WO2018193119A1 - Gene therapy - Google Patents
Gene therapy Download PDFInfo
- Publication number
- WO2018193119A1 WO2018193119A1 PCT/EP2018/060238 EP2018060238W WO2018193119A1 WO 2018193119 A1 WO2018193119 A1 WO 2018193119A1 EP 2018060238 W EP2018060238 W EP 2018060238W WO 2018193119 A1 WO2018193119 A1 WO 2018193119A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cell
- monocyte
- ifn
- mir
- cancer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/28—Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
- A61K31/403—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
- A61K31/404—Indoles, e.g. pindolol
- A61K31/405—Indole-alkanecarboxylic acids; Derivatives thereof, e.g. tryptophan, indomethacin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/21—Interferons [IFN]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/21—Interferons [IFN]
- A61K38/212—IFN-alpha
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4231—Cytokines
- A61K40/4232—Tumor necrosis factors [TNF] or CD70
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
- A61K48/0058—Nucleic acids adapted for tissue specific expression, e.g. having tissue specific promoters as part of a contruct
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0083—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the administration regime
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0645—Macrophages, e.g. Kuepfer cells in the liver; Monocytes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0647—Haematopoietic stem cells; Uncommitted or multipotent progenitors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2207/00—Modified animals
- A01K2207/12—Animals modified by administration of exogenous cells
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/105—Murine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/0331—Animal model for proliferative diseases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55522—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
- C12N2510/02—Cells for production
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2840/00—Vectors comprising a special translation-regulating system
- C12N2840/007—Vectors comprising a special translation-regulating system cell or tissue specific
Definitions
- the present invention relates to the use of cytokine gene therapy, in particular interferon (e.g. interferon-alpha or -gamma) gene therapy, optionally in combination with an immune checkpoint inhibitor, a tumor associated antigen (TAA)-specific T-cell and/or 1-methyl- tryptophan (1 -MT) for treating or preventing cancer.
- interferon e.g. interferon-alpha or -gamma
- TAA tumor associated antigen-specific T-cell
- 1-methyl- tryptophan 1-methyl- tryptophan
- Immunotherapy has recently gained renewed interest as anticancer treatment, due to its potential to induce long-lasting remission.
- An increased understanding of the mechanisms co-opted by cancer cells to evade immune response has led to the development of novel therapeutics targeting immune checkpoints, thereby unleashing the power of the immune system 1 .
- Clinical testing of these drugs has led to unprecedented rates of durable responses in tumors previously considered invariably lethal, such as metastatic melanoma 2,3 .
- a large fraction of patients do not respond to these therapies, either due to the failure to generate tumor-specific T cells or the existence of an immunosuppressive tumor microenvironment, which imparts resistance to blockade of the classical negative checkpoints, CTLA4 or PD1/PDL14.
- IFNs interferons
- DCs dendritic cells
- NK natural killer cells
- TCR transgenic T cell receptor
- CAR chimeric antigen receptor
- TAA tumor-associated antigen
- B-ALL B cell acute lymphoblastic leukemia
- the present invention achieves this need by establishing that improved efficacy can be achieved when a cytokine such as IFNa delivered by gene therapy is used in combination with other immunotherapeutic strategies.
- a cytokine such as an interferon delivered by gene therapy can boost the induction, consolidation and maintenance of anti-tumor responses and synergize with other immunotherapeutic strategies, in particular treatment with immune checkpoint inhibitors and treatment with tumor associated antigen (TAA)- specific T-cells.
- TAA tumor associated antigen
- a hematopoietic stem cell HSC
- HPC hematopoietic progenitor cell
- myeloid/monocyte-committed progenitor cell a macrophage or a monocyte
- the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor.
- a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte- committed progenitor cell, the macrophage or the monocyte is used in combination with a tumor associated antigen (TAA)-specific T-cell.
- TAA tumor associated antigen
- a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte- committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor and a TAA-specific T-cell.
- a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte- committed progenitor cell, the macrophage or the monocyte is used in combination with 1- methyl-tryptophan (1-MT).
- 1-MT 1- methyl-tryptophan
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the vector is used in combination with an immune checkpoint inhibitor.
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the vector is used in combination with a TAA-specific T-cell.
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the vector is used in combination with an immune checkpoint inhibitor and a TAA-specific T- cell.
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the vector is used in combination with 1 -methyl-tryptophan (1-MT).
- a TAA-specific T-cell expressing a CAR and/or a transgenic TCR for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- an immune checkpoint inhibitor for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- an immune checkpoint inhibitor for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a vector comprising at least one mir-130a and/or mir- 126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- 1 -methyl-tryptophan for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- 1 -methyl-tryptophan for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- a combination of an immune checkpoint inhibitor and a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- an immune checkpoint inhibitor and a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- a method for treating or preventing a cancer which comprises administering a HSC, a HPC, a myeloid/monocyte- committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine to a patient in need thereof, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor and/or a TAA-specific T-cell.
- a method for treating or preventing a cancer which comprises administering a vector comprising at least one mir- 130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine to a patient in need thereof, wherein the vector is used in combination with an immune checkpoint inhibitor and/or a TAA-specific T-cell.
- a method for treating or preventing a cancer in a patient previously administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, which method comprises administering to the patient a TAA-specific T-cell, and/or administering to the patient an immune checkpoint inhibitor.
- a method for treating and/or preventing a cancer in a patient previously administered with a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine which comprises the step of administering to the patient a TAA-specific T-cell, and/or the step of administering to the patient an immune checkpoint inhibitor.
- a method for treating or preventing a cancer which comprises administering a HSC, a HPC, a myeloid/monocyte- committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine to a patient in need thereof, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with 1-methyl-tryptophan (1-MT).
- a method for treating or preventing a cancer which comprises administering a vector comprising at least one mir- 130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine to a patient in need thereof, wherein the vector is used in combination with 1 - methyl-tryptophan (1-MT).
- a method for treating or preventing a cancer in a patient previously administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, which method comprises administering to the patient 1-methyl-tryptophan (1 -MT).
- a method for treating and/or preventing a cancer in a patient previously administered with a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine which comprises the step of administering to the patient 1-methyl- tryptophan (1 -MT).
- a hematopoietic stem cell HSC
- HPC hematopoietic progenitor cell
- myeloid/monocyte-committed progenitor cell a macrophage or a monocyte
- a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor.
- a HSC a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte
- a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with a tumor associated antigen (TAA)-specific T-cell.
- TAA tumor associated antigen
- a HSC a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte
- a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor and a TAA-specific T-cell.
- a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with 1-methyl-tryptophan (1-MT).
- 1-methyl-tryptophan (1-MT 1-methyl-tryptophan
- a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the polynucleotide is used in combination with an immune checkpoint inhibitor.
- a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the polynucleotide is used in combination with a TAA-specific T-cell.
- a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the polynucleotide is used in combination with an immune checkpoint inhibitor and a TAA-specific T-cell.
- a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the polynucleotide is used in combination with 1 -methyl-tryptophan (1 -MT).
- a TAA-specific T-cell expressing a CAR and/or a transgenic TCR for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- an immune checkpoint inhibitor for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- an immune checkpoint inhibitor for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- 1 -methyl-tryptophan for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- 1 -methyl-tryptophan for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- a combination of an immune checkpoint inhibitor and a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- an immune checkpoint inhibitor and a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine.
- a method for treating or preventing a cancer which comprises administering a HSC, a HPC, a myeloid/monocyte- committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine to a patient in need thereof, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor and/or a TAA-specific T-cell.
- a method for treating or preventing a cancer which comprises administering a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine to a patient in need thereof, wherein the polynucleotide is used in combination with an immune checkpoint inhibitor and/or a TAA-specific T-cell.
- a method for treating or preventing a cancer in a patient previously administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, which method comprises administering to the patient a TAA-specific T-cell, and/or administering to the patient an immune checkpoint inhibitor.
- a method for treating and/or preventing a cancer in a patient previously administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine which comprises the step of administering to the patient a TAA-specific T-cell, and/or the step of administering to the patient an immune checkpoint inhibitor.
- a method for treating or preventing a cancer which comprises administering a HSC, a HPC, a myeloid/monocyte- committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine to a patient in need thereof, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with 1-methyl-tryptophan (1 -MT).
- a method for treating or preventing a cancer which comprises administering a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine to a patient in need thereof, wherein the polynucleotide is used in combination with 1-methyl-tryptophan (1-MT).
- a method for treating or preventing a cancer in a patient previously administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, which method comprises administering to the patient 1-methyl-tryptophan (1-MT).
- a method for treating and/or preventing a cancer in a patient previously administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine which comprises the step of administering to the patient 1 -methyl-tryptophan (1-MT).
- a hematopoietic stem cell HSC
- HPC hematopoietic progenitor cell
- myeloid/monocyte-committed progenitor cell a macrophage or a monocyte
- the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon (I FN) for use in treating or preventing a cancer in a patient
- I FN type 1 interferon
- a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte- committed progenitor cell, the macrophage or the monocyte is used in combination with a tumor associated antigen (TAA)-specific T-cell.
- TAA tumor associated antigen
- a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte- committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor and a TAA-specific T-cell.
- a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte- committed progenitor cell, the macrophage or the monocyte is used in combination with 1- methyl-tryptophan (1-MT).
- 1-MT 1- methyl-tryptophan
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon for use in treating or preventing a cancer in a patient, wherein the vector is used in combination with an immune checkpoint inhibitor.
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon for use in treating or preventing a cancer in a patient, wherein the vector is used in combination with a TAA-specific T-cell.
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon for use in treating or preventing a cancer in a patient, wherein the vector is used in combination with an immune checkpoint inhibitor and a TAA- specific T-cell.
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon for use in treating or preventing a cancer in a patient, wherein the vector is used in combination with 1 -methyl-tryptophan (1-MT).
- a TAA-specific T-cell expressing a CAR and/or a transgenic TCR for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- an immune checkpoint inhibitor for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- an immune checkpoint inhibitor for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a vector comprising at least one mir-130a and/or mir- 126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- 1 -methyl-tryptophan for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon.
- 1 -methyl-tryptophan for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon.
- a combination of an immune checkpoint inhibitor and a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- an immune checkpoint inhibitor and a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- a method for treating or preventing a cancer which comprises administering a HSC, a HPC, a myeloid/monocyte- committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon to a patient in need thereof, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor and/or a TAA-specific T-cell.
