SEQ ID NO: 507.
  • the full-length anti-GPC3 antibody comprises a mouse ⁇ light cahin constant domain (C L ) comprising the amino acid sequence of SEQ ID NO: 508.
  • C L light cahin constant domain
  • the full-length anti-GPC3 antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 505, and a light chain comprising the amino acid sequence of SEQ ID NO: 506.
  • the heavy and/or light chain of the full-length anti-GPC3 antibody optionally comprises an N-terminal signal peptide.
  • the signal peptide comprises the amino acid seqeuence of SEQ ID NO: 509.
  • a full-length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3, comprising: i) a V H comprising an HC- CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and ii) a V L
  • a full-length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3, comprising: i) a V H comprising an HC- CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154- 184, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 205-235, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 256-286; and b) an anti-GPC3 antibody mo
  • a full-length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3, comprising: i) a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337; and ii) a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388.
  • a full-length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety specifically recognizing a cell surface-bound GPC3, comprising the HC-CDRs of a V H comprising the amino acid sequence of any one of SEQ ID NOs: 307-337, and the LC-CDRs of a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358-388.
  • a full-length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety that specifically binds to a cell surface-bound GPC3 competitively with any of the anti-GPC3 constructs described herein; and an Fc fragment.
  • a full-length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising an anti-nGPC3 antibody moiety that specifically binds to the same, or substantially the same, nGPC3 epitope competitively with any one of the anti-GPC3 constructs described herein; and an Fc fragment.
  • the Fc fragment comprises an IgGl Fc sequence (e.g., human or mouse IgGl Fc sequence).
  • the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293.
  • the GPC3 is expressed on the surface of a cancer cell (such as liver cancer cell, e.g., HCC).
  • the full-length anti-GPC3 antibody is non-naturally occurring.
  • the full-length anti-GPC3 antibody is monoclonal.
  • the full-length anti-GPC3 antibody is monospecific.
  • the full-length anti-GPC3 antibody is multispecific (e.g., bispecific).
  • the K4 of the binding between the anti-nGPC3 antibody moiety and nGPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-nGPC3 antibody moiety and nGPC3.
  • the K d of the binding between the anti- nGPC3 antibody moiety and an sGPC3 is about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the anti-nGPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semi-synthetic.
  • the full-length anti-GPC3 antibody comprises a mouse IgGl heavy cahin constant domain (CH) comprising the amino acid sequence of SEQ ID NO: 507.
  • the full-length anti-GPC3 antibody comprises a mouse ⁇ light cahin constant domain (CL) comprising the amino acid sequence of SEQ ID NO: 508.
  • the full-length anti-GPC3 antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 505, and a light chain comprising the amino acid sequence of SEQ ID NO: 506.
  • the heavy and/or light chain of the full-length anti-GPC3 antibody optionally comprises an N-terminal signal peptide.
  • the signal peptide comprises the amino acid seqeuence of SEQ ID NO: 509.
  • a full-length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising: i) a VH comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or
  • a full-length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising: i) a VH comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, an HC- CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, and an HC- CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; and ii) a V L comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 185- 204, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 236-255, and an LC-CDR3 comprising the amino acid sequence of any one
  • a full-length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising: i) a VH comprising the amino acid sequence of any one of SEQ ID NOs: 338-357; and ii) a VL comprising the amino acid sequence of any one of SEQ ID NOs: 389-408.
  • GPC3 e.g., nGPC3 and/or sGPC3
  • a full-length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising the HC-CDRs of a VH comprising the amino acid sequence of any one of SEQ ID NOs: 338-357, and the LC-CDRs of a VL comprising the amino acid sequence of any one of SEQ ID NOs: 389-408.
  • GPC3 e.g., nGPC3 and/or sGPC3
  • a full- length anti-GPC3 antibody (such as an isolated full-length anti-GPC3 antibody) comprising: a) an anti-GPC3 antibody moiety that specifically binds to a target GPC3 (e.g., nGPC3 and/or sGPC3) competitively with any of the anti-GPC3 constructs described herein; and an Fc fragment.
  • a target GPC3 e.g., nGPC3 and/or sGPC3
  • the Fc fragment comprises an IgGl Fc sequence (e.g., human or mouse IgGl Fc sequence).
  • the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293.
  • the GPC3 is expressed on the surface of a cancer cell (such as liver cancer cell, e.g., HCC).
  • the anti-GPC3 construct is non-naturally occurring.
  • the full-length anti-GPC3 antibody is monoclonal. In some embodiments, the full-length anti-GPC3 antibody is monospecific.
  • the full-length anti-GPC3 antibody is multispecific (e.g., bispecific).
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3.
  • the binding affinity of the anti-nGPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3.
  • the anti-nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity.
  • the anti-GPC3 antibody moiety specifically recognizes a soluble GPC3.
  • the binding affinity of the anti-sGPC3 antibody moiety to a soluble GPC3 is higher than that to a cell surface-bound GPC3.
  • the anti- sGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461.
  • the anti-sGPC3 antibody moiety specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467).
  • the anti-GPC3 antibody moiety specifically recognizes both cell surface- bound GPC3 and soluble GPC3.
  • the K d of the binding between the anti- GPC3 antibody moiety and a target GPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the K d of the binding between the anti-GPC3 antibody moiety and a non-target can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-GPC3 antibody moiety and the target GPC3.
  • the K d of the binding between the anti-GPC3 antibody moiety and a non-target is about 10 _1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the anti- GPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semisynthetic.
  • the full-length anti-GPC3 antibody comprises a mouse IgGl heavy cahin constant domain (C H ) comprising the amino acid sequence of SEQ ID NO: 507.
  • the full-length anti-GPC3 antibody comprises a mouse ⁇ light cahin constant domain (C L ) comprising the amino acid sequence of SEQ ID NO: 508.
  • the heavy and/or light chain of the full-length anti-GPC3 antibody optionally comprises an N-terminal signal peptide.
  • the signal peptide comprises the amino acid seqeuence of SEQ ID NO : 509.
  • anti-GPC3 constructs (such as isolated anti-GPC3 constructs) in some embodiment
  • embodiments comprise a multi-specific ⁇ e.g., bispecific) anti-GPC3 molecule comprising an anti-GPC3 antibody moiety according to any one of the anti-GPC3 antibody moieties described herein, and a second binding moiety (such as a second antibody moiety) specifically recognizing a second antigen.
  • the multi-specific anti-GPC3 molecule comprises an anti-GPC3 antibody moiety and a second antibody moiety specifically recognizing a second antigen.
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3.
  • the binding affinity of the anti-nGPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3.
  • the anti-nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity. In some embodiments, the anti-GPC3 antibody moiety specifically recognizes a soluble GPC3. In some embodiments, the binding affinity of the anti-sGPC3 antibody moiety to a soluble GPC3 is higher than that to a cell surface-bound GPC3. In some embodiments, the anti-GPC3 antibody moiety specifically recognizes both cell surface-bound GPC3 and soluble GPC3.
  • Multi-specific molecules are molecules that have binding specificities for at least two different antigens or epitopes (e.g., bispecific antibodies have binding specificities for two antigens or epitopes). Multi-specific molecules with more than two valencies and/or specificities are also contemplated. For example, trispecific antibodies can be prepared (Tutt et al. J.
  • a multi-specific ⁇ e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety ⁇ e.g., scFv) specifically recognizing a target GPC3 ⁇ e.g., nGPC3 and/or sGPC3), and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing a second antigen.
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface- bound GPC3.
  • the binding affinity of the anti-nGPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3.
  • the anti- nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity.
  • the anti- GPC3 antibody moiety specifically recognizes a soluble GPC3.
  • the binding affinity of the anti-sGPC3 antibody moiety to a soluble GPC3 is higher than that to a cell surface-bound GPC3.
  • the anti-GPC3 antibody moiety specifically recognizes both cell surface-bound GPC3 and soluble GPC3.
  • the second binding moiety specifically recognizes the same format of GPC3 (e.g., nGPC3 and/or sGPC3) as the anti-GPC3 antibody moiety. In some embodiments, the second binding moiety specifically recognizes a different GPC3 epitope compared to the anti-GPC3 antibody moiety. In some embodiments, the second binding moiety specifically recognizes a different format of GPC3 compared to the anti-GPC3 antibody moiety. For example, in some embodiments, the second binding moiety specifically recognizes an sGPC3 (or both sGPC3 and nGPC3), while the anti- GPC3 antibody moiety specifically recognizes nGPC3 (with no or little binding to sGPC3).
  • GPC3 e.g., nGPC3 and/or sGPC3
  • the second binding moiety specifically recognizes a second antigen that is not GPC3. In some embodiments, the second binding moiety specifically recognizes a second antigen on the surface of a cell, such as a cytotoxic cell. In some embodiments, the second binding moiety specifically binds to an antigen on the surface of a lymphocyte, such as a T cell, a B cell, a natural killer (NK) cell, a neutrophil, a monocyte, a macrophage, or a dendritic cell. In some embodiments, the second binding moiety specifically binds to an effector T cell, such as a cytotoxic T cell (also known as cytotoxic T lymphocyte (CTL) or T killer cell) or natural killer T (NKT) cell.
  • CTL cytotoxic T lymphocyte
  • NKT natural killer T
  • the second binding moiety specifically binds to a second antigen on the surface of an effector cell, including for example CD3y, CD35, CD3s, CD3 ⁇ CD27, CD28, CD16a, CD40L, CD56, CD68, CD137, OX40, GITR, HVEM and GDS2D.
  • the anti-GPC3 antibody moiety is chimeric, human, partially humanized, fully humanized, or semi-synthetic.
  • the anti-GPC3 antibody moiety is a full-length antibody, a Fab, a Fab', a F(ab')2, an Fv, or an scFv.
  • the second binding moiety is chimeric, human, partially humanized, fully humanized, or semisynthetic.
  • the multi-specific anti-GPC3 molecule further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional antibody moieties.