- a method for treating or preventing a cancer which comprises administering a vector comprising at least one mir- 130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon to a patient in need thereof, wherein the vector is used in combination with an immune checkpoint inhibitor and/or a TAA-specific T-cell.
- a method for treating or preventing a cancer in a patient previously administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon, which method comprises administering to the patient a TAA-specific T-cell, and/or administering to the patient an immune checkpoint inhibitor.
- a method for treating and/or preventing a cancer in a patient previously administered with a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon which comprises the step of administering to the patient a TAA- specific T-cell, and/or the step of administering to the patient an immune checkpoint inhibitor.
- a method for treating or preventing a cancer which comprises administering a HSC, a HPC, a myeloid/monocyte- committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon to a patient in need thereof, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with 1-methyl-tryptophan (1-MT).
- a method for treating or preventing a cancer which comprises administering a vector comprising at least one mir- 130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon to a patient in need thereof, wherein the vector is used in combination with 1 - methyl-tryptophan (1-MT).
- a method for treating or preventing a cancer in a patient previously administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon, which method comprises administering to the patient 1-methyl-tryptophan (1 -MT).
- a method for treating and/or preventing a cancer in a patient previously administered with a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon which comprises the step of administering to the patient 1-methyl- tryptophan (1 -MT).
- a hematopoietic stem cell HSC
- HPC hematopoietic progenitor cell
- myeloid/monocyte-committed progenitor cell a macrophage or a monocyte
- a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon (I FN) for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte- committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor.
- I FN type 1 interferon
- a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with a tumor associated antigen (TAA)-specific T-cell.
- TAA tumor associated antigen
- a HSC a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte
- a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon for use in treating or preventing a cancer in a patient
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor and a TAA-specific T-cell.
- a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with 1-methyl-tryptophan (1-MT).
- 1-methyl-tryptophan (1-MT 1-methyl-tryptophan
- a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon for use in treating or preventing a cancer in a patient, wherein the polynucleotide is used in combination with an immune checkpoint inhibitor.
- a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon for use in treating or preventing a cancer in a patient, wherein the polynucleotide is used in combination with a TAA-specific T-cell.
- a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon for use in treating or preventing a cancer in a patient, wherein the polynucleotide is used in combination with an immune checkpoint inhibitor and a TAA-specific T-cell.
- a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon for use in treating or preventing a cancer in a patient, wherein the polynucleotide is used in combination with 1 -methyl-tryptophan (1 -MT).
- a TAA-specific T-cell expressing a CAR and/or a transgenic TCR for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- an immune checkpoint inhibitor for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- an immune checkpoint inhibitor for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- 1 -methyl-tryptophan for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon.
- 1 -methyl-tryptophan for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon.
- a combination of an immune checkpoint inhibitor and a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- an immune checkpoint inhibitor and a TAA-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon.
- a method for treating or preventing a cancer which comprises administering a HSC, a HPC, a myeloid/monocyte- committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon to a patient in need thereof, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor and/or a TAA-specific T-cell.
- a method for treating or preventing a cancer which comprises administering a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon to a patient in need thereof, wherein the polynucleotide is used in combination with an immune checkpoint inhibitor and/or a TAA-specific T-cell.
- a method for treating or preventing a cancer in a patient previously administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon, which method comprises administering to the patient a TAA-specific T-cell, and/or administering to the patient an immune checkpoint inhibitor.
- a method for treating and/or preventing a cancer in a patient previously administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a type 1 interferon which comprises the step of administering to the patient a TAA-specific T-cell, and/or the step of administering to the patient an immune checkpoint inhibitor.
- a method for treating or preventing a cancer which comprises administering a HSC, a HPC, a myeloid/monocyte- committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon to a patient in need thereof, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with 1 -methyl-tryptophan (1-MT).
- a method for treating or preventing a cancer which comprises administering a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon to a patient in need thereof, wherein the polynucleotide is used in combination with 1-methyl-tryptophan (1-MT).
- a method for treating or preventing a cancer in a patient previously administered with a HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a polynucleotide wherein the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon, which method comprises administering to the patient 1 -methyl-tryptophan (1-MT).
- a method for treating and/or preventing a cancer in a patient previously administered with a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding an interferon which comprises the step of administering to the patient 1-methyl-tryptophan (1 -MT).
- the TAA-specific T-cell expresses a chimeric antigen receptor (CAR) and/or a transgenic T-cell receptor (TCR). In one embodiment, the TAA-specific T-cell expresses a CAR. In one embodiment, the TAA-specific T-cell expresses a transgenic TCR.
- CAR chimeric antigen receptor
- TCR transgenic T-cell receptor
- the present invention may use a T-cell engineered to express a TAA-specific CAR or TCR.
- the cytokine is an interferon (IFN), IL-12 or granulocyte-macrophage colony-stimulating factor (GM-CSF).
- IFN interferon
- IL-12 IL-12
- GM-CSF granulocyte-macrophage colony-stimulating factor
- the cytokine is an interferon (IFN).
- IFN interferon
- the cytokine is a type I interferon or a type II interferon.
- the cytokine is IFNa.
- the cytokine is interferon-gamma (IFNy).
- the type 1 interferon is interferon-alpha (IFNa) or interferon-beta (IFN3).
- the type 1 interferon is IFNa.
- the type 1 interferon is IFNp.
- the type II interferon is interferon-gamma (IFNy).
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage, the monocyte or the vector of the present invention is provided for use in preventing the recurrence of the cancer in the patient.
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage, the monocyte or the vector of the present invention is provided for use in preventing the progression of the cancer in the patient.
- the TAA is selected from any one or more of carcinoembryonic antigen (CEA), estrogen receptor, progesterone receptor, ephrinB2, ROR1 , mesothelin, c-Met, GD- 2, and MAGE A3 TCR, 4-1 BB, adenocarcinoma antigen, alpha-fetoprotein, BAFF, B- lymphoma cell, C242 antigen, carbonic anhydrase 9 (CA-IX), CCR4, CD152, CD200, CD22, CD19, CD22, CD123, CD221 , CD23 (IgE receptor), CD28, CD4, CD40, CD44, CD44 v6, CD51 , CD52, CD56, CD74, CD80, CS
- GD2, GD3, GM2) Le y , CA-125, CA19-9, Epidermal growth factor receptor (EGFR), p185HER2, IL-2 receptor, de2-7 EGFR, Fibroblast activation protein (FAP), Tenascin, metalloproteinases, Endosialin, Carbonic anhydrase, Galectin 9, Aldolase A, elFv4, Tyrosinase, Galectin 4, HERKV-K10, p53, NY-LU-12, Restin, NY-CO-38, MAGE-1 , MAGE-4a, SSX2, NY-ESO-1 , SCP-1 , 707-AP, AFP, ART-4, BAGE, b-catenin/m, Bcr-abl, CAMEL, CAP-1 , CASP-8, CDC27m, CDK4/m, CT, Cyp-B, DAM-6 (MAGE-B2) and DAM-10 (MAGE-B1 ), ELF2M, E
- the TAA is CD19.
- the TAA-specific T-cell expresses a CD19-specific CAR.
- the TAA-specific T-cell is derived from a cell isolated from the patient.
- the TAA-specific T-cell has been engineered to disrupt at least one endogenous gene, preferably wherein the at least one endogenous gene is selected from an endogenous gene encoding a TCR a chain, a TCR ⁇ chain and a major histocompatibility complex (MHC).
- the immune checkpoint inhibitor is an antibody, preferably wherein the immune checkpoint inhibitor antibody is selected from the group consisting of an anti-CTLA4 antibody, an anti-PD1 antibody, an anti-PDL1 antibody, an anti-PDL2 antibody and an anti- LAG-3 antibody.
- the vector comprises at least one mir-130a target sequence and at least one mir-126 target sequence, preferably the vector comprises two mir-130a target sequences and two mir-126 target sequences.
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte used in the present invention comprises at least one mir-130a target sequence and at least one mir-126 target sequence, preferably the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte used in the present invention comprises two mir-130a target sequences and two mir-126 target sequences.
- the vector or the polynucleotide may further comprise a tissue specific promoter operably linked to the nucleotide sequence encoding the cytokine, for example the type 1 interferon.
- tissue specific promoter is the TEK (Tie2) promoter.
- the cancer is a hematological malignancy or a solid tumor, preferably wherein the hematological malignancy is selected from the group consisting of acute myeloid leukemia (AML), lymphoblastic leukemia, acute lymphoblastic leukemia (ALL), myelodysplastic syndromes (MDS), myeloproliferative neoplasms (MPN), primary myelofibrosis, essential thrombocythemia, polycythemia vera, atypical chronic myeloid leukemia, chronic myeloid leukemia (CML), lymphoma, multiple myeloma, non Hodgkin lymphoma, and Hodgkin lymphoma; or preferably wherein the solid tumor is selected from the group consisting of lung cancer, breast cancer, oesophageal cancer, gastric cancer, colon cancer, cholangiocarcinoma, pancreatic cancer, ovarian cancer, head and neck cancers, synovial sarcoma, angio
- the cancer is a metastasis from a primary tumor.
- the cell used in the present invention is a HSC comprising a vector or a polynucleotide, wherein the vector or the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, for example a type 1 interferon.
- the cell used in the present invention is a HPC comprising a vector or a polynucleotide, wherein the vector or the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, for example a type 1 interferon.
- the cell used in the present invention is a myeloid/monocyte-committed progenitor cell comprising a vector or a polynucleotide, wherein the vector or the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, for example a type 1 interferon.
- the cell used in the present invention is a macrophage comprising a vector or a polynucleotide, wherein the vector or the polynucleotide comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, for example a type 1 interferon.
- the cell used in the present invention is a monocyte comprising a vector or a polynucleotide, wherein the vector or the polynucleotide comprises at least one mir- 130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, for example a type 1 interferon.
- a hematopoietic stem cell HSC
- HPC hematopoietic progenitor cell
- myeloid/monocyte-committed progenitor cell a macrophage or a monocyte
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a first cytokine
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a second cytokine for use in treating or preventing a cancer in a patient, wherein the first and second cytokines are different.
- a population of hematopoietic stem cells HSCs
- HPCs hematopoietic progenitor cells
- myeloid/monocyte- committed progenitor cells macrophages or monocytes
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a second cytokine for use in treating or preventing a cancer in a patient wherein the first and second cytokines are different.
- the first cytokine is encoded on a first vector and the second cytokine is encoded on a second vector.
- the first and second cytokines are encoded on the same vector.
- the first cytokine is encoded on a first polynucleotide and the second cytokine is encoded on a second polynucleotide.
- the first and second cytokines are encoded on the same polynucleotide.
- the polynucleotides may be, for example, in the form of a vector.
- the first and second cytokines are each independently selected from an interferon (IFN) or tumour necrosis factor alpha (TNFa),
- IFN interferon
- TNFa tumour necrosis factor alpha
- the first and second cytokines are each independently selected from the group consisting of a type I IFN (preferably IFNa or IFN3), a type II IFN (preferably IFNy) and TNFa.
- the first and second cytokines are each independently selected from the group consisting of IFNa, IFN3, IFNy and TNFa.
- the first cytokine is IFNa and the second cytokine is IFNy.
- the first cytokine is IFNa and the second cytokine is TNFa.
- the first cytokine is IFNy and the second cytokine is TNFa.
- a hematopoietic stem cell HSC
- HPC hematopoietic progenitor cell
- myeloid/monocyte-committed progenitor cell a macrophage or a monocyte
- the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the cytokine is an interferon (IFN) or tumour necrosis factor alpha (TNFa).
- IFN interferon
- TNFa tumour necrosis factor alpha
- a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the cytokine is an interferon (IFN) or tumour necrosis factor alpha (TNFa).
- IFN interferon
- TNFa tumour necrosis factor alpha
- a polynucleotide comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the cytokine is an interferon (IFN) or tumour necrosis factor alpha (TNFa).
- IFN interferon
- TNFa tumour necrosis factor alpha
- the IFN is a type II IFN (preferably IFNy) or a type I IFN (preferably IFNa or IFNp)
- the cytokine is IFNy. In one embodiment, the cytokine is IFNa. In one embodiment, the cytokine is IFNp.
- FIG. 1 Inhibition of OVA-ALL growth in IFN mice by induction of OVA-specific CD8+ T cells.
- a Schematic representation of the lentiviral vectors (LV) used to engineer HSC and generate spontaneous B-ALL.
- b Experimental design
- Concanavalin A (ConA) stimulation and T cells from OT-I mice are used as positive controls.
- FIG. 1 Adoptively transferred OT-I T cells expand and contain OVA-ALL in IFN mice.
- FIG. 3 ISG/Th1 primed gene signature and increased classical monocytes and M1 - skewing in IFN mice.
- a Volcano plot showing changes in the expression of a panel of cancer immune genes in the BM and spleen of IFN and CTRL mice before and after OVA-ALL challenge.
- Horizontal dashed lines indicate threshold of significance (FDR ⁇ 0.05).
- Vertical dashed lines indicate genes with 2-fold increased/decreased expression with respect to CTRL mice.
- ISGs are shown in orange, Th1 and T cell activation genes in light blue, genes common to IFN and Th1 responses in green, macrophage and DC activation genes in red, NK cell activation genes in purple, antigen processing genes in blue, leukemia associated genes in grey.
- FIG. 4 IFN cell and gene therapy induces durable anti-cancer responses and when combined with immune checkpoint therapy further improves survival.
- the dashed line indicates the higher median background level seen against the EL4 NGFR target cells.
- Each dot represents a single mouse tested against all four TAAs. i, Clonality and similarity of the TCR-beta CDR repertoire of surviving mice (each arrow represents a mouse) from (f) before OVA-ALL injection (start of the arrow, TO) and 4 days after second tumor re-challenge (tip of the arrow, T2).
- k Survival curve of mice from (g) stratified based on their immune reactivity as assessed by IFNg-ELISPOT assay shown in (j).
- mice shown in red react against 2 or more antigens; mice shown in black react against 1 or no antigens. Note that reactivity against OVA and NGFR count for 1 as their expression is co-regulated by a bidirectional promoter present within a BdLV.
- FIG. 5 Engineered OVA-ALL showed increased immunogenicity as compared to parental ALL.
- a Schematic representation of the bidirectional LV (BdLV) used to generate OVA-ALL with representative plot showing NGFR expression on purified OVA-ALL.
- a Gating strategy used to identify B-ALL (CD19+OFP+) and NGFR expression on ALL in PB of tumor-injected mice,
- Figure 6 Inhibition of OVA-ALL growth in IFN mice and induction of OVA-specific T cells.
- *** P ⁇ 0.001 Mann- Whitney.
- FIG. 8 Adoptive transfer of OT-I T cells in OVA-ALL-injected CTRL, IFN mice and non-tumor bearing C57BI/6 mice.
- Each dot represents a single mouse, c, Gating strategy used to identify adoptively transferred OT-I T cells (CD45.2+) and Lag3 expression on OT-I T cells present in BM and spleen of mice from (a, b).
- OVA-ALL cells are first excluded by gating on OFP-CD8+ T cells.
- CD45.1 and CD45.2 markers are used to distinguish among radio-resistant recipient-derived CD8+ T cells (CD45.1 +), donor-derived CD8+ T cells (CD45.1.2+) and adoptively transferred OT-I T cells (CD45.2+).
- adoptively transferred OT-I T cells are defined as CD8+ T cells and are distinguished from CD8+ recipient-derived T cells (CD45.1 +) by gating on CD45.2+ CD8+ T cells, d, Gating strategy used to identify naive (CD62L+CD44-), central memory (CD62L+CD44+) and effector memory (CD62L-CD44+) adoptively transferred OT-I T cells.
- OT-I T cells are identified as described in (c, OVA-ALL are first excluded by gating on CD19-CD8+ T cells), e, f, Absolute numbers of OVA-ALL (e) (mean ⁇ SEM) and NGFR marker expression (f) on ALL in BM and spleen from mice shown in (a, b) at 3 days upon adoptive transfer of OT-I T cells. Each dot represents a single mouse. ** p ⁇ 0.01 , *** p ⁇ 0.001 , Mann- Whitney (e). Supplementary Figure 6. Gene expression analysis of prototypical Th2 and Treg genes in purified splenic CD4+ T cells.
- FIG. 9 Adoptively transferred OT-I T cells expand and contain OVA-ALL in IFN mice.
- Long-term surviving mice are shown in green. Note that NGFR expression is not shown for surviving mice that eradicate leukemia.
- Each individual mouse is represented as single dot (b, d) or line (a, b).
- f Percentage (mean ⁇ SEM) of PD1 expression on OT-I T cells present in the BM, spleen and lymph nodes of mice shown in (e). Each dot represents a single mouse.
- FIG. 11 Flow cytometric analysis of myeloid cells in the PB and spleen of tumor- bearing and non tumor-injected IFN and CTRL mice.
- Macrophages are identified as CD19-CD1 1 c-Ly6G-F4/80+ cells and further distinguished into MHC-II+ MF and MHC-II- Mf using the lAb (MHC-II) marker.
- MHC-II lAb marker.
- CD19-F4/80-CD1 1 c+MHCII- myeloid cells from the CD19-F4/80- CD1 1 C+MHCII+ dendritic cells.
- FIG. 12 Flow cytometric analysis of myeloid cells in the BM and T regulatory cells in the BM and spleen of tumor-bearing and non tumor-injected IFN and CTRL mice.
- Each dot represents a single mouse.
- Macrophages are identified as CD19-CD1 1 c-Ly6G-F4/80+ cells, dendritic cells (DCs) as CD19-F4/80-CD1 1 c+MHCII+, granulocytes as CD19-F4/80- CD1 1 c-CD1 1 b+Ly6C+Ly6G+, classical monocytes as CD19-F4/80-CD1 1 c- CD1 1 b+Ly6ClowLy6G- and non classical monocytes as CD19-F4/80-CD1 1 c- CD1 1 b+Ly6CLy6G-.
- T regulatory cells are defined as CD3+CD4+CD25+FoxP3+. ** p ⁇ 0.01 , Kruskall- Wallis with adjusted p-value by Dunn's test. Statistics is performed within each individual tissue.
- FIG. 13 Flow cytometric analysis of NK and NKT cells in the spleen of tumor- bearing and non tumor-injected IFN and CTRL mice.
- Each dot represents a single mouse.
- NK cells are identified as CD19-CD3-NK1.1 + and NKT cells as CD19-CD3+NK1.1 +.
- CD1 1 b and CD27 markers we further distinguished among the most immature (CD1 1 b-CD27+), the mature and most cytotoxic and cytokine producers (CD1 1 b+CD27+) and the mature and less cytotoxic and cytokine producers (CD1 1 b+CD27-) NK cells. ** p ⁇ 0.01 , *** p ⁇ 0.001 , Kruskall-Wallis with adjusted p-value by Dunn's test. Statistics is performed within each individual population, c, Percentage (mean ⁇ SEM) of the indicated sub-populations of NK cells in the spleen (top) and BM (bottom) of tumor-free or tumorbearing IFN and CTRL mice from (b).
- Each dot represents a single mouse, d, e, Percentage (mean ⁇ SEM) of NKG2D and NKp46 expression on CD1 1 b+CD27+ (d) and CD1 1 b+CD27-(d, e) NK cells present in the spleen (d) and BM (e) of mice from (b).
- Each dot represents a single mouse. * p ⁇ 0.05, ** p>0.01 , Kruskall-Wallis with adjusted p-value by Dunn's test. Statistics is performed within each individual population.
- Each dot represents a single mouse, e, Representative plot showing the OVA-ALL and parental ALL cells mixed at 1 to 1 ratio before injection in the mice.
- Figure 15 Leukemic growth kinetic in individual mice.
- Each line represents a single mouse.
- FIG. 16 Immune-selection of OVA-negative ALL cells is enhanced in both CTLA4- treated IFN and CTRL mice.
- b Percentage of OVA-specific T cells within CD8+ T cells in the PB of mice from (a). * p ⁇ 0.05, ** p ⁇ 0.01 , **** p ⁇ 0.0001 , nonparametric rank-based method for longitudinal data in factorial experiments, c, Clonality and similarity of the TCR-beta CDR repertoire of tumor- free long-term surviving mice (each arrow represents a mouse) from Figure 4f before OVA- ALL injection (start of the arrow, TO) and at 30 days upon OVA-ALL challenge (tip of the arrow, T1 ).
- IFN gene therapy inhibits ALL growth by activating adaptive immunity.
- FIG. 19 Transcriptional reprogramming of the leukemia TME by IFN gene therapy.