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g., scFv) specifically recognizing a cell surface-bound GPC3 (e.g., the binding affinity of the anti-nGPC3 antibody moiety to the cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti-nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity), and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing a second antigen (e.g., CD3 on T cell).
  • an anti-GPC3 antibody moiety e.g., scFv
  • a cell surface-bound GPC3 e.g., the binding affinity of the anti-nGPC3 antibody moiety to
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within human GPC3 comprising the amino acid sequence of SEQ ID NO: 460. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 462. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 463. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the N-terminal fragment of GPC3.
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 1-358 of SEQ ID NO: 460 (SEQ ID NO: 468). In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 464. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 359-560 of SEQ ID NO: 460 (SEQ ID NO: 465).
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 359-580 of SEQ ID NO: 460 (SEQ ID NO: 466). In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain. In some embodiments, the anti-nGPC3 antibody moiety specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467). In some embodiments, the anti-nGPC3 antibody moiety
  • the anti-nGPC3 antibody moiety can specifically bind to a full-length mature human GPC3 (e.g., amino acids 25-560 or 25-580 of SEQ ID NO: 460) but does not bind to an N-terminal fragment of human GPC3 (e.g., amino acids 25-358 of SEQ ID NO: 460) or to a C-terminal fragment of human GPC3 (e.g., amino acids 359-560 or 359-580 of SEQ ID NO: 460.
  • a full-length mature human GPC3 e.g., amino acids 25-560 or 25-580 of SEQ ID NO: 460
  • an N-terminal fragment of human GPC3 e.g., amino acids 25-358 of SEQ ID NO: 460
  • C-terminal fragment of human GPC3 e.g., amino acids 359-560 or 359-580 of SEQ ID NO: 460.
  • the anti-nGPC3 antibody moiety specifically recognizes an epitope within the C-terminal fragment of GPC3 lacking heparin sulfate side chain
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising: a) an anti-nGPC3 antibody moiety (e.g., scFv; e.g., the binding affinity of the anti- nGPC3 antibody moiety to the cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti-nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity) that competes for binding to nGPC3 with any one of the anti-GPC3 constructs described herein; and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising: a) an anti-nGPC3 antibody moiety (e.g., scFv; e.g., the binding affinity of the anti-nGPC3 antibody moiety to the cell surface-bound GPC3 is higher than that to a soluble GPC3, or the anti-nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity) that specifically binds to the same, or substantially the same, nGPC3 epitope competitively with any one of the anti-GPC3 constructs described herein; and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing a second antigen (e.g., CD3 on T cell).
  • an anti-nGPC3 antibody moiety e.g., scFv;
  • the GPC3 is expressed on the surface of a cell selected from the group consisting of HepG2, Hep3B, Huh7, JHH-7, and 293. In some embodiments, the GPC3 is expressed on the surface of a cancer cell (such as liver cancer cell, e.g., HCC). In some embodiments, the K4 of the binding between the anti-nGPC3 antibody moiety and nGPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-nGPC3 antibody moiety and nGPC3.
  • the K d of the binding between the anti- nGPC3 antibody moiety and an sGPC3 is about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the first and/or the second antibody moieties are chimeric, human, partially humanized, fully humanized, or semi-synthetic. In some embodiments, the first and/or the second antibody moieties are full-length antibody, a Fab, a Fab', a F(ab')2, an Fv, or an scFv. In some embodiments, the first and/or the second antibody moiety is scFv. In some embodiments, the first and the second antibody moieties are connected by a linker (e.g., SEQ ID NO: 474). In some embodiments, the first anti-GPC3 antibody moiety is N-terminal to the second antibody moiety.
  • a linker e.g., SEQ ID NO: 474
  • the effector cell is T cell (e.g., cytotoxic T cell, helper T cell, or natural killer T cell), B cell, NK cell, dendritic cell, macrophage, monocyte, or a neutrophil.
  • the second antigen is CD3y, CD35, CD3s, ⁇ 3 ⁇ , CD28, OX40, GITR, CD 137, CD27, CD40L, or HVEM.
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g., scFv) specifically recognizing a cell surface-bound GPC3, comprising: i) a VH comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions; and i
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g., scFv) specifically recognizing a cell surface- bound GPC3, comprising: i) a VH comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 1-31, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 52-82, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 103-133; and ii) a VL comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 154-184, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 205-235, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 256-286;
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g., scFv) specifically recognizing a cell surface-bound GPC3, comprising: i) a VH comprising the amino acid sequence of any one of SEQ ID NOs: 307-337; and ii) a VL comprising the amino acid sequence of any one of SEQ ID NOs: 358-388; and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing a second antigen (e.g., CD3 on T cell).
  • an anti-GPC3 antibody moiety e.g., scFv
  • a cell surface-bound GPC3 comprising: i) a VH comprising the amino acid sequence of any one of SEQ ID NOs: 307-337; and ii) a VL comprising the amino acid sequence of any one
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g., scFv) specifically recognizing a cell surface-bound GPC3, comprising the HC-CDRs of a VH comprising the amino acid sequence of any one of SEQ ID NOs: 307-337, and the LC-CDRs of a V L comprising the amino acid sequence of any one of SEQ ID NOs: 358- 388; and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing a second antigen (e.g., CD3 on T cell).
  • an anti-GPC3 antibody moiety e.g., scFv
  • a second antigen e.g., CD3 on T cell
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g., scFv) specifically recognizing a cell surface-bound GPC3, wherein the anti-nGPC3 antibody moiety competes for binding to the cell surface-bound GPC3 with a second anti- nGPC3 antibody moiety according to any of the anti-nGPC3 antibody moieties described herein; and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing a second antigen (e.g., CD3 on T cell).
  • an anti-GPC3 antibody moiety e.g., scFv
  • a second antigen e.g., CD3 on T cell
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising: a) an anti-nGPC3 antibody moiety (e.g., scFv) that specifically binds to the same, or substantially the same, nGPC3 epitope competitively with any one of the anti-GPC3 constructs described herein; and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing a second antigen (e.g., CD3 on T cell).
  • an anti-nGPC3 antibody moiety e.g., scFv
  • a second binding moiety such as a second antibody moiety, e.g., scFv
  • a second antigen e.g., CD3 on T cell
  • the K d of the binding between the anti- nGPC3 antibody moiety and nGPC3 is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-nGPC3 antibody moiety and nGPC3.
  • the K d of the binding between the anti-nGPC3 antibody moiety and an sGPC3 is about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the first and/or the second antibody moieties are chimeric, human, partially humanized, fully humanized, or semi -synthetic.
  • the first and/or the second antibody moieties are full-length antibody, a Fab, a Fab', a F(ab')2, an Fv, or an scFv.
  • the first and/or the second antibody moiety is scFv.
  • the first and the second antibody moieties are connected by a linker (e.g., SEQ ID NO: 474).
  • the first anti-GPC3 antibody moiety is N-terminal to the second antibody moiety.
  • the effector cell is T cell (e.g., cytotoxic T cell, helper T cell, or natural killer T cell), B cell, NK cell, dendritic cell, macrophage, monocyte, or a neutrophil.
  • the second antigen is CD3y, CD35, CD38, CD3C, CD28, OX40, GITR, CD137, CD27, CD40L, or HVEM.
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g., scFv) specifically recognizing GPC3 (e.g., nGPC3 and/or sGPC3), comprising: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, or a variant thereof comprising up to about 5 (such as about any of 1, 2, 3, 4, or 5) amino acid substitutions, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153, or a variant thereof comprising up to about 5 (such as about any about any
  • a multi-specific (e.g., bispecific) anti- GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g., scFv) specifically recognizing GPC3, comprising: i) a V H comprising an HC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 32-51, an HC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 83-102, and an HC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 134-153; and ii) a VL comprising an LC-CDR1 comprising the amino acid sequence of any one of SEQ ID NOs: 185-204, an LC-CDR2 comprising the amino acid sequence of any one of SEQ ID NOs: 236-255, and an LC-CDR3 comprising the amino acid sequence of any one of SEQ ID NOs: 287-306; and b
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g., scFv) specifically recognizing GPC3, comprising: i) a VH comprising the amino acid sequence of any one of SEQ ID NOs: 338-357; and ii) a VL comprising the amino acid sequence of any one of SEQ ID NOs: 389-408; and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing a second antigen (e.g., CD3 on T cell).
  • an anti-GPC3 antibody moiety e.g., scFv
  • GPC3 an anti-GPC3 antibody moiety specifically recognizing GPC3
  • a second binding moiety such as a second antibody moiety, e.g., scFv
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g., scFv) specifically recognizing GPC3, comprising the HC-CDRs of a VH comprising the amino acid sequence of any one of SEQ ID NOs: 338-357, and the LC-CDRs of a VL comprising the amino acid sequence of any one of SEQ ID NOs: 389-408; and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing a second antigen (e.g., CD3 on T cell).
  • an anti-GPC3 antibody moiety e.g., scFv
  • GPC3 antibody moiety specifically recognizing GPC3
  • HC-CDRs of a VH comprising the amino acid sequence of any one of SEQ ID NOs: 338-357
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g., scFv) specifically recognizing GPC3, wherein the anti-GPC3 antibody moiety competes for binding to the target GPC3 (e.g., nGPC3 and/or sGPC3) with a second anti-GPC3 antibody moiety according to any of the anti-GPC3 antibody moieties described herein; and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing a second antigen (e.g., CD3 on T cell).
  • an anti-GPC3 antibody moiety e.g., scFv
  • the anti-GPC3 antibody moiety competes for binding to the target GPC3 (e.g., nGPC3 and/or sGPC3) with a second anti-GPC3 antibody moiety according to any of the
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising: a) an anti-GPC3 antibody moiety (e.g., scFv) that specifically binds to the same, or substantially the same, GPC3 epitope competitively with any one of the anti-GPC3 constructs described herein; and b) a second binding moiety (such as a second antibody moiety, e.g., scFv) specifically recognizing a second antigen (e.g., CD3 on T cell).
  • the anti-GPC3 antibody moiety specifically recognizes a cell surface-bound GPC3.
  • the binding affinity of the anti-nGPC3 antibody moiety to a cell surface-bound GPC3 is higher than that to a soluble GPC3.
  • the anti- nGPC3 antibody moiety specifically recognizes a cell surface-bound GPC3 at a high binding affinity and binds to a soluble GPC3 at a low binding affinity.