- a,b Volcano plots (left panels) showing differentially expressed genes (abs. log 2 FC>1.5, FDR ⁇ 0.05) up-regulated (green) or down-regulated (orange) in splenic macrophages from tumor-bearing (ALL) vs. control (CTRL) mice (a) or ALL mice treated (IFN+ALL) or not (ALL) with IFN gene therapy (b).
- Bar plots show GO terms enriched in up-regulated (green) or down-regulated (orange) genes from the indicated comparisons.
- Transcriptionally defined clusters and associated cell types (e) are indicated by numbers and colours in the legend.
- Single-cell RNA-Seq data in cells from cluster 1 non- classical monocytes), coloured based on the experimental condition (f).
- g GO terms enriched in the top 100 genes (ranked by log 2 FC) up-regulated (green) or down-regulated (orange) in scRNA-Seq data from cluster 1 (non-classical monocytes) in the indicated comparisons
- h Mean expression (log transformed TPM values, normalized for number of cells) in non-classical monocytes of selected genes for the indicated conditions
- i Minimum spanning tree (MST) analysis of scRNA-Seq data from cluster 1 (non-classical monocytes), after sub-clustering.
- MST Minimum spanning tree
- FIG. 20 IFN gene therapy boosts activation of adoptively transferred CAR19- transduced T cells and enhances survival.
- **** p ⁇ 0.0001 nonparametric rank-based method for longitudinal data in factorial experiments.
- FIG. 22 Bulk RNA-Seq analyses in splenic macrophages.
- b Heatmap of correlation between RNA-Seq datasets in macrophages from the indicated conditions. Numbers indicate calculated coefficients of determination (R 2 ). Samples are ordered based on unsupervised hierarchical clustering.
- Figure 23 Cell type identification in scRNA-Seq data from splenic CD11 b + cells.
- a tSNE plots showing single-cell expression levels of the indicated gene signatures (GS).
- Non-classical monocytes Cd300e, 170001 1 l03Rik, Tspan9, Dmpk, Fxyd2; classical monocytes: Ly6c2, Tarm, Tfec, Psrd , Mmp8; neutrophils: N1f9, Pglyrp4, Nlrp12, Mrgpra2b, Mmp8, Ltf, Amer2, Stfa2l1 , Gm5483; dendritic cells: Adam23, Procr, Mab21 l3, Sucnrl , Fndc5, Rnf186, Flt3, Cd207, Adam1 1 , Apol7c, Htr7; macrophages: Vcaml , Mertk, Actnl , Fcna, Crip2, S
- Colour scale reflects average expression (log transformed TPM) across genes within each signature, b, Heatmap showing expression (scaled log transformed TPM values) of top 20 discriminative genes for each cluster. Selected representative genes for each cluster are shown on the right. Up to 200 single cells are shown for each cluster.
- Figure 24 Leukemia and IFN-induced changes in scRNA-Seq data on splenic CD11 b + cells.
- FIG. 25 Sub-clustering analysis of scRNA-Seq data from non-classical monocytes and gene expression analyses on CD4 T cells.
- a Flow cytometric plots showing OVA-ALL cells (top) and OVA-specific CD8 T cells (bottom) in the spleen from 3 representative ALL-injected CTRL (CTRL + ALL), I FN non responder (IFN + ALL NR) and IFN responder (IFN + ALL R) mice.
- CD1 1 b+ cells from these mice were analysed by scRNA-seq.
- tSNE plots showing sub-cluster of cells within the non-classical monocyte population, coloured based on clustering (top plot) or experimental condition (bottom plot). Circled sub-clusters represent minor sub-clusters with dispersed composition and correspond to those marked by asterisks in Figure 19i.
- FIG. 26 IFN gene therapy boosts activation of CART19 cells.
- a Schematic representation of the bidirectional LV (BdLV) used to transduced mouse T cells and percentage of NGFR expression in un-transduced (UT) and transduced (CART19) CD4 and CD8 T cells prior to infusion in the mice from Figure 20b.
- b Percentage of naive (CD62L+CD44+), central memory (CD62L+CD44+) and effector memory (CD62L-CD44+) UT or CART19 T cells prior to infusion in the mice from Figure 20b.
- c Representative flow cytofluorimetric plot of the IFN + CART19 surviving mouse from Figure 20b showing B cell aplasia in the PB.
- FIG. 27 IFN gene therapy boosts activation of iCART19 cells.
- a Percentage of NGFR expression in un-transduced (UT) and transduced (CART19) CD4 and CD8 T cells prior to infusion in the mice from Figure 20e.
- b Percentage of naive (CD62L+CD44+), central memory (CD62L+CD44+) and effector memory (CD62L-CD44+) UT or CART19 T cells prior to infusion in the mice from Figure 20e.
- a stem cell is able to differentiate into many cell types.
- a cell that is able to differentiate into all cell types is known as totipotent. In mammals, only the zygote and early embryonic cells are totipotent. Stem cells are found in most, if not all, multicellular organisms. They are characterised by the ability to renew themselves through mitotic cell division and differentiate into a diverse range of specialised cell types.
- the two broad types of mammalian stem cells are embryonic stem cells that are isolated from the inner cell mass of blastocysts, and adult stem cells that are found in adult tissues. In a developing embryo, stem cells can differentiate into all of the specialised embryonic tissues.
- HSCs Haematopoietic stem cells
- HSCs are multipotent stem cells that may be found, for example, in peripheral blood, bone marrow and umbilical cord blood. HSCs are capable of self-renewal and differentiation into any blood cell lineage. They are capable of recolonising the entire immune system, and the erythroid and myeloid lineages in all the haematopoietic tissues (such as bone marrow, spleen and thymus). They provide for life-long production of all lineages of haematopoietic cells.
- HPCs Haematopoietic progenitor cells
- stem cells In contrast to stem cells however, they are already far more specific: they are pushed to differentiate into their "target" cell.
- a difference between HSCs and HPCs is that HSCs can replicate indefinitely, whereas HPCs can only divide a limited number of times.
- the present invention may use a mixed population of cells comprising HSCs and HPCs (e.g. a HSPC population).
- a mixed population of cells comprising HSCs and HPCs (e.g. a HSPC population).
- a differentiated cell is a cell which has become more specialised in comparison to a stem cell or progenitor cell. Differentiation occurs during the development of a multicellular organism as the organism changes from a single zygote to a complex system of tissues and cell types. Differentiation is also a common process in adults: adult stem cells divide and create fully-differentiated daughter cells during tissue repair and normal cell turnover. Differentiation dramatically changes a cell's size, shape, membrane potential, metabolic activity and responsiveness to signals. These changes are largely due to highly-controlled modifications in gene expression. In other words a differentiated cell is a cell which has specific structures and performs certain functions due to a developmental process which involves the activation and deactivation of specific genes.
- a differentiated cell includes differentiated cells of the haematopoietic lineage such as monocytes, macrophages, neutrophils, basophils, eosinophils, erythrocytes, megakaryocytes/platelets, dendritic cells, T-cells, B-cells and NK-cells.
- differentiated cells of the haematopoietic lineage can be distinguished from HSCs and HPCs by detection of cell surface molecules which are not expressed or are expressed to a lesser degree on undifferentiated cells (HSCs and HPCs).
- Suitable human lineage markers include CD33, CD13, CD14, CD15 (myeloid), CD19, CD20, CD22, CD79a (B), CD36, CD71 , CD235a (erythroid), CD2, CD3, CD4, CD8 (T), CD56 (NK).
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte used in the present invention is obtained from a tissue sample.
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte can be obtained from adult and foetal peripheral blood, umbilical cord blood, bone marrow, liver or spleen.
- these cells are obtained from peripheral blood or bone marrow. They may be obtained after mobilisation of the cells in vivo by means of growth factor treatment.
- HSC or HPC may be carried out using, for example, G-CSF, plerixaphor or combinations thereof.
- Other agents such as NSAIDs, CXCR2 ligands (Grobeta) and dipeptidyl peptidase inhibitors may also be useful as mobilising agents.
- stem cell growth factors GM-CSF and G-CSF are now performed using stem cells collected from the peripheral blood, rather than from the bone marrow. Collecting peripheral blood stem cells provides a bigger graft, does not require that the donor be subjected to general anaesthesia to collect the graft, results in a shorter time to engraftment and may provide for a lower long-term relapse rate.
- Bone marrow may be collected by standard aspiration methods (either steady-state or after mobilisation), or by using next-generation harvesting tools.
- HSCs may also be derived from induced pluripotent stem cells.
- HSCs are typically of low forward scatter and side scatter profile by flow cytometric procedures. Some are metabolically quiescent, as demonstrated by Rhodamine labelling which allows determination of mitochondrial activity. HSCs may comprise certain cell surface markers such as CD34, CD45, CD133, CD90 and CD49f. They may also be defined as cells lacking the expression of the CD38 and CD45RA cell surface markers. However, expression of some of these markers is dependent upon the developmental stage and tissue-specific context of the HSC. Some HSCs called "side population cells" exclude the Hoechst 33342 dye as detected by flow cytometry. Thus, HSCs have descriptive characteristics that allow for their identification and isolation.
- CD38 is the most established and useful single negative marker for human HSCs.
- Human HSCs may also be negative for lineage markers such as CD2, CD3, CD14, CD16, CD19, CD20, CD24, CD36, CD56, CD66b, CD271 and CD45RA. However, these markers may need to be used in combination for HSC enrichment.
- CD34 and CD133 are the most useful positive markers for HSCs.
- HSCs are also positive for lineage markers such as CD90, CD49f and CD93. However, these markers may need to be used in combination for HSC enrichment.
- the therapeutic population of cells may be CD34 + CD38 " . Further separations may be carried out to obtain, for example, CD34 + CD38 " CD45RA " CD90 + CD49f + cells. miRNA expression
- miRNAs mir-126 and mir-130a in a cell indicates that the cell is a HSC or a HPC. More specifically, mir-126 expression indicates that the cell is a primitive HPC. Mir- 130a expression indicates that the cell is a more primitive HPC.
- Cytokines are a category of small proteins, typically approximately 5-20 kDa in size, that play an important role in cell signalling. Cytokines may include interferons, chemokines, interleukins, lymphokines and tumour necrosis factors, and are produced by a broad range of cells, including macrophages, B lymphocytes, T lymphocytes, mast cells, endothelial cells and fibroblasts.
- Cytokines act through receptors, and have a particularly important role in the immune system, modulating the balance between humoral and cell-based immune responses.
- Cytokines include interferons (IFNs), IL-12 and granulocyte-macrophage colony-stimulating factor (GM-CSF).