  • the anti- GPC3 antibody moiety specifically recognizes a soluble GPC3.
  • the binding affinity of the anti-sGPC3 antibody moiety to a soluble GPC3 is higher than that to a cell surface-bound GPC3.
  • the anti-sGPC3 antibody moiety specifically recognizes an epitope within the amino acid sequence of SEQ ID NO: 461.
  • the anti-sGPC3 antibody moiety specifically recognizes an epitope within amino acids 510-560 of SEQ ID NO: 460 (SEQ ID NO: 467). In some embodiments, the anti-GPC3 antibody moiety specifically recognizes both cell surface-bound GPC3 and soluble GPC3. In some embodiments, the K d of the binding between the anti-GPC3 antibody moiety and target GPC3 (e.g., gGPC3 and/or sGPC3) is about 10 "7 M to about 10 "13 M (such as about 10 "7 M to about 10 "13 M, about 10 "9 M to about 10 "13 M, or about 10 "10 M to about 10 "12 M).
  • the K d of the binding between the anti-GPC3 antibody moiety and a non-target can be at least about 10 times (such as at least about 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , or 10 7 times) of the K d of the binding between the anti-GPC3 antibody moiety and the target GPC3.
  • the K d of the binding between the anti-GPC3 antibody moiety and a non-target is about 10 "1 M to about 10 "6 M (such as about 10 "1 M to about 10 "6 M, about 10 "1 M to about 10 "5 M, or about 10 "2 M to about 10 "4 M).
  • the first and/or the second antibody moieties are chimeric, human, partially humanized, fully humanized, or semi-synthetic. In some embodiments, the first and/or the second antibody moieties are full-length antibody, a Fab, a Fab', a F(ab')2, an Fv, or an scFv. In some embodiments, the first and/or the second antibody moiety is scFv. In some embodiments, the first and the second antibody moieties are connected by a linker (e.g., SEQ ID NO: 474). In some embodiments, the first anti-GPC3 antibody moiety is N-terminal to the second antibody moiety.
  • a linker e.g., SEQ ID NO: 474
  • the effector cell is T cell (e.g., cytotoxic T cell, helper T cell, or natural killer T cell), B cell, NK cell, dendritic cell, macrophage, monocyte, or a neutrophil.
  • the second antigen is CD3y, CD35, CD38, CD3C, CD28, OX40, GITR, CD137, CD27, CD40L, or HVEM.
  • the multi-specific anti-GPC3 molecule is, for example, a diabody (Db), a single-chain diabody (scDb), a tandem scDb (Tandab), a linear dimeric scDb (LD-scDb), a circular dimeric scDb (CD-scDb), a di-diabody, a tandem scFv, a tandem di-scFv (e.g., a bispecific T cell engager), a tandem tri-scFv, a tri(a)body, a bispecific Fab2, a di- miniantibody, a tetrabody, an scFv-Fc-scFv fusion, a dual-affinity retargeting (DART) antibody, a dual variable domain (DVD) antibody, an IgG-scFab, an scFab-ds-scFv, an Fv2-Fc,
  • DART dual-affinity
  • the anti-GPC3 construct (such as an isolated anti-GPC3 construct) comprises a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising an anti- GPC3 antibody moiety (such as an anti-nGPC3 antibody moiety) and a second antibody moiety (e.g. scFv) specifically recognizing a second antigen.
  • the second antigen is also GPC3 but comprises a different epitope compared to that recognized by the anti-GPC3 antibody moiety.
  • the second antigen is not GPC3.
  • the second antigen is a tumor antigen.
  • the second antigen is a cell surface molecule.
  • the second antigen is a cell surface molecule on an effector cell.
  • Exemplary tumor antigens that can be recognized by the second antibody moiety described herein include, but are not limited to, alpha fetoprotein (AFP), CA15-3, CA27-29, CA19-9, CA-125, calretinin, carcinoembryonic antigen, CD34, CD99, CD1 17, chromogranin, cytokeratin, desmin, epithelial membrane protein (EMA), Factor VIII, CD31 FL1, glial fibrillary acidic protein (GFAP), gross cystic disease fluid protein (GCDFP-15), HMB-45, human chorionic gonadotropin (hCG), inhibin, keratin, CD45, a lymphocyte marker, MART-1 (Melan- A), Myo Dl, muscle-specific actin (MSA), neurofilament, neuron-specific enolase (NSE), placental alkaline phosphatase (PLAP), prostate-specific antigen, S I 00 protein, smooth muscle actin (SMA), synaptophy
  • the multi-specific (e.g., bispecific) anti-GPC3 molecules described herein can be engineered to facilitate killing (e.g., cytotoxic lysis or phagocytosis) of tumor cells by directing (or recruiting) an effector cell (such as a cytotoxic T cell) to a tumor site.
  • an effector cell such as a cytotoxic T cell
  • tumor cytotoxicitiy can be tested using an LDH Cytotoxicity Assay.
  • the multi-specific (e.g., bispecific) anti-GPC3 molecule can effectively direct an effector cell (e.g., T cell, NK cell, CAR-T cell, caTCR-T cell) to a target cell in an immunosuppressive environment, such as an immunosuppressive tumor environment.
  • an effector cell e.g., T cell, NK cell, CAR-T cell, caTCR-T cell
  • an immunosuppressive environment such as an immunosuppressive tumor environment.
  • Exemplary effector cells include without limitation a T cell, a B cell, a natural killer (NK) cell, a dendritic cell (DC), a macrophage, a monocyte, a neutrophil, a natural killer T (NKT) cell, an antibody-dependent cytotoxic cell, a chimeric antigen receptor (CAR) effector cell (e.g., CAR-T), a chimeric antibody-T cell receptor (TCR) construct (caTCR) effector cell (see caTCR section below), or the like.
  • the effector cell is a T cell (e.g., a cytotoxic T cell, a helper T cell, or an NKT cell).
  • the effector cell is a cytotoxic T cell.
  • the effector cell is allogenic.
  • the effector cell is autologous.
  • a cell surface molecule of the present invention is a molecule found on the
  • cell surface molecules include, but are not limited to, membrane proteins such as receptors, transporters, ion channels, proton pumps, and G protein-coupled receptors;
  • extracellular matrix molecules such as adhesion molecules (e.g., integrins, cadherins, selectins, or NCAMS); see, e.g., U.S. Pat. No. 7,556,928, which is incorporated herein by reference in its entirety.
  • Cell surface molecules on an effector cell include but not limited to CD3 (e.g., CD3y, CD35, CD38, or CO3Q, CD4, CD5, CD7, CD8, CD13, CD14, CD16, CD27 (TNFRSF7), CD28, CD31, CD38, CD40L (TNFSF5 or CD154), CD56, CD64, CD68, CD89, CD94, CD137
  • TNFRSF9 or 4-1BB CD278, NKp46, NKp30, NKG2D, MAC-l/MAC-3, IL-2Ra, OX40 (TNFRSF4 or CD134), GITR, HVEM (TNFRSF14 or CD270), Ly49, or an invariant TCR.
  • CD3 is a cell surface molecule on T cells
  • CD 16, NKG2D, or NKp30 are cell surface molecules on NK cells
  • CD3 or an invariant TCR are the cell surface molecules on NKT-cells.
  • the activation molecule is one or more of CD3 (e.g., CD3y, CD35 or CD3s), CD27, CD28, CD40, CD134, CD137, and CD278.
  • the cell surface molecule is CD16, NKG2D, or NKp30; or wherein the effector cell is a NKT- cell, the cell surface molecule is CD3 or an invariant TCR.
  • the second antibody moiety binds specifically to CD3.
  • CD3 is an antigen expressed by T cells and comprises three different polypeptide chains ( ⁇ , ⁇ and ⁇ chains).
  • the three CD3 polypeptide chains associate with the T cell receptor (TCR) and the ⁇ - chain to form the TCR complex, which has the function of activating signaling cascades in T cells.
  • TCR T cell receptor
  • many therapeutic strategies target the TCR signal transduction to treat diseases using anti-human CD3 monoclonal antibodies.
  • the TCR complex is an octomeric complex of variable TCR a and ⁇ chains with three dimeric signaling modules CD35/s, CD3y/8 and ⁇ 3 ⁇ / ⁇ or ⁇ / ⁇ .
  • the second antibody moiety (such as an scFv) described herein binds to CD3s, targeting other CD3 molecules, especially CD3 ⁇ or the TCR a and ⁇ chains, is also encompassed in the disclosure.
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g. scFv) specifically recognizing a target GPC3 (e.g., nGPC3 and/or sGPC3), and b) a second antibody moiety (e.g. scFv) that binds specifically to CD3.
  • the second antibody moiety specifically binds to CD3s.
  • the second antibody moiety specifically binds to an agonistic epitope of CD3s.
  • agonistic epitope means (a) an epitope that, upon binding of the multi-specific molecule, optionally upon binding of several multi-specific molecules on the same cell, allows said multi-specific molecules to activate TCR signaling and induce T cell activation, and/or (b) an epitope that is solely composed of amino acid residues of the epsilon chain of CD3 and is accessible for binding by the multi-specific molecule, when presented in its natural context on T cells (i.e. surrounded by the TCR, the CD3y chain, etc.), and/or (c) an epitope that, upon binding of the multi-specific molecule, does not lead to stabilization of the spatial position of CD3s relative to CD3y.
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g. scFv) specifically recognizing a target GPC3 (e.g., nGPC3 and/or sGPC3), and b) a second antibody moiety (e.g. scFv) that binds specifically to an antigen on the surface of an effector cell, including for example CD3y, CD35, CD38, CD3C, CD28, CD16a, CD56, CD68, and GDS2D.
  • an anti-GPC3 antibody moiety e.g. scFv
  • target GPC3 e.g., nGPC3 and/or sGPC3
  • a second antibody moiety e.g. scFv
  • a multi-specific (e.g., bispecific) anti-GPC3 molecule comprising a) an anti-GPC3 antibody moiety (e.g. scFv) specifically recognizing a target GPC3 (e.g., nGPC3 and/or sGPC3), and b) a second antibody moiety (e.g. scFv) that binds specifically to a component of the complement system, such as Clq.
  • Clq is a subunit of the CI enzyme complex that activates the serum complement system.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Microbiology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biotechnology (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Mycology (AREA)
  • Oncology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Developmental Biology & Embryology (AREA)
  • Gynecology & Obstetrics (AREA)
PCT/US2018/029221 2017-04-26 2018-04-24 Constructs specifically recognizing glypican 3 and uses thereof Ceased WO2018200586A1 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
CN201880027827.8A CN110741019B (zh) 2017-04-26 2018-04-24 特异性识别磷脂酰肌醇蛋白聚糖3的构筑体及其用途
KR1020197034685A KR102663596B1 (ko) 2017-04-26 2018-04-24 글리피칸 3을 특이적으로 인식하는 구축물 및 그의 용도
AU2018258049A AU2018258049B2 (en) 2017-04-26 2018-04-24 Constructs specifically recognizing glypican 3 and uses thereof
MX2019012133A MX420947B (es) 2017-04-26 2018-04-24 Constructos que reconocen específicamente glipicano 3 y usos de estos.
KR1020247014513A KR20240067275A (ko) 2017-04-26 2018-04-24 글리피칸 3을 특이적으로 인식하는 구축물 및 그의 용도
US16/608,377 US11447564B2 (en) 2017-04-26 2018-04-24 Constructs specifically recognizing glypican 3 and uses thereof
SG11201909728X SG11201909728XA (en) 2017-04-26 2018-04-24 Constructs specifically recognizing glypican 3 and uses thereof
CA3059820A CA3059820A1 (en) 2017-04-26 2018-04-24 Constructs specifically recognizing glypican 3 and uses thereof
JP2019558615A JP7295030B2 (ja) 2017-04-26 2018-04-24 グリピカン3を特異的に認識するコンストラクト及びその使用
EP18791195.3A EP3615574A4 (en) 2017-04-26 2018-04-24 SPECIFIC GLYPICAN 3 RECOGNIZING CONSTRUCTS AND THEIR USE
IL319308A IL319308A (en) 2017-04-26 2018-04-24 Structures that specifically recognize glypican 3 and their uses
MYPI2019006272A MY201065A (en) 2017-04-26 2018-04-24 Constructs specifically recognizing glypican 3 and uses thereof
IL270138A IL270138B2 (en) 2017-04-26 2018-04-24 Structures that specifically recognize glypican 3 and their uses
PH12019502412A PH12019502412A1 (en) 2017-04-26 2019-10-24 Constructs specifically recognizing glypican 3 and uses thereof
ZA2020/00027A ZA202000027B (en) 2017-04-26 2020-01-02 Constructs specifically recognizing glypican 3 and uses thereof
US17/817,308 US12479924B2 (en) 2017-04-26 2022-08-03 Constructs specifically recognizing Glypican 3 and uses thereof
JP2023094432A JP2023123540A (ja) 2017-04-26 2023-06-07 グリピカン3を特異的に認識するコンストラクト及びその使用

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762490586P 2017-04-26 2017-04-26
US62/490,586 2017-04-26

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/608,377 A-371-Of-International US11447564B2 (en) 2017-04-26 2018-04-24 Constructs specifically recognizing glypican 3 and uses thereof
US17/817,308 Continuation US12479924B2 (en) 2017-04-26 2022-08-03 Constructs specifically recognizing Glypican 3 and uses thereof

Publications (2)

Publication Number Publication Date
WO2018200586A1 true WO2018200586A1 (en) 2018-11-01
WO2018200586A9 WO2018200586A9 (en) 2019-11-28

Family

ID=63920003

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/029221 Ceased WO2018200586A1 (en) 2017-04-26 2018-04-24 Constructs specifically recognizing glypican 3 and uses thereof

Country Status (15)

Country Link
US (2) US11447564B2 (https=)
EP (1) EP3615574A4 (https=)
JP (2) JP7295030B2 (https=)
KR (2) KR102663596B1 (https=)
CN (1) CN110741019B (https=)
AU (1) AU2018258049B2 (https=)
CA (1) CA3059820A1 (https=)
IL (2) IL319308A (https=)
MX (2) MX420947B (https=)
MY (1) MY201065A (https=)
PH (1) PH12019502412A1 (https=)
SG (2) SG11201909728XA (https=)
TW (1) TWI878207B (https=)
WO (1) WO2018200586A1 (https=)
ZA (1) ZA202000027B (https=)

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020156554A1 (zh) * 2019-02-01 2020-08-06 科济生物医药(上海)有限公司 Tcr融合蛋白及表达tcr融合蛋白的细胞
US20210388109A1 (en) * 2018-10-01 2021-12-16 Adicet Bio, Inc. Compositions and methods regarding engineered and non-engineered gamma delta t-cells for treatment of solid tumors
US20220064327A1 (en) * 2018-12-21 2022-03-03 Kymab Limited Fixaxfx bispecific antibody with common light chain
CN114901301A (zh) * 2019-12-20 2022-08-12 免疫医疗有限责任公司 用靶向磷脂酰肌醇蛋白聚糖3的嵌合抗原受体治疗癌症的组合物和方法
WO2022216744A3 (en) * 2021-04-05 2022-11-17 Cytovia Therapeutics, Llc. Bispecific antibodies targeting nkp46 and gpc3 and methods of use thereof
WO2022242682A1 (en) * 2021-05-21 2022-11-24 Beigene, Ltd. Anti-gpc3 and anti-cd137 multispecific antibodies and methods of use
EP3965897A4 (en) * 2019-05-07 2023-01-04 The Board of Trustees of the Leland Stanford Junior University CHEMERA ANTIGEN RECEPTORS TARGETING GLYPICAN-2
US20230058044A1 (en) * 2019-11-26 2023-02-23 Ramot At Tel-Aviv University Ltd. Chimeric antigen receptor to carbohydrate antigens
JP2023516286A (ja) * 2020-02-27 2023-04-19 ナンジン レジェンド バイオテック シーオー., エルティーディー. グリピカン-3(gpc3)を標的化する抗体及びキメラ抗原受容体並びにその使用方法
US20230183312A1 (en) * 2020-02-14 2023-06-15 The Board Of Trustees Of The Leland Stanford Junior University Chimeric antigen receptors with cd2 activation
JP2023525991A (ja) * 2020-05-07 2023-06-20 フェインズ セラピューティクス,インコーポレーテッド 抗腫瘍関連抗原抗体及びその使用
US11708401B2 (en) 2018-06-22 2023-07-25 Kite Pharma, Inc. Chimeric transmembrane proteins and uses thereof
WO2023215738A1 (en) * 2022-05-02 2023-11-09 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Compositions targeting gpc2 and gpc3 and their use for treating solid tumors
WO2024020429A1 (en) * 2022-07-22 2024-01-25 Lyell Immunopharma, Inc. Immune cell therapy
US11965021B2 (en) 2017-04-26 2024-04-23 Eureka Therapeutics, Inc. Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
US11976105B2 (en) 2015-10-23 2024-05-07 Eureka Therapeutics, Inc. Antibody/T-cell receptor chimeric constructs and uses thereof
WO2024109678A1 (en) * 2022-11-21 2024-05-30 Beigene, Ltd. Anti-cd137 antibodies and methods of use
EP4121517A4 (en) * 2020-03-18 2024-08-07 Eutilex Co., Ltd. IL-18-SECRETING GPC3 CAR-T CELLS AND METHODS OF MAKING AND USING THE SAME
US12109235B2 (en) 2019-06-21 2024-10-08 Kite Pharma, Inc. TGF-beta receptors and methods of use
EP4326780A4 (en) * 2021-04-23 2025-02-26 Shanghai Henlius Biotech, Inc. Anti-gpc3 antibodies, multispecific antibodies and methods of use
US12540196B2 (en) 2021-06-08 2026-02-03 Kite Pharma, Inc. GPC3 binding molecules

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3615574A4 (en) 2017-04-26 2021-02-24 Eureka Therapeutics, Inc. SPECIFIC GLYPICAN 3 RECOGNIZING CONSTRUCTS AND THEIR USE
TW202216788A (zh) * 2020-06-26 2022-05-01 日商協和麒麟股份有限公司 與GPC3及TfR結合之雙特異性抗體
CN113203780B (zh) * 2021-05-13 2022-05-31 桂林电子科技大学 一种非诊断目的无标记适配体传感器检测gpc3的方法
CN113238040B (zh) * 2021-05-18 2022-05-31 桂林电子科技大学 一种非诊断目的基于纳米复合材料的laps传感器检测gpc3方法
CN118488970A (zh) * 2021-10-15 2024-08-13 乐普创一生物科技(上海)有限公司 抗磷脂酰肌醇蛋白聚糖3抗体
WO2023249071A1 (ja) * 2022-06-24 2023-12-28 国立研究開発法人国立がん研究センター T細胞受容体
WO2025159562A1 (ko) * 2024-01-24 2025-07-31 국립암센터 Gpc3에 특이적으로 결합하는 신규 항체 및 이의 용도