- IFNs interferons
- IL-12 IL-12
- GM-CSF granulocyte-macrophage colony-stimulating factor
- IFNs are typically divided into three classes: type I, type II, and type III.
- Type I interferons are a class of cytokines produced by immunes cells (leukocytes, e.g. NK cells, B-cells, T-cells, macrophages etc.). Type I IFNs are referred to as pleiotropic cytokines as they can have a specific IFN effect on multiple cell types.
- the type I IFN is interferon-alpha (IFNa).
- IFNa is also known as IFN- alpha, IFNa, INFa-1/13.
- IFNa amino acid sequence is:
- the nucleotide sequence encoding the type I IFN encodes an IFNa protein comprising the amino acid sequence of SEQ ID NO:6. In one embodiment, the nucleotide sequence encoding the type I IFN encodes an IFNa protein comprising an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO:6, and wherein the functionality of a IFNa protein having the amino acid sequence of SEQ ID NO:6 is substantially maintained.
- An example nucleotide sequence encoding an IFNa is:
- the nucleotide sequence encoding IFNa comprises the nucleotide sequence of SEQ ID NO: 7. In one embodiment, the nucleotide sequence encoding IFNa comprises a nucleotide sequence having at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO:7, wherein said nucleotide sequence encodes a protein having substantially the same function as the protein of SEQ ID NO: 6.
- the type 1 IFN is interferon-beta (IFN3; IFNb).
- IFN3 amino acid sequence is:
- the nucleotide sequence encoding the type I IFN encodes an IFN3 protein comprising the amino acid sequence of SEQ ID NO: 8. In one embodiment, the nucleotide sequence encoding the type I IFN encodes a IFN3 protein comprising an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 8, and wherein the functionality of a IFN3 protein having the amino acid sequence of SEQ ID NO: 8 is substantially maintained.
- An example nucleotide sequence encoding an IFN3 is: gaattctcaggtcgtttgctttcctttgctttctcccaagtcttgtttttacaatttgctt tagtcattcactgaaactttaaaaacattagaaaacctcacagtttgttttc cctattatatatatcataagataggagcttaaataaagagttttagaaactactaaaatg taaatgacataggaaaactgaaagggagaagtgaaagtgggaaattcctctgaatagaga gaggaccatctcatataaataggccatacccacggagaaaggacattcttaactgcaaccttcgaagcctttgctggcacaacaggtagtag
- the nucleotide sequence encoding IFN3 comprises the nucleotide sequence of SEQ ID NO: 9. In one embodiment, the nucleotide sequence encoding IFN3 comprises a nucleotide sequence having at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO:9, wherein said nucleotide sequence encodes a protein having substantially the same function as the IFN3 protein of SEQ ID NO: 8.
- nucleotide sequence encoding type I IFN is codon optimised.
- IFNy amino acid sequence is:
- Amino acids 1-23 of SEQ ID NO: 12 may act as a signal peptide and be cleaved to form a mature protein that is represented by amino acids 24-161 of SEQ ID NO: 12.
- An example mature amino acid sequence of IFNy is:
- the nucleotide sequence encoding the IFNy encodes an IFNy protein comprising the amino acid sequence of SEQ ID NO: 12 or 13. In one embodiment, the nucleotide sequence encoding the IFNy encodes an IFNy protein comprising an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 12 or 13, and wherein the functionality of an IFNy protein having the amino acid sequence of SEQ ID NO: 12 or 13 is substantially maintained.
- IFNy amino acid sequence is:
- the nucleotide sequence encoding the IFNy encodes an IFNy protein comprising the amino acid sequence of SEQ ID NO: 17. In one embodiment, the nucleotide sequence encoding the IFNy encodes an IFNy protein comprising an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 17, and wherein the functionality of an IFNy protein having the amino acid sequence of SEQ ID NO: 17 is substantially maintained.
- An example nucleotide sequence encoding an IFNy is:
- nucleotide sequence encoding a mature form of IFNy is:
- a further example nucleotide sequence encoding an IFNy is:
- the nucleotide sequence encoding IFNy comprises the nucleotide sequence of SEQ ID NO: 14, 15 or 16. In one embodiment, the nucleotide sequence encoding IFNy comprises a nucleotide sequence having at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 14, 15 or 16, wherein said nucleotide sequence encodes a protein having substantially the same function as the protein of SEQ ID NO: 12 or 13.
- a further example nucleotide sequence encoding an IFNy is:
- the nucleotide sequence encoding IFNy comprises the nucleotide sequence of SEQ ID NO: 18. In one embodiment, the nucleotide sequence encoding IFNy comprises a nucleotide sequence having at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 18, wherein said nucleotide sequence encodes a protein having substantially the same function as the protein of SEQ ID NO: 17.
- the nucleotide sequence encoding the IFNy is codon optimised.
- Tumor necrosis factor a is a cytokine that is involved in systemic inflammation. Its primary role is in the regulation of immune cells.
- TNFa is mainly produced by activated macrophages, but is also produced by other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons.
- TNFa amino acid sequence is: MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDE KFPNGLPLI SSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKD NQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAI SYQEKVNLLSAVKSPCPKDTPEG AELKPWYEP IYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
- the nucleotide sequence encoding TNFa encodes a TNFa protein comprising the amino acid sequence of SEQ ID NO: 19. In one embodiment, the nucleotide sequence encoding the TNFa encodes a TNFa protein comprising an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 19, and wherein the functionality of a TNFa protein having the amino acid sequence of SEQ ID NO: 19 is substantially maintained.
- An example nucleotide sequence encoding a TNFa is:
- the nucleotide sequence encoding TNFa comprises the nucleotide sequence of SEQ ID NO: 20. In one embodiment, the nucleotide sequence encoding TNFa comprises a nucleotide sequence having at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 20, wherein said nucleotide sequence encodes a protein having substantially the same function as the protein of SEQ ID NO: 19.
- 1-METHYL-TRYPTOPHAN (1-MT) 1-Methyltryptophan (1-MT) is an inhibitor of the tryptophan catabolic enzyme indoleamine 2,3-dioxygenase (IDO) and has the structure:
- the 1-MT of the present invention can be present as a salt or ester, in particular a pharmaceutically-acceptable salt or ester.
- the 1 -ML is D-1-MT. In one embodiment, the 1 -ML is L-1 -MT. In one embodiment, the 1 -ML is a racemic mixture.
- compositions of the agents of the invention include suitable acid addition or base salts thereof.
- suitable pharmaceutical salts may be found in Berge et al. (1977) J Pharm Sci 66: 1-19.
- the invention also includes where appropriate all enantiomers and tautomers of the agents.
- the skilled person will recognise compounds that possess optical properties (e.g. one or more chiral carbon atoms) or tautomeric characteristics.
- the corresponding enantiomers and/or tautomers may be isolated/prepared by methods known in the art.
- MicroRNA genes are scattered across all human chromosomes, except for the Y chromosome. They can be either located in non-coding regions of the genome or within introns of protein-coding genes. Around 50% of miRNAs appear in clusters which are transcribed as polycistronic primary transcripts. Similar to protein-coding genes, miRNAs are usually transcribed from polymerase-ll promoters, generating a so-called primary miRNA transcript (pri-miRNA). This pri-miRNA is then processed through a series of endonucleolytic cleavage steps, performed by two enzymes belonging to the RNAse Type III family, Drosha and Dicer.
- pri-miRNA primary miRNA transcript
- a stem loop of about 60 nucleotides in length called mirna precursor (pre-mirna)
- pre-mirna a stem loop of about 60 nucleotides in length
- DGCR8 Drosha and DiGeorge syndrome critical region gene
- Dicer performs a double strand cut at the end of the stem loop not defined by the Drosha cut, generating a 19-24 bp duplex, which is composed of the mature miRNA and the opposite strand of the duplex, called miRNA * .
- miRNA * the opposite strand of the duplex
- RISC RNA-induced silencing complex
- MicroRNAs trigger RNAi, very much like small interfering RNAs (siRNA) which are extensively being used for experimental gene knockdown.
- siRNA small interfering RNAs
- the main difference between miRNA and siRNA is their biogenesis.
- the guide strand of the small RNA molecule interacts with mRNA target sequences preferentially found in the 3' untranslated region (3'UTR) of protein-coding genes. It has been shown that nucleotides 2-8 counted from the 5' end of the miRNA, the so-called seed sequence, are essential for triggering RNAi.
- the mRNA is endonucleolytically cleaved by involvement of the Argonaute (Ago) protein, also called “slicer” of the small RNA duplex into the RNA-induced silencing complex (RISC).
- Ago Argonaute protein
- DGRC DiGeorge syndrome critical region gene 8
- TRBP TAR (HIV) RNA binding protein 2
- miRNAs can induce the repression of translation initiation, mark target mRNAs for degradation by deadenylation, or sequester targets into the cytoplasmic P- body.
- RNAi acts through multiple mechanisms leading to translational repression.
- Eukaryotic mRNA degradation mainly occurs through the shortening of the polyA tail at the 3' end of the mRNA, and de-capping at the 5' end, followed by 5'-3' exonuclease digestion and accumulation of the miRNA in discrete cytoplasmic areas, the so called P-bodies, enriched in components of the mRNA decay pathway.
- cytokine such as the type 1 I FN
- expression of the cytokine is regulated by endogenous miRNAs using corresponding miRNA target sequences.
- a miRNA endogenously expressed in a cell prevents or reduces transgene expression in that cell by binding to its corresponding miRNA target sequence positioned in the vector or polynucleotide.
- miRNA target sequences that are useful in the present invention are miRNA target sequences which are expressed in HSCs but which are not expressed extensively in differentiated cells e.g., myeloid cells (including tumor-infiltrating macrophages). This is particularly important since IFNa expression is known to be toxic to HSCs.
- Preferred examples of miRNA target sequences for use in the invention are mir-130a and mir-126.
- mir-126 miRNA Binding of mir-126 miRNA to the mir-126 target sequence blocks expression most effectively in HSC and in cells of the erythroid lineage.
- the mir-126 target sequence is particularly suitable for gene therapy applications relying on robust transgene expression in the myeloid and lymphoid lineage.
- the mir-126 miRNA may have the nucleotide sequence: UCGUACCGUGAGUAAUAAUGCG (SEQ ID NO: 1 ).
- the mir-126 target sequence comprises the nucleotide sequence of GCATTATTACTCACGGTACGA (SEQ ID NO:2).
- the vector or polynucleotide used in the present invention comprises at least one, at least two, or at least three, copies of the nucleotide sequence of SEQ ID NO:2.
- the mir-126 target sequence comprises two copies of the nucleotide sequence of SEQ ID NO: 2.
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte used in the present invention comprise at least one, at least two, or at least three, copies of the nucleotide sequence of SEQ ID NO:2.
- the mir-126 target sequence comprises two copies of the nucleotide sequence of SEQ ID NO: 2.
- the copies mir-126 target sequences may be separated by a spacer sequence.
- the spacer sequence may comprise at least one, at least two, at least three or at least four or at least five nucleotide bases.
- mir-130a miRNA Binding of mir-130a miRNA to the mir-130a target sequence blocks expression most effectively in HSC and in cells of the erythroid lineage (similar to miR-126).
- the miR- 130a target sequence is particularly suitable for gene therapy applications relying on robust transgene expression in the myeloid and lymphoid lineage.
- the mir-130a miRNA may have the nucleotide sequence of: CAGUGCAAUGUUAAAAGGGCAU (SEQ ID NO: 3).
- the mir-130a target sequence comprises the nucleotide sequence of ATGCCCTTTTAACATTGCACTG (SEQ ID NO: 4).
- the mir-130a target sequence comprises at least one, at least two or at least three copies of the nucleotide sequence of SEQ ID NO: 4. In a preferred embodiment, the mir-130a target sequence comprises two copies of the nucleotide sequence of SEQ ID NO: 4.
- the copies mir-130a target sequences may be separated by a spacer sequence.
- the spacer sequence may comprise at least one, at least two, at least three, at least four, or at least five nucleotide bases.
- the vector comprises two copies of a mir-126 target sequence and two copies of a mir-130a target sequence.
- two copies of the mir-126 target sequence and two copies of the mir- 130a target sequence are comprised in the nucleotide sequence of:
- Combination target sequence e.g. a target sequence comprising two copies of the mir-126 target sequence and two copies of the mir-130a target sequence are a particular preferred for use in the present invention since use of this combination maximizes repression of the vector in HSC and expression in the myeloid progeny.
- transgene downregulation in HSC is assured by two independent miRNAs, and the risk of interfering with endogenous miRNA regulation is reduced, thus increasing safety and efficacy of the target sequence.
- a vector is a tool that allows or facilitates the transfer of an entity from one environment to another.
- some vectors used in recombinant nucleic acid techniques allow entities, such as a segment of nucleic acid (e.g. a heterologous DNA segment, such as a heterologous Cdna segment), to be transferred into a target cell.
- the vector may serve the purpose of maintaining the heterologous nucleic acid (DNA or RNA) within the cell, facilitating the replication of the vector comprising a segment of nucleic acid, or facilitating the expression of the protein encoded by a segment of nucleic acid.
- Vectors may be non-viral or viral.
- vectors used in recombinant nucleic acid techniques include, but are not limited to, plasmids, chromosomes, artificial chromosomes and viruses.
- the vector may also be, for example, a naked nucleic acid (e.g. DNA).
- the vector may itself be a nucleotide of interest.
- the vectors used in the invention may be, for example, plasmid or virus vectors and may include a promoter for the expression of a polynucleotide and optionally a regulator of the promoter.
- the vector is a viral vector.
- Vectors comprising polynucleotides used in the invention may be introduced into cells using a variety of techniques known in the art, such as transformation, transfection and transduction.
- techniques are known in the art, for example transduction with recombinant viral vectors, such as retroviral, lentiviral, adenoviral, adeno-associated viral, baculoviral and herpes simplex viral vectors, Sleeping Beauty vectors; direct injection of nucleic acids and biolistic transformation.
- Non-viral delivery systems include but are not limited to DNA transfection methods.
- transfection includes a process using a non-viral vector to deliver a gene to a target cell.
- Typical transfection methods include electroporation, DNA biolistics, lipid-mediated transfection, compacted DNA-mediated transfection, liposomes, immunoliposomes, lipofectin, cationic agent-mediated transfection, cationic facial amphiphiles (CFAs) (Nature Biotechnology 1996 14; 556) and combinations thereof.
- CFAs cationic facial amphiphiles
- transfection is to be understood as encompassing the delivery of polynucleotides to cells by both viral and non-viral delivery.
- the invention may employ gene targeting protocols, for example the delivery of DNA-modifying agents.
- Viral delivery systems include but are not limited to adenovirus vector, an adeno-associated viral (AAV) vector, a herpes viral vector, a retroviral vector, a lentiviral vector, and a baculoviral vector.
- AAV adeno-associated viral
- Retroviruses are RNA viruses with a life cycle different to that of lytic viruses.
- a retrovirus is an infectious entity that replicates through a DNA intermediate.
- a retrovirus infects a cell, its genome is converted to a DNA form by a reverse transcriptase enzyme.
- the DNA copy serves as a template for the production of new RNA genomes and virally encoded proteins necessary for the assembly of infectious viral particles.
- retroviruses for example murine leukemia virus (MLV), human immunodeficiency virus (HIV), equine infectious anaemia virus (EIAV), mouse mammary tumour virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), Moloney murine leukemia virus (Mo-MLV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukemia virus (A-MLV), Avian myelocytomatosis virus-29 (MC29), and Avian erythroblastosis virus (AEV) and all other retroviridiae including lentiviruses.
- Lentiviruses also belong to the retrovirus family, but they can infect both dividing and non- dividing cells (Lewis et al (1992) EMBO J. 3053-3058).
- the vector is a lentiviral vector.
- the vector comprises a tissue specific promoter.
- the tissue specific promoter drives specific expression to a subset of tumor infiltrating myeloid cells, such as Tie2 expressing monocytes (TEM) or M2-polarized macrophages.
- the tissue specific promoter is the TEK (Tie2) promoter.
- TEK promoter nucleotide sequence is:
- the TEK promoter comprises the nucleotide sequence of SEQ ID NO: 10. In one embodiment, the TEK promoter comprises a nucleotide sequence having at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 10.
- the TEK (Tie2) promoter may be combined with the mir-126 target sequence and/or the mir- 130a target sequence. This enables specific transgene expression in a subset of tumor- infiltrating myeloid cells, e.g. tumor infiltrating macrophages.
- the vector may further comprise a TEK (Tie2) enhancer sequence.
- TEK (Tie2) enhancer sequence is:
- the TEK enhancer sequence comprises the nucleotide sequence of SEQ ID NO: 1 1.
- the TEK enhancer comprises a nucleotide sequence having at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 1 1 .
- the polynucleotides used in the present invention may be codon-optimised. Codon optimisation has previously been described in WO 1999/41397 and WO 2001/79518. Different cells differ in their usage of particular codons. This codon bias corresponds to a bias in the relative abundance of particular tRNAs in the cell type. By altering the codons in the sequence so that they are tailored to match with the relative abundance of corresponding tRNAs, it is possible to increase expression. By the same token, it is possible to decrease expression by deliberately choosing codons for which the corresponding tRNAs are known to be rare in the particular cell type. Thus, an additional degree of translational control is available.
- viruses including HIV and other lentiviruses
- Codon usage tables are known in the art for mammalian cells, as well as for a variety of other organisms.
- Codon optimization may also involve the removal of mRNA instability motifs and cryptic splice sites.
- TUMOR ASSOCIATED ANTIGEN TAA
- tumor associated antigen refers to an antigenic molecule expressed by a cancer cell, e.g. a tumor cell.
- a TAA may be recognised by an immune cell which expresses an immune receptor (e.g. a TCR, a transgenic TCR or a CAR) that is able to specifically bind to a portion (e.g. an epitope) of the TAA molecule.
- an immune receptor e.g. a TCR, a transgenic TCR or a CAR
- TAA-specific T-cell refers to a T-cell which expresses a TCR or a CAR that is specific for a TAA.
- a T-cell expressing a TAA-specific TCR or TAA-specific CAR may be able to specifically target and kill tumor cells expressing the TAA.
- the TAA-specific TCR may be a transgenic TCR
- the TAA-specific T-cell may not be genetically engineered.
- the T cells may be naturally induced tumor-specific T cells.
- the T cells used in the present invention may be expanded from the tumor or lymph node.
- a particular TAA may be expressed at a high relative abundance on a particular type of tumor cell compared to a non-tumor cell (e.g. a healthy cell).
- a non-tumor cell e.g. a healthy cell
- TAAs include carcinoembryonic antigen (CEA), estrogen receptor, progesterone receptor, ephrinB2, ROR1 , mesothelin, c-Met, GD-2, and MAGE A3 TCR, 4- 1 BB, adenocarcinoma antigen, alpha-fetoprotein, BAFF, B-lymphoma cell, C242 antigen, carbonic anhydrase 9 (CA-IX), CCR4, CD152, CD200, CD22, CD19, CD22, CD123, CD221 , CD23 (IgE receptor), CD28, CD4, CD40, CD44, CD44 v6, CD51 , CD52, CD56, CD74, CD80, CS-1 , CNT0888, CTLA-4, DR5, EpCAM, CD3, fibronectin extra domain-B, folate receptor 1 , glycoprotein 75, GPNMB, HGF, human scatter factor receptor kinase, IGF-1 receptor, IGF-I, Ig
- GD2, GD3, GM2) Le y , CA-125, CA19-9, Epidermal growth factor receptor (EGFR), p185HER2, IL-2 receptor, de2-7 EGFR, Fibroblast activation protein (FAP), Tenascin, metalloproteinases, Endosialin, Carbonic anhydrase, Galectin 9, Aldolase A, elFv4, Tyrosinase, Galectin 4, HERKV-K10, p53, NY-LU-12, Restin, NY-CO-38, MAGE-1 , MAGE-4a, SSX2, NY-ESO-1 , SCP-1 , 707-AP, AFP, ART-4, BAGE, b-catenin/m, Bcr-abl, CAMEL, CAP-1 , CASP-8, CDC27m, CDK4/m, CT, Cyp-B, DAM-6 (MAGE-B2) and DAM-10 (MAGE-B1 ), ELF2M, E
- TAAs may be identified using methods known in the art - see, e.g. the review article by Zilberberg et al. 2015 (Biology of Blood and Marrow Transplantation, Volume 21 , Issue 6, June 2015, Pages 1000-1007) the content of which is incorporated herein by reference.