Citations (117)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
EP0003089A1 (fr) 1978-01-06 1979-07-25 Bernard David Séchoir pour feuilles imprimées par sérigraphie
WO1981001145A1 (en) 1979-10-18 1981-04-30 Univ Illinois Hydrolytic enzyme-activatible pro-drugs
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4975278A (en) 1988-02-26 1990-12-04 Bristol-Myers Company Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
WO1991000360A1 (en) 1989-06-29 1991-01-10 Medarex, Inc. Bispecific reagents for aids therapy
US4994560A (en) 1987-06-24 1991-02-19 The Dow Chemical Company Functionalized polyamine chelants and radioactive rhodium complexes thereof for conjugation to antibodies
US5199942A (en) 1991-06-07 1993-04-06 Immunex Corporation Method for improving autologous transplantation
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
US5229275A (en) 1990-04-26 1993-07-20 Akzo N.V. In-vitro method for producing antigen-specific human monoclonal antibodies
WO1993021232A1 (en) 1992-04-10 1993-10-28 Research Development Foundation IMMUNOTOXINS DIRECTED AGAINST c-erbB-2 (HER-2/neu) RELATED SURFACE ANTIGENS
US5274119A (en) 1988-07-01 1993-12-28 The Dow Chemical Company Vicinal diols
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US5342604A (en) 1988-10-31 1994-08-30 The Dow Chemical Company Complexes possessing ortho ligating functionality
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
US5428139A (en) 1991-12-10 1995-06-27 The Dow Chemical Company Bicyclopolyazamacrocyclophosphonic acid complexes for use as radiopharmaceuticals
US5435990A (en) 1988-06-24 1995-07-25 The Dow Chemical Company Macrocyclic congugates and their use as diagnostic and therapeutic agents
US5489425A (en) 1987-06-24 1996-02-06 The Dow Chemical Company Functionalized polyamine chelants
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5505931A (en) 1993-03-04 1996-04-09 The Dow Chemical Company Acid cleavable compounds, their preparation and use as bifunctional acid-labile crosslinking agents
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5567610A (en) 1986-09-04 1996-10-22 Bioinvent International Ab Method of producing human monoclonal antibodies and kit therefor
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1996034103A1 (en) 1995-04-25 1996-10-31 Vrije Universiteit Brussel Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5591669A (en) 1988-12-05 1997-01-07 Genpharm International, Inc. Transgenic mice depleted in a mature lymphocytic cell-type
WO1997004801A1 (en) 1995-07-27 1997-02-13 Genentech, Inc. Stabile isotonic lyophilized protein formulation
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
WO1997017852A1 (de) 1995-11-15 1997-05-22 Hoechst Schering Agrevo Gmbh Synergistische herbizide mischungen
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5652361A (en) 1988-06-24 1997-07-29 The Dow Chemical Company Macrocyclic ligands and complexes
WO1997030087A1 (en) 1996-02-16 1997-08-21 Glaxo Group Limited Preparation of glycosylated antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5696239A (en) 1988-10-31 1997-12-09 The Dow Chemical Company Conjugates possessing ortho ligating functionality and complexes thereof
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5756065A (en) 1988-06-24 1998-05-26 The Dow Chemical Company Macrocyclic tetraazacyclododecane conjugates and their use as diagnostic and therapeutic agents
US5808003A (en) 1989-05-26 1998-09-15 Perimmune Holdings, Inc. Polyaminocarboxylate chelators
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1998056418A1 (en) 1997-06-13 1998-12-17 Genentech, Inc. Stabilized antibody formulation
WO1998058964A1 (en) 1997-06-24 1998-12-30 Genentech, Inc. Methods and compositions for galactosylated glycoproteins
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
WO1999022764A1 (en) 1997-10-31 1999-05-14 Genentech, Inc. Methods and compositions comprising glycoprotein glycoforms
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
WO1999054440A1 (en) 1998-04-21 1999-10-28 Micromet Gesellschaft Für Biomedizinische Forschung Mbh CD19xCD3 SPECIFIC POLYPEPTIDES AND USES THEREOF
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO2001029246A1 (fr) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Procede de production d'un polypeptide
WO2001029058A1 (en) 1999-10-15 2001-04-26 University Of Massachusetts Rna interference pathway genes as tools for targeted genetic interference
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
WO2001096584A2 (en) 2000-06-12 2001-12-20 Akkadix Corporation Materials and methods for the control of nematodes
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
EP1391213A1 (en) 2002-08-21 2004-02-25 Boehringer Ingelheim International GmbH Compositions and methods for treating cancer using maytansinoid CD44 antibody immunoconjugates and chemotherapeutic agents
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
WO2005035778A1 (ja) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法
WO2005035586A1 (ja) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. 融合蛋白質組成物
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
US20050123546A1 (en) 2003-11-05 2005-06-09 Glycart Biotechnology Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
WO2005053742A1 (ja) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. 抗体組成物を含有する医薬
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
WO2008077546A1 (en) 2006-12-22 2008-07-03 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor i receptor and uses thereof
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
WO2009012394A1 (en) * 2007-07-17 2009-01-22 Medarex, Inc. Monoclonal antibodies against glypican-3
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
WO2009067800A1 (en) 2007-11-27 2009-06-04 Viventia Biotech Inc. Antibodies against a cancer-associated epitope of variant nfkbib and uses thereof
US7556928B2 (en) 2001-05-26 2009-07-07 One Cell Systems, Inc. Method of screening a population of cells
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2011056983A1 (en) 2009-11-05 2011-05-12 Genentech, Inc. Zirconium-radiolabeled, cysteine engineered antibody conjugates
WO2011133886A2 (en) 2010-04-23 2011-10-27 Genentech, Inc. Production of heteromultimeric proteins
WO2013181543A1 (en) * 2012-06-01 2013-12-05 The United States Of America, As Represented By The Secretary, Dept. Of Health And Human Services High-affinity monoclonal antibodies to glypican-3 and use thereof
US20140170114A1 (en) 2011-11-08 2014-06-19 The Trustees Of The University Of Pennsylvania Glypican-3-specific antibody and uses thereof
US20140322129A1 (en) 2013-03-14 2014-10-30 Genentech, Inc. Anti-b7-h4 antibodies and immunoconjugates
US20150368340A1 (en) * 2011-04-19 2015-12-24 The United States of America, as Represented by the Secretary, Department of Health and Human Services Human monoclonal antibodies specific for glypican-3 and use thereof
US20160000842A1 (en) * 2013-03-05 2016-01-07 Baylor College Of Medicine Oncolytic virus
WO2016049459A1 (en) * 2014-09-26 2016-03-31 Baylor College Of Medicine Glypican-3 specific chimeric antigen receptors for adoptive immunotherapy

Family Cites Families (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE3850542T2 (de) 1987-09-23 1994-11-24 Bristol Myers Squibb Co Antikörper-Heterokonjugate zur Töting von HIV-infizierten Zellen.
WO1992020373A1 (en) 1991-05-14 1992-11-26 Repligen Corporation Heteroconjugate antibodies for treatment of hiv infection
JP2003516344A (ja) 1999-12-13 2003-05-13 エピミューン, インコーポレイテッド Hlaクラスia2腫瘍関連抗原ペプチドおよびワクチン組成物
WO2004022597A1 (ja) * 2002-09-04 2004-03-18 Chugai Seiyaku Kabushiki Kaisha Gpc3の血中可溶化n端ペプチドに対する抗体
US7393531B2 (en) * 2003-01-21 2008-07-01 Arius Research Inc. Cytotoxicity mediation of cells evidencing surface expression of MCSP
SI1674111T1 (sl) * 2004-07-09 2011-02-28 Chugai Pharmaceutical Co Ltd Protitelo proti glipikanu 3
RU2654567C2 (ru) 2011-10-11 2018-05-21 Дженентек, Инк. Улучшенная сборка биспецифических антител
CN104140974B (zh) 2013-05-08 2017-09-29 科济生物医药(上海)有限公司 编码gpc‑3嵌合抗原受体蛋白的核酸及表达gpc‑3嵌合抗原受体蛋白的t淋巴细胞
US20170335281A1 (en) * 2014-03-15 2017-11-23 Novartis Ag Treatment of cancer using chimeric antigen receptor
EP2944652A1 (en) * 2014-05-13 2015-11-18 Technische Universität München Glypican-3-specific T-cell receptors and their uses for immunotherapy of hepatocellular carcinoma
WO2015179658A2 (en) * 2014-05-22 2015-11-26 Genentech, Inc. Anti-gpc3 antibodies and immunoconjugates
US10093746B2 (en) * 2014-09-04 2018-10-09 The Trustees Of The University Of Pennsylvania Glypican-3 antibody and uses thereof
WO2016161390A1 (en) * 2015-04-03 2016-10-06 Eureka Therapeutics, Inc. Constructs targeting afp peptide/mhc complexes and uses thereof
PL3298033T5 (pl) 2015-05-18 2023-10-30 TCR2 Therapeutics Inc. Kompozycje i zastosowania medyczne do reprogramowania TCR z zastosowaniem białek fuzyjnych
MX2018004721A (es) 2015-10-23 2018-07-06 Eureka Therapeutics Inc Construcciones quimericas anticuerpo/receptor de celulas t y usos de las mismas.
CA3032498A1 (en) 2016-08-02 2018-02-08 TCR2 Therapeutics Inc. Compositions and methods for tcr reprogramming using fusion proteins
WO2018067993A1 (en) 2016-10-07 2018-04-12 TCR2 Therapeutics Inc. Compositions and methods for t-cell receptors reprogramming using fusion proteins
JP7291396B2 (ja) 2016-11-22 2023-06-15 ティーシーアール2 セラピューティクス インク. 融合タンパク質を用いたtcrの再プログラミングのための組成物及び方法
JP2020513754A (ja) 2016-12-21 2020-05-21 ティーシーアール2 セラピューティクス インク. がん治療用に操作されたt細胞
US20190359678A1 (en) 2017-02-09 2019-11-28 The Regents Of The University Of California Chimeric t cell antigen receptors and methods of use thereof
EP3615574A4 (en) 2017-04-26 2021-02-24 Eureka Therapeutics, Inc. SPECIFIC GLYPICAN 3 RECOGNIZING CONSTRUCTS AND THEIR USE
WO2018232020A1 (en) 2017-06-13 2018-12-20 TCR2 Therapeutics Inc. Compositions and methods for tcr reprogramming using fusion proteins
KR102061677B1 (ko) 2018-08-23 2020-02-11 주식회사 나노테크 텅스텐과 티타늄 복합 탄화물 분말의 제조 방법