- T-cell may refer to CD8+ T-cells, CD4+ T-cells, naive T-cells, memory stem T-cells, central memory T-cells, double negative T-cells, effector memory T- cells, effector T-cells, ThO cells, TcO cells, Th1 cells, Tc1 cells, Th2 cells, Tc2 cells, Th17 cells, Th22 cells, gamma/delta T-cells.
- the T-cell used in the present invention may be used for adoptive T-cell transfer.
- the present invention also encompasses adoptive transfer of tumor-infiltrating lymphocytes (TIL) and/or marrow infiltrating lymphocytes (MIL).
- TIL tumor-infiltrating lymphocytes
- MIL marrow infiltrating lymphocytes
- a T-cell transfer refers to the administration of a T-cell population to a patient.
- a T-cell may be isolated from a subject and then genetically modified and cultured in vitro (ex vivo) in order to express a TAA-specific TCR or CAR before being administered to the patient.
- Adoptive cell transfer may be allogenic or autologous.
- autologous cell transfer it is to be understood that the starting population of cells is obtained from the same subject as that to which the transduced T-cell population is administered. Autologous transfer is advantageous as it avoids problems associated with immunological incompatibility and is available to subjects irrespective of the availability of a genetically matched donor.
- allogeneic cell transfer it is to be understood that the starting population of cells is obtained from a different subject as that to which the transduced cell population is administered.
- the donor will be genetically matched to the subject to which the cells are administered to minimise the risk of immunological incompatibility.
- the donor may be mismatched and unrelated to the patient.
- Suitable doses of transduced cell populations are such as to be therapeutically and/or prophylactically effective.
- the dose to be administered may depend on the subject and condition to be treated, and may be readily determined by a skilled person.
- the T-cell may be derived from a T-cell isolated from a patient.
- the T-cell may be part of a mixed cell population isolated from the subject, such as a population of peripheral blood lymphocytes (PBL).
- PBL peripheral blood lymphocytes
- T-cells within the PBL population may be activated by methods known in the art, such as using anti-CD3 and/or anti-CD28 antibodies or cell sized beads conjugated with anti-CD3 and/or anti-CD28 antibodies.
- the T-cell may be a CD4 + helper T cell or a CD8 + cytotoxic T cell.
- the T-cell may be in a mixed population of CD4 + helper T cell/CD8 + cytotoxic T-cells.
- Polyclonal activation, for example using anti-CD3 antibodies optionally in combination with anti-CD28 antibodies will trigger the proliferation of CD4 + and CD8 + T-cells.
- the T-cell may be isolated from the subject to which the genetically modified cell is to be adoptively transferred.
- the cell may be made by isolating a T-cell from a subject, optionally activating the T-cell, transferring the TCR gene to the cell ex vivo.
- Subsequent immunotherapy of the subject may then be carried out by adoptive transfer of the TCR-transduced cells.
- this process refers to autologous T-cell transfer - i.e. the TCR-transduced cells are administered to the same subject from which the T-cells were originally derived.
- the T-cell may be isolated from a different subject, such that it is allogeneic.
- the T-cell may be isolated from a donor subject.
- the cell may be derived from the donor, from which the organs, tissues or cells are derived.
- the donor and the subject undergoing treatment may be siblings.
- the T-cell may be derived from a stem cell, such as a haemopoietic stem cell (HSC).
- HSC haemopoietic stem cell
- the mature T-cells once produced, express only the introduced TCR and little or no endogenous TCR chains, because the expression of the introduced TCR chains suppresses rearrangement of endogenous TCR gene segments to form functional TCR alpha and beta genes.
- the gene-modified stem cells are a continuous source of mature T-cells with the desired antigen specificity. Accordingly, the HSC, the HPC, or the vector as defined herein may be used in combination with a gene-modified stem cell, preferably a gene-modified hematopoietic stem cell, which, upon differentiation, produces a T-cell expressing a TAA-specific TCR.
- disrupting refers to reducing, limiting, preventing, silencing, or abrogating expression of a gene.
- the person skilled in the art is able to use any method known in the art to disrupt an endogenous gene, e.g., any suitable method for genome editing, gene silencing, gene knock-down or gene knock-out.
- an endogenous gene may be disrupted with an artificial nuclease.
- An artificial nuclease is, e.g., an artificial restriction enzyme engineered to selectively target a specific polynucleotide sequence (e.g. encoding a gene of interest) and induce a double strand break in said polynucleotide sequence.
- a specific polynucleotide sequence e.g. encoding a gene of interest
- the double strand break DSB
- NHEJ error-prone non-homologous end joining
- the artificial nuclease is selected from the group consisting of zinc finger nucleases (ZFN), transcription activator-like effector nucleases (TALEN) and CRISPR/Cas (e.g. CRISPR/Cas9).
- ZFN zinc finger nucleases
- TALEN transcription activator-like effector nucleases
- CRISPR/Cas e.g. CRISPR/Cas9.
- TCR T-CELL RECEPTOR
- MHC major histocompatibility complex
- T cell receptor is a molecule found on the surface of T-cells that is responsible for recognizing antigens bound to MHC molecules.
- the TCR heterodimer consists of an alpha (a) and beta ( ⁇ ) chain in around 95% of T-cells, whereas around 5% of T-cells have TCRs consisting of gamma ( ⁇ ) and delta ( ⁇ ) chains.
- Engagement of the TCR with antigen and MHC results in activation of the T lymphocyte on which the TCR is expressed through a series of biochemical events mediated by associated enzymes, co-receptors, and specialized accessory molecules.
- Each chain of the TCR is a member of the immunoglobulin superfamily and possesses one N-terminal immunoglobulin (Ig)-variable (V) domain, one Ig-constant (C) domain, a transmembrane/cell membrane-spanning region, and a short cytoplasmic tail at the C- terminal end.
- Ig immunoglobulin
- V immunoglobulin
- C Ig-constant
- variable domain of both the TCR a chain and ⁇ chain have three hypervariable or complementarity determining regions (CDRs).
- CDR3 is the main CDR responsible for recognizing processed antigen, although CDR1 of the alpha chain has also been shown to interact with the N-terminal part of the antigenic peptide, whereas CDR1 of the beta chain interacts with the C-terminal part of the peptide.
- CDR2 is thought to recognize the MHC molecule.
- the constant domain of the TCR domain consists of short connecting sequences in which a cysteine residue forms a disulfide bond, making a link between the two chains.
- the TCR used in the present invention may have one or more additional cysteine residues in each of the a and ⁇ chains such that the TCR may comprise two or more disulphide bonds in the constant domains.
- the structure allows the TCR to associate with other molecules like CD3 which possess three distinct chains ( ⁇ , ⁇ , and ⁇ ) in mammals and the ⁇ -chain. These accessory molecules have negatively charged transmembrane regions and are vital to propagating the signal from the TCR into the cell.
- the signal from the T cell complex is enhanced by simultaneous binding of the MHC molecules by a specific co-receptor.
- this co-receptor is CD4 (specific for class II MHC); whereas for cytotoxic T-cells, this co-receptor is CD8 (specific for class I MHC).
- the co-receptor allows prolonged engagement between the antigen presenting cell and the T cell and recruits essential molecules (e.g., LCK) inside the cell involved in the signalling of the activated T lymphocyte.
- T-cell receptor refers to a molecule capable of recognising a peptide when presented by an MHC molecule.
- the molecule may be a heterodimer of two chains a and ⁇ (or optionally ⁇ and ⁇ ) or it may be a single chain TCR construct.
- the TCR used in the present invention may be a hybrid TCR comprising sequences derived from more than one species. For example, it has surprisingly been found that murine TCRs are more efficiently expressed in human T-cells than human TCRs.
- the TCR may therefore comprise human variable regions and murine constant regions.
- a disadvantage of this approach is that the murine constant sequences may trigger an immune response, leading to rejection of the transferred T-cells.
- the conditioning regimens used to prepare patients for adoptive T-cell therapy may result in sufficient immunosuppression to allow the engraftment of T-cells expressing murine sequences.
- the portion of the TCR that establishes the majority of the contacts with the antigenic peptide bound to the major histocompatibility complex (MHC) is the complementarity determining region 3 (CDR3), which is unique for each T cell clone.
- CDR3 region is generated upon somatic rearrangement events occurring in the thymus and involving noncontiguous genes belonging to the variable (V), diversity (D, for ⁇ and ⁇ chains) and joining (J) genes.
- V variable
- D diversity
- J joining
- random nucleotides inserted/deleted at the rearranging loci of each TCR chain gene greatly increase diversity of the highly variable CDR3 sequence.
- the frequency of a specific CDR3 sequence in a biological sample indicates the abundance of a specific T cell population.
- T-cell receptor diversity is focused on CDR3 and this region is primarily responsible for antigen recognition.
- the CDRs may, for example, comprise one, two, or three substitutions, additions or deletions from the given sequence, provided that the TCR retains the capacity to bind TAA derived peptide when presented by an MHC molecule.
- TCRs specific for TAA may be generated easily by the person skilled in the art using any method known in the art.
- TAA-specific TCRs maybe identified by the TCR gene capture method of Linnemann et al (Nature Medicine 19, 1534-1541 (2013)). Briefly, this method uses a high- throughput DNA-based strategy to identify TCR sequences by the capture and sequencing of genomic DNA fragments encoding the TCR genes and may be used to identify TAA- specific TCRs.
- the T cell may be modified (e.g. using a vector) to comprise one or more genes encoding CD3-gamma, CD3-delta, CD3-epsilon and/or CD3-zeta.
- the T cell comprises a gene encoding CD3-zeta.
- the T cell may comprise a gene encoding CD8.
- the vector encoding such genes may encode a selectable marker or a suicide gene, to increase the safety profile of the genetically engineered cell.
- the genes may be linked by self-cleaving sequences, such as the 2A self-cleaving sequence.
- one or more separate vectors encoding a CD3 gene may be provided for co- transfer to a T cell simultaneously, sequentially or separately with one or more vectors encoding TCRs.
- the transgenic TCR may be expressed in a T-cell used in the present invention to alter the antigen specificity of the T-cell.
- TCR-transduced T-cells express at least two TCR alpha and two TCR beta chains. While the endogenous TCR alpha/beta chains form a receptor that is self-tolerant, the introduced TCR alpha/beta chains form a receptor with defined specificity for the given target antigen.
- TCR gene therapy requires sufficient expression of transferred (i.e. transgenic) TCRs as the transferred TCR might be diluted by the presence of the endogenous TCR, resulting in suboptimal expression of the tumor specific TCR.