Patent Citations (132)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
EP0003089A1 (fr) 1978-01-06 1979-07-25 Bernard David Séchoir pour feuilles imprimées par sérigraphie
WO1981001145A1 (en) 1979-10-18 1981-04-30 Univ Illinois Hydrolytic enzyme-activatible pro-drugs
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US5567610A (en) 1986-09-04 1996-10-22 Bioinvent International Ab Method of producing human monoclonal antibodies and kit therefor
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US4994560A (en) 1987-06-24 1991-02-19 The Dow Chemical Company Functionalized polyamine chelants and radioactive rhodium complexes thereof for conjugation to antibodies
US5489425A (en) 1987-06-24 1996-02-06 The Dow Chemical Company Functionalized polyamine chelants
US4975278A (en) 1988-02-26 1990-12-04 Bristol-Myers Company Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells
US5652361A (en) 1988-06-24 1997-07-29 The Dow Chemical Company Macrocyclic ligands and complexes
US5756065A (en) 1988-06-24 1998-05-26 The Dow Chemical Company Macrocyclic tetraazacyclododecane conjugates and their use as diagnostic and therapeutic agents
US5435990A (en) 1988-06-24 1995-07-25 The Dow Chemical Company Macrocyclic congugates and their use as diagnostic and therapeutic agents
US5274119A (en) 1988-07-01 1993-12-28 The Dow Chemical Company Vicinal diols
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5714631A (en) 1988-10-31 1998-02-03 The Dow Chemical Company Conjugates possessing ortho ligating functionality
US5342604A (en) 1988-10-31 1994-08-30 The Dow Chemical Company Complexes possessing ortho ligating functionality
US5696239A (en) 1988-10-31 1997-12-09 The Dow Chemical Company Conjugates possessing ortho ligating functionality and complexes thereof
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7232566B2 (en) 1988-11-23 2007-06-19 The United States As Represented By The Secretary Of The Navy Methods for treating HIV infected subjects
US7144575B2 (en) 1988-11-23 2006-12-05 The Regents Of The University Of Michigan Methods for selectively stimulating proliferation of T cells
US6887466B2 (en) 1988-11-23 2005-05-03 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US5883223A (en) 1988-11-23 1999-03-16 Gray; Gary S. CD9 antigen peptides and antibodies thereto
US5591669A (en) 1988-12-05 1997-01-07 Genpharm International, Inc. Transgenic mice depleted in a mature lymphocytic cell-type
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
US5589466A (en) 1989-03-21 1996-12-31 Vical Incorporated Induction of a protective immune response in a mammal by injecting a DNA sequence
US5808003A (en) 1989-05-26 1998-09-15 Perimmune Holdings, Inc. Polyaminocarboxylate chelators
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
WO1991000360A1 (en) 1989-06-29 1991-01-10 Medarex, Inc. Bispecific reagents for aids therapy
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5229275A (en) 1990-04-26 1993-07-20 Akzo N.V. In-vitro method for producing antigen-specific human monoclonal antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5199942A (en) 1991-06-07 1993-04-06 Immunex Corporation Method for improving autologous transplantation
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
US5428139A (en) 1991-12-10 1995-06-27 The Dow Chemical Company Bicyclopolyazamacrocyclophosphonic acid complexes for use as radiopharmaceuticals
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
WO1993021232A1 (en) 1992-04-10 1993-10-28 Research Development Foundation IMMUNOTOXINS DIRECTED AGAINST c-erbB-2 (HER-2/neu) RELATED SURFACE ANTIGENS
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US5505931A (en) 1993-03-04 1996-04-09 The Dow Chemical Company Acid cleavable compounds, their preparation and use as bifunctional acid-labile crosslinking agents
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6905681B1 (en) 1994-06-03 2005-06-14 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US7642228B2 (en) 1995-03-01 2010-01-05 Genentech, Inc. Method for making heteromultimeric polypeptides
US5821333A (en) 1995-03-01 1998-10-13 Genetech, Inc. Method for making heteromultimeric polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
WO1996034103A1 (en) 1995-04-25 1996-10-31 Vrije Universiteit Brussel Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
US7172869B2 (en) 1995-05-04 2007-02-06 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
WO1997004801A1 (en) 1995-07-27 1997-02-13 Genentech, Inc. Stabile isotonic lyophilized protein formulation
WO1997017852A1 (de) 1995-11-15 1997-05-22 Hoechst Schering Agrevo Gmbh Synergistische herbizide mischungen
WO1997030087A1 (en) 1996-02-16 1997-08-21 Glaxo Group Limited Preparation of glycosylated antibodies
WO1998056418A1 (en) 1997-06-13 1998-12-17 Genentech, Inc. Stabilized antibody formulation
WO1998058964A1 (en) 1997-06-24 1998-12-30 Genentech, Inc. Methods and compositions for galactosylated glycoproteins
WO1999022764A1 (en) 1997-10-31 1999-05-14 Genentech, Inc. Methods and compositions comprising glycoprotein glycoforms
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
WO1999054440A1 (en) 1998-04-21 1999-10-28 Micromet Gesellschaft Für Biomedizinische Forschung Mbh CD19xCD3 SPECIFIC POLYPEPTIDES AND USES THEREOF
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
US7332581B2 (en) 1999-01-15 2008-02-19 Genentech, Inc. Polypeptide variants with altered effector function
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
WO2001029058A1 (en) 1999-10-15 2001-04-26 University Of Massachusetts Rna interference pathway genes as tools for targeted genetic interference
WO2001029246A1 (fr) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Procede de production d'un polypeptide
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
WO2001096584A2 (en) 2000-06-12 2001-12-20 Akkadix Corporation Materials and methods for the control of nematodes
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
US7556928B2 (en) 2001-05-26 2009-07-07 One Cell Systems, Inc. Method of screening a population of cells
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
US20040110704A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells of which genome is modified
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
EP1391213A1 (en) 2002-08-21 2004-02-25 Boehringer Ingelheim International GmbH Compositions and methods for treating cancer using maytansinoid CD44 antibody immunoconjugates and chemotherapeutic agents
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
WO2005035586A1 (ja) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. 融合蛋白質組成物
WO2005035778A1 (ja) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法
US20050123546A1 (en) 2003-11-05 2005-06-09 Glycart Biotechnology Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
WO2005053742A1 (ja) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. 抗体組成物を含有する医薬
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
WO2008077546A1 (en) 2006-12-22 2008-07-03 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor i receptor and uses thereof
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
WO2009012394A1 (en) * 2007-07-17 2009-01-22 Medarex, Inc. Monoclonal antibodies against glypican-3
WO2009067800A1 (en) 2007-11-27 2009-06-04 Viventia Biotech Inc. Antibodies against a cancer-associated epitope of variant nfkbib and uses thereof
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2011056983A1 (en) 2009-11-05 2011-05-12 Genentech, Inc. Zirconium-radiolabeled, cysteine engineered antibody conjugates
WO2011133886A2 (en) 2010-04-23 2011-10-27 Genentech, Inc. Production of heteromultimeric proteins
US20110287009A1 (en) 2010-04-23 2011-11-24 Genentech, Inc. Production of Heteromultimeric Proteins
US20150368340A1 (en) * 2011-04-19 2015-12-24 The United States of America, as Represented by the Secretary, Department of Health and Human Services Human monoclonal antibodies specific for glypican-3 and use thereof
US20140170114A1 (en) 2011-11-08 2014-06-19 The Trustees Of The University Of Pennsylvania Glypican-3-specific antibody and uses thereof
WO2013181543A1 (en) * 2012-06-01 2013-12-05 The United States Of America, As Represented By The Secretary, Dept. Of Health And Human Services High-affinity monoclonal antibodies to glypican-3 and use thereof
US20160000842A1 (en) * 2013-03-05 2016-01-07 Baylor College Of Medicine Oncolytic virus
US20140322129A1 (en) 2013-03-14 2014-10-30 Genentech, Inc. Anti-b7-h4 antibodies and immunoconjugates
WO2016049459A1 (en) * 2014-09-26 2016-03-31 Baylor College Of Medicine Glypican-3 specific chimeric antigen receptors for adoptive immunotherapy

Non-Patent Citations (153)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", 1980
ABHINANDAN AND MARTIN, MOL. IMMUNOL., vol. 45, 2008, pages 3832 - 3839
ABHINANDANMARTIN, MOL. IMMUNOL., vol. 45, 2008, pages 3832 - 3839
ADOLF-BRYFOGLE J. ET AL., NUCLEIC ACIDS RES., vol. 43, 2015, pages 413 - 422
AL-LAZIKANI B. ET AL., J. MOL. BIOL., vol. 273, 1997, pages 927 - 948
ALTMAN, J.D.DAVIS, M.M., CURRENT PROTOCOLS IN IMMUNOLOGY, vol. 248, no. 3, 2003, pages 467 - 498
BALDWIN ET AL., LANCET, 15 March 1986 (1986-03-15), pages 603 - 605
BAUMHOER D ET AL., AM J CLIN PATHOL., 2008
BERG ET AL., TRANSPLANT PROC., vol. 30, no. 8, 1998, pages 3975 - 3977
BOERNER ET AL., J. IMMUNOL., vol. 147, no. 1, 1991, pages 86 - 95
BRISCHWEIN, K. ET AL., MOL. IMMUNOL., vol. 43, no. 8, 2006, pages 1129 - 1143
BROWN ET AL., CELL, vol. 49, 1987, pages 603 - 612
BRUGGEMANN ET AL., YEAR IN IMMUNOL., vol. 7, 1993, pages 33
BRUGGEMANN, M. ET AL., J. EXP. MED., vol. 166, 1987, pages 1351 - 1361
BURTON, MOLEC IMMUNOL., vol. 22, 1985, pages 161 - 206
BURTON, MOLEC. IMMUNOL., vol. 22, 1985, pages 161 - 206
CAPEL ET AL., IMMUNOMETHODS, vol. 113, 1994, pages 269 - 315
CAPURRO M ET AL., GASTROENTEROLOGY, 2003
CHARI ET AL., CANCER RESEARCH, vol. 52, 1992, pages 127 - 131
CHATAL: "Monoclonal Antibodies in Immunoscintigraphy", 1989, CRC PRESS
CHEADLE ET AL., MOL IMMUNOL, vol. 29, 1992, pages 21 - 30
CHMIELEWSKI, M. ET AL., CANCER RESEARCH, vol. 71, no. 17, 2011, pages 5697 - 5706
CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOWDHURY, METHODS MOL. BIOL., vol. 207, 2008, pages 179 - 196
CLIPSTONE, NACRABTREE, GR., NATURE, vol. 357, no. 6380, 1992, pages 695 - 7
CLYNES ET AL., PNAS (USA), vol. 95, 1998, pages 652 - 656
CLYNES ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656
COLCHER ET AL.: "Use of Monoclonal Antibodies as Radiopharmaceuticals for the Localization of Human Carcinoma Xenografts in Athymic Mice", METH. ENZYMOL., vol. 121, 1986, pages 802 - 16
CRAGG, M. S. ET AL., BLOOD, vol. 101, no. 16, 2003, pages 1045 - 1052
CRAGG, M. S.M. J. GLENNIE, BLOOD, vol. 103, 2004, pages 2738 - 2743
CUNNINGHAMWELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085
DAËRON, ANNU. REV. IMMUNOL., vol. 15, 1997, pages 203 - 234
DALL' ACQUA ET AL., BIOCHEM., vol. 37, 1998, pages 9266 - 9273
DATTA, R. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 1014 - 10153
DAVID ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 1014
DURAND, D., MOLEC. CELL. BIOL., vol. 8, 1988, pages 1715 - 1724
EDGAR, R.C., BMC BIOINFORMATICS, vol. 5, no. 1, 2004, pages 113
EDGAR, R.C., NUCLEIC ACIDS RESEARCH, vol. 32, no. 5, 2004, pages 1792 - 1797
EHRENMANN F. ET AL., NUCLEIC ACIDS RES., vol. 38, 2010, pages 301 - 307
FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472
FERRARA ET AL., BIOTECHNOLOGY AND BIOENGINEERING, vol. 93, no. 5, 2006, pages 851 - 861
FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 826 - 851
FLEMING BDHO M, TOXINS, 2016
FRAKER ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 80, 1978, pages 49 - 57
GARLAND ET AL., J. IMMUNOL. METH., vol. 227, no. 1-2, 1999, pages 53 - 63
GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163
GHETIEWARD, ANNU. REV. IMMUNOL., vol. 18, 2000, pages 739 - 766
GINGRICH ET AL., ANNUAL REV. NEUROSCI, vol. 21, 1998, pages 377 - 405
GRIFFITHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734
GUGHAYUR, METHODS ENZYMOL., vol. 502, 2012, pages 25 - 41
GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587
HAANEN ET AL., J. EXP. MED., vol. 190, no. 9, 1999, pages 13191328
HAAS ET AL., J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 41
HARUYAMA YKATAOKA H, WORLD J GASTROENTEROL., 2016
HELLSTROM, I ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502
HELLSTROM, I. ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063
HINMAN ET AL., CANCER RES., vol. 53, 1993, pages 3336 - 3342
HIPPO Y ET AL., CANCER RES., 2004
HOET, R.M. ET AL., NAT. BIOTECHNOL., vol. 23, no. 3, 2005, pages 344 - 348
HOLLIGER ET AL., PROC. NATL. ACAD. SCI., vol. 90, 1993, pages 6444 - 6448
HONEGGERPLUCKTHUN, J. MOL. BIOL., vol. 309, 2001, pages 657 - 670
HOOGENBOOMWINTER, J. MOL. BIOL., vol. 222, 1991, pages 581
HOOGENBOOMWINTER, J. MOL. BIOL., vol. 227, 1992, pages 381 - 388
HUNTER ET AL., NATURE, vol. 144, 1962, pages 945
IDUSOGIE ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184
ISHIGURO ET AL., CANCER RES, vol. 68, 2008, pages 9832 - 9838
JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258
JAKOBOVITS ET AL., PNAS USA, vol. 90, 1993, pages 2551
JANSEN ET AL., IMMUNOLOGICAL REVIEWS, vol. 62, 1982, pages 185 - 216
JIANG, Y. ET AL., CELL DEATH & DISEASE, vol. 6, no. 6, 2015, pages 1792
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
KABAT ET AL., J. BIOL. CHEM., vol. 252, 1977, pages 6609 - 6616
KABAT ET AL.: "U.S. Dept. of Health and Human Services", SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST, 1991
KAM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 102, 2005, pages 11600 - 11605
KANDA, Y. ET AL., BIOTECHNOL. BIOENG., vol. 94, no. 4, 2006, pages 680 - 688
KILLENLINDSTROM, JOUR. IMMUN., vol. 133, 1984, pages 1335 - 2549
KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249
KIM, JH ET AL., PLOS ONE, vol. 6, no. 4, 2011, pages 18556
KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495
KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553
KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001
LABRIGIN ET AL., PROC. NATL. ACAD. SCI., vol. 110, no. 13, 2013, pages 5145 - 5150
LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132
LEFRANC M.P. ET AL., DEV. COMP. IMMUNOL., vol. 27, 2003, pages 55 - 77
LINDHOFER ET AL., J. IMMUNOL., vol. 155, 1995, pages 219 - 225
LIU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 8618 - 8623
LODE ET AL., CANCER RES., vol. 58, 1998, pages 2928
LONBERG ET AL., NATURE, vol. 368, 1994, pages 812 - 813
LONBERGHUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93
MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745
MACK ET AL., PROC. NATL. ACAD. SCI., vol. 92, 1995, pages 7021 - 7025
MADER, S.WHITE, J. H., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5603 - 5607
MANDLER ET AL., BIOCONJUGATE CHEM., vol. 13, 2002, pages 786 - 791
MANDLER ET AL., BIOORGANIC & MED. CHEM. LETTERS, vol. 10, 2000, pages 1025 - 1028
MANDLER ET AL., J. NAT. CANCER INST., vol. 92, no. 19, 2000, pages 1573 - 1581
MANOME, Y. ET AL., BIOCHEMISTRY, vol. 32, 1993, pages 10607 - 10613
MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783
MCCAFFERTY ET AL., NATURE, vol. 352, 1991, pages 624 - 628
MILSTEINCUELLO, NATURE, vol. 305, 1983, pages 537 - 539
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
MUNSONPOLLARD, ANAL. BIOCHEM., vol. 107, 1980, pages 220
NAKATSURA T ET AL., BIOCHEM BIOPHYS RES COMMUN., 2003
NAKATSURA T ET AL., CLIN CANCER RES., 2004
NEUBERGER ET AL., NATURE, vol. 312, 1984, pages 604 - 608
NICULESCU-DUVAZSPRINGER, ADV. DRG. DEL. REV., vol. 26, 1997, pages 151 - 172
NYGREN, J., HISTOCHEM. AND CYTOCHEM., vol. 30, 1982, pages 407
OKAZAKI ET AL., J. MOL. BIOL., vol. 336, no. 5, 2004, pages 1239 - 1249
PAIN ET AL., J. IMMUNOL. METH., vol. 40, 1981, pages 219
PALUCKABANCHEREAU, NATURE REVIEWS CANCER, vol. 12, 2012, pages 265 - 277
PETKOVA, S. B. ET AL., INT'L. IMMUNOL., vol. 18, no. 12, 2006, pages 1759 - 1769
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
PULLARKAT ET AL., TRENDS BIOTECHNOL., vol. 48, 1999, pages 9 - 21
RAAGWHITLOW, FASEB, vol. 9, no. 1, 1995, pages 73 - 80
RAMAKRISHNAN, S. ET AL., CANCER RES., vol. 44, 1984, pages 201 - 208
RAVETCHKINET, ANNU. REV. IMMUNOL, vol. 9, 1991, pages 457 - 92
RAVETCHKINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492
RIDGWAY ET AL., PROTEIN ENG., vol. 9, no. 7, 1996, pages 617 - 621
RIECHMANN ET AL., NATURE, vol. 322, 1988, pages 738 - 327
RIPKA ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 249, 1986, pages 533 - 545
ROSENBERG ET AL., NEW ENG. J. OF MED., vol. 319, 1988, pages 1676
ROSSI ET AL., PROC. NATL. ACAD. SCI., vol. 103, 2006, pages 6841 - 6846
ROWLAND ET AL., CANCER IMMUNOL. IMMUNOTHER, vol. 21, 1986, pages 183 - 187
SANJ ANA ET AL., NAT METHODS., vol. 11, 2014, pages 783 - 784
SCHERAGA, REV. COMPUTATIONAL CHEM., vol. 11, 1992, pages 173 - 142
See also references of EP3615574A4
SHANS WONG: "Chemistry of Protein Conjugation and Crosslinking", 1991, CRC PRESS
SHIELDS ET AL., J BIOL. CHEM., vol. 178, no. 2, 2001, pages 6591 - 6604
SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604
SHIRAKAWA H ET AL., CANCER SCI., 2009
SHOJI-HOSAKA ET AL., J. BIOCHEM., vol. 140, 2006, pages 777 - 83
SPENCER, D. M. ET AL., SCIENCE, vol. 262, 1993, pages 1019 - 1024
STADLMANN S ET AL., INT J GYNECOL PATHOL., 2007
SURESH ET AL., METHODS IN ENZYMOLOGY, vol. 121, 1986, pages 210 - 103
SYRIGOSEPENETOS, ANTICANCER RESEARCH, vol. 19, 1999, pages 605 - 614
THORPE ET AL.: "Monoclonal Antibodies '84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", pages: 475 - 506
TOMIMATSU, K. ET AL., BIOSCI. BIOTECHNOL. BIOCHEM., vol. 73, no. 7, 2009, pages 1465 - 1469
TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655
TRAUNECKER ET AL., EMBO, vol. 10, 1991, pages 3655 - 3659
UI-TEL ET AL., 2000 FEBS LETTERS, vol. 479, pages 79 - 82
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536
VERI ET AL., ARTHRITIS RHEUM., vol. 62, no. 7, 2010, pages 1933 - 1943
VITETTA ET AL., SCIENCE, vol. 238, 1987, pages 1098
WANG L ET AL., HEPATOBILIARY PANCREAT DIS INT., 2015
WENSELMEARES: "Radioimmunoimaging And Radioimmunotherapy", 1983, ELSEVIER
WHERRY, E. J., NATURE IMMUNOLOGY, vol. 12, no. 6, 2011, pages 492 - 499
WINTER ET AL., ANN. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455
WRIGHT ET AL., TIBTECH, vol. 15, 1997, pages 26 - 32
YAMANE-OHNUKI ET AL., BIOTECH. BIOENG., vol. 87, 2004, pages 614
YAMAUCHI N ET AL., MODERN PATHOLOGY, 2005
YE J. ET AL., NUCLEIC ACIDS RESEARCH, vol. 41, 2013, pages 34 - 40
YU X ET AL., GENET MOL RES., 2015
ZHANG, L. ET AL., MOLECULAR THERAPY, vol. 19, no. 4, 2011, pages 751 - 759
ZYNGER DL ET AL., AM J SURG PATHOL., 2006

Cited By (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11976105B2 (en) 2015-10-23 2024-05-07 Eureka Therapeutics, Inc. Antibody/T-cell receptor chimeric constructs and uses thereof
US11965021B2 (en) 2017-04-26 2024-04-23 Eureka Therapeutics, Inc. Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
US11708401B2 (en) 2018-06-22 2023-07-25 Kite Pharma, Inc. Chimeric transmembrane proteins and uses thereof
US20210388109A1 (en) * 2018-10-01 2021-12-16 Adicet Bio, Inc. Compositions and methods regarding engineered and non-engineered gamma delta t-cells for treatment of solid tumors
US20220064327A1 (en) * 2018-12-21 2022-03-03 Kymab Limited Fixaxfx bispecific antibody with common light chain
WO2020156554A1 (zh) * 2019-02-01 2020-08-06 科济生物医药(上海)有限公司 Tcr融合蛋白及表达tcr融合蛋白的细胞
EP3965897A4 (en) * 2019-05-07 2023-01-04 The Board of Trustees of the Leland Stanford Junior University CHEMERA ANTIGEN RECEPTORS TARGETING GLYPICAN-2
US12109235B2 (en) 2019-06-21 2024-10-08 Kite Pharma, Inc. TGF-beta receptors and methods of use
US20230058044A1 (en) * 2019-11-26 2023-02-23 Ramot At Tel-Aviv University Ltd. Chimeric antigen receptor to carbohydrate antigens
CN114901301A (zh) * 2019-12-20 2022-08-12 免疫医疗有限责任公司 用靶向磷脂酰肌醇蛋白聚糖3的嵌合抗原受体治疗癌症的组合物和方法
JP2023507369A (ja) * 2019-12-20 2023-02-22 メディミューン,エルエルシー グリピカン3を標的とするキメラ抗原受容体を用いて癌を治療する組成物及び方法
JP7822313B2 (ja) 2019-12-20 2026-03-02 メディミューン,エルエルシー グリピカン3を標的とするキメラ抗原受容体を用いて癌を治療する組成物及び方法
US20230183312A1 (en) * 2020-02-14 2023-06-15 The Board Of Trustees Of The Leland Stanford Junior University Chimeric antigen receptors with cd2 activation
JP2023516286A (ja) * 2020-02-27 2023-04-19 ナンジン レジェンド バイオテック シーオー., エルティーディー. グリピカン-3(gpc3)を標的化する抗体及びキメラ抗原受容体並びにその使用方法
JP7747645B2 (ja) 2020-02-27 2025-10-01 レジェンド バイオテック アイルランド リミテッド グリピカン-3(gpc3)を標的化する抗体及びキメラ抗原受容体並びにその使用方法
EP4121517A4 (en) * 2020-03-18 2024-08-07 Eutilex Co., Ltd. IL-18-SECRETING GPC3 CAR-T CELLS AND METHODS OF MAKING AND USING THE SAME
JP2023525991A (ja) * 2020-05-07 2023-06-20 フェインズ セラピューティクス,インコーポレーテッド 抗腫瘍関連抗原抗体及びその使用
EP4146702A4 (en) * 2020-05-07 2024-07-10 Phanes Therapeutics, Inc. Anti-tumor associated antigen antibodies and uses thereof
JP7821121B2 (ja) 2020-05-07 2026-02-26 フェインズ セラピューティクス,インコーポレーテッド 抗腫瘍関連抗原抗体及びその使用
WO2022216744A3 (en) * 2021-04-05 2022-11-17 Cytovia Therapeutics, Llc. Bispecific antibodies targeting nkp46 and gpc3 and methods of use thereof
EP4326780A4 (en) * 2021-04-23 2025-02-26 Shanghai Henlius Biotech, Inc. Anti-gpc3 antibodies, multispecific antibodies and methods of use
WO2022242682A1 (en) * 2021-05-21 2022-11-24 Beigene, Ltd. Anti-gpc3 and anti-cd137 multispecific antibodies and methods of use
US12540196B2 (en) 2021-06-08 2026-02-03 Kite Pharma, Inc. GPC3 binding molecules
WO2023215738A1 (en) * 2022-05-02 2023-11-09 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Compositions targeting gpc2 and gpc3 and their use for treating solid tumors
WO2024020429A1 (en) * 2022-07-22 2024-01-25 Lyell Immunopharma, Inc. Immune cell therapy
WO2024109678A1 (en) * 2022-11-21 2024-05-30 Beigene, Ltd. Anti-cd137 antibodies and methods of use

Also Published As

Publication number Publication date
JP7295030B2 (ja) 2023-06-20
AU2018258049B2 (en) 2025-03-27
CA3059820A1 (en) 2018-11-01
MY201065A (en) 2024-02-01
IL319308A (en) 2025-04-01
KR102663596B1 (ko) 2024-05-10
US20230048360A1 (en) 2023-02-16
US20210107992A1 (en) 2021-04-15
CN110741019B (zh) 2025-06-13
MX420947B (es) 2025-02-10
SG11201909728XA (en) 2019-11-28
WO2018200586A9 (en) 2019-11-28
IL270138B2 (en) 2025-08-01
IL270138A (en) 2019-12-31
JP2020517294A (ja) 2020-06-18
EP3615574A4 (en) 2021-02-24
IL270138B1 (en) 2025-04-01
SG10201913582XA (en) 2020-02-27
PH12019502412A1 (en) 2020-09-14
TWI878207B (zh) 2025-04-01
US12479924B2 (en) 2025-11-25
CN110741019A (zh) 2020-01-31
TW201902929A (zh) 2019-01-16
KR20240067275A (ko) 2024-05-16
JP2023123540A (ja) 2023-09-05
MX2024009388A (es) 2024-08-13
EP3615574A1 (en) 2020-03-04
AU2018258049A1 (en) 2019-12-12
KR20200012860A (ko) 2020-02-05
ZA202000027B (en) 2023-10-25
US11447564B2 (en) 2022-09-20

Similar Documents

Publication Publication Date Title
US12479924B2 (en) Constructs specifically recognizing Glypican 3 and uses thereof
US10011658B2 (en) Constructs targeting AFP peptide/MHC complexes and uses thereof
US20250011463A1 (en) Constructs targeting prostate-specific membrane antigen (psma) and uses thereof
US20190382504A1 (en) Constructs targeting ny-eso-1 peptide/mhc complexes and uses thereof
EP3294328A1 (en) Constructs targeting hpv16-e7 peptide/mhc complexes and uses thereof
US11274157B2 (en) Constructs targeting histone H3 peptide/MHC complexes and uses thereof
WO2017015634A2 (en) Constructs targeting psa peptide/mhc complexes and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18791195

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3059820

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019558615

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20197034685

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018791195

Country of ref document: EP

Effective date: 20191126

ENP Entry into the national phase

Ref document number: 2018258049

Country of ref document: AU

Date of ref document: 20180424

Kind code of ref document: A

WWG Wipo information: grant in national office

Ref document number: MX/A/2019/012133

Country of ref document: MX

WWD Wipo information: divisional of initial pct application

Ref document number: 319308

Country of ref document: IL

WWG Wipo information: grant in national office

Ref document number: 201880027827.8

Country of ref document: CN