- mispairing between endogenous and introduced chains may occur to form novel receptors, which might display unexpected specificities for self-antigens and cause autoimmune damage when transferred into patients.
- Mutations of the TCR alpha/beta interface is one strategy currently employed to reduce unwanted mispairing.
- the introduction of a cysteine in the constant domains of the alpha and beta chain allows the formation of a disulfide bond and enhances the pairing of the introduced chains while reducing mispairing with wild type chains.
- the TCRs used in the present invention may comprise one or more mutations at the a chain/ ⁇ chain interface, such that when the a chain and the ⁇ chain are expressed in a T-cell, the frequency of mispairing between said chains and endogenous TCR a and ⁇ chains is reduced.
- the one or more mutations introduce a cysteine residue into the constant region domain of each of the a chain and the ⁇ chain, wherein the cysteine residues are capable of forming a disulphide bond between the a chain and the ⁇ chain.
- Another strategy to reduce mispairing relies on the introduction of polynucleotide sequences encoding siRNA, added to the genes encoding for the tumor specific TCR a and or ⁇ chains, and designed to limit the expression of the endogenous TCR genes (Okamoto S. Cancer research 69, 9003-901 1 , 2009).
- the vector or polynucleotide encoding the TCRs used in the present invention may comprise one or more siRNA or other agents aimed at limiting or abrogating the expression of the endogenous TCR genes.
- TCR gene editing proved superior to TCR gene transfer in vitro and in vivo (Provasi E., Genovese P., Nature Medicine May; 18(5):807-15; 2012).
- the genome editing technology allows targeted integration of a expression cassette, comprising a polynucleotide encoding a TCR used in the present invention, and optionally one or more promoter regions and/or other expression control sequences, into an endogenous gene disrupted by the artificial nucleases (Lombardo A., Nature biotechnology 25, 1298-1306; 2007).
- TCR ⁇ constant regions e.g. the TRAC, TRBC1 and TRBC2 regions
- Murizination of TCR constant regions is described in, for example, Sommermeyer and Uckert J Immunol; 2010 (184:6223-6231 ). Accordingly, the TCR used in the present invention may be murinized.
- CHIMERIC ANTIGEN RECEPTOR (CAR) CARs comprise an extracellular ligand binding domain, most commonly a single chain variable fragment of a monoclonal antibody (scFv) linked to intracellular signaling components, most commonly ⁇ 3 ⁇ alone or combined with one or more costimulatory domains.
- scFv monoclonal antibody
- a spacer is often added between the extracellular antigen-binding domain and the transmembrane moiety to optimize the interaction with the target.
- a CAR for use in the present invention may comprise:
- the antigen-specific targeting domain comprises an antibody or fragment thereof, more preferably a single chain variable fragment.
- the antigen-specific targeting domain targets a TAA.
- the antigen-specific targeting domain targets CD19.
- transmembrane domains include a transmembrane domain of a zeta chain of a T cell receptor complex, CD28 and CD8a.
- costimulatory domains include a costimulating domain from CD28, CD137 (4- 1 BB), CD134 (OX40), DapIO, CD27, CD2, CD5, ICAM-1 , LFA-1 , Lck, TNFR-I, TNFR-II, Fas, CD30 and CD40.
- the costimulatory domain is a costimulating domain from CD28.
- intracellular signaling domains include human CD3 zeta chain, FcyRIII, FcsRI, a cytoplasmic tail of a Fc receptor and an immunoreceptor tyrosine-based activation motif (ITAM) bearing cytoplasmic receptors.
- ITAM immunoreceptor tyrosine-based activation motif
- CAR Chimeric antigen receptor
- CARs engineered receptors which can confer an antigen specificity onto cells (for example T cells such as naive T cells, central memory T cells, effector memory T cells or combinations thereof). CARs are also known as artificial T-cell receptors, chimeric T-cell receptors or chimeric immunoreceptors.
- the CARs of the invention comprise an antigen-specific targeting region, an extracellular domain, a transmembrane domain, optionally one or more co-stimulatory domains, and an intracellular signaling domain.
- the antigen-specific targeting domain provides the CAR with the ability to bind to the target antigen of interest.
- the antigen-specific targeting domain preferably targets an antigen of clinical interest against which it would be desirable to trigger an effector immune response that results in tumor killing.
- the antigen-specific targeting domain may be any protein or peptide that possesses the ability to specifically recognize and bind to a biological molecule (e.g., a cell surface receptor or tumor protein, or a component thereof).
- the antigen-specific targeting domain includes any naturally occurring, synthetic, semi-synthetic, or recombinantly produced binding partner for a biological molecule of interest.
- Illustrative antigen-specific targeting domains include antibodies or antibody fragments or derivatives, extracellular domains of receptors, ligands for cell surface molecules/receptors, or receptor binding domains thereof, and tumor binding proteins.
- the antigen-specific targeting domain is, or is derived from, an antibody.
- An antibody-derived targeting domain can be a fragment of an antibody or a genetically engineered product of one or more fragments of the antibody, which fragment is involved in binding with the antigen. Examples include a variable region (Fv), a complementarity determining region (CDR), a Fab, a single chain antibody (scFv), a heavy chain variable region (VH), a light chain variable region (VL) and a camelid antibody (VHH).
- the binding domain is a single chain antibody (scFv).
- the scFv may be murine, human or humanized scFv.
- CDR complementarity determining region
- the heavy chain variable region and the light chain variable region each contain 3 CDRs.
- Heavy chain variable region refers to the fragment of the heavy chain of an antibody that contains three CDRs interposed between flanking stretches known as framework regions, which are more highly conserved than the CDRs and form a scaffold to support the CDRs.
- Light chain variable region or “VL” refers to the fragment of the light chain of an antibody that contains three CDRs interposed between framework regions.
- Fv refers to the smallest fragment of an antibody to bear the complete antigen binding site.
- An Fv fragment consists of the variable region of a single light chain bound to the variable region of a single heavy chain.
- Single-chain Fv antibody or “scFv” refers to an engineered antibody consisting of a light chain variable region and a heavy chain variable region connected to one another directly or via a peptide linker sequence.
- Antibodies that specifically bind a tumor cell surface molecule can be prepared using methods well known in the art. Such methods include phage display, methods to generate human or humanized antibodies, or methods using a transgenic animal or plant engineered to produce human antibodies. Phage display libraries of partially or fully synthetic antibodies are available and can be screened for an antibody or fragment thereof that can bind to the target molecule. Phage display libraries of human antibodies are also available. Once identified, the amino acid sequence or polynucleotide sequence coding for the antibody can be isolated and/or determined.
- the selection of the targeting domain will depend on the type of cancer to be treated, and may target tumor antigens.
- a tumor sample from a subject may be characterized for the presence of certain biomarkers or cell surface markers.
- breast cancer cells from a subject may be positive or negative for each of Her2Neu, Estrogen receptor, and/or the Progesterone receptor.
- a tumor antigen or cell surface molecule is selected that is found on the individual subject's tumor cells.
- the antigen-specific targeting domain targets a cell surface molecule that is found on tumor cells and is not substantially found on normal tissues, or restricted in its expression to non-vital normal tissues.
- TAA which may be targeted by the CAR used in the present invention include but are not limited to any one or more of carcinoembryonic antigen (CEA), estrogen receptor, progesterone receptor, ephrinB2, ROR1 , mesothelin, c-Met, GD-2, and MAGE A3 TCR, 4- 1 BB, adenocarcinoma antigen, alpha-fetoprotein, BAFF, B-lymphoma cell, C242 antigen, carbonic anhydrase 9 (CA-IX), CCR4, CD152, CD200, CD22, CD19, CD22, CD123, CD221 , CD23 (IgE receptor), CD28, CD4, CD40, CD44, CD44 v6, CD51 , CD52, CD56, CD74, CD80, CS-1 , CNT0888, CTLA-4, DR5, EpCAM, CD3, fibronectin extra domain-B, folate receptor 1 , glycoprotein 75, GPNMB, HGF, human
- GD2, GD3, GM2) Le y , CA-125, CA19-9, Epidermal growth factor receptor (EGFR), p185HER2, IL-2 receptor, de2-7 EGFR, Fibroblast activation protein (FAP), Tenascin, metalloproteinases, Endosialin, Carbonic anhydrase, Galectin 9, Aldolase A, elFv4, Tyrosinase, Galectin 4, HERKV-K10, p53, NY-LU-12, Restin, NY-CO-38, MAGE-1 , MAGE-4a, SSX2, NY-ESO-1 , SCP-1 , 707-AP, AFP, ART-4, BAGE, b-catenin/m, Bcr-abl, CAMEL, CAP-1 , CASP-8, CDC27m, CDK4/m, CT, Cyp-B, DAM-6 (MAGE-B2) and DAM-10 (MAGE-B1 ), ELF2M, E
- the CAR used in the present invention may also comprise one or more co-stimulatory domains. This domain may enhance cell proliferation, cell survival and development of memory cells.
- Each co-stimulatory domain comprises the co-stimulatory domain of any one or more of, for example, members of the TNFR super family, CD28, CD137 (4-1 BB), CD134 (OX40), DapIO, CD27, CD2, CD5, ICAM-1 , LFA-1 , Lck, TNFR-1 , TNFR-II, Fas, CD30, CD40 or combinations thereof.
- Co-stimulatory domains from other proteins may also be used with the CAR used in the present invention. Additional co-stimulatory domains will be apparent to those of skill in the art.
- Intracellular signaling domains may also comprise an intracellular signaling domain.
- This domain may be cytoplasmic and may transduce the effector function signal and direct the cell to perform its specialized function.
- intracellular signaling domains include, but are not limited to, ⁇ chain of the T-cell receptor or any of its homologs (e.g., ⁇ chain, FceRl y and ⁇ chains, MB1 (Iga) chain, B29 (Ig3) chain, etc.), CD3 polypeptides ( ⁇ , ⁇ and ⁇ ), syk family tyrosine kinases (Syk, ZAP 70, etc.), src family tyrosine kinases (Lck, Fyn, Lyn, etc.) and other molecules involved in T-cell transduction, such as CD2, CD5 and CD28.
- ⁇ chain of the T-cell receptor or any of its homologs e.g., ⁇ chain, FceRl y and ⁇ chains, MB1 (
- the intracellular signaling domain may be human CD3 zeta chain, FcyRIII, FcsRI, cytoplasmic tails of Fc receptors, immunoreceptor tyrosine-based activation motif (ITAM) bearing cytoplasmic receptors or combinations thereof.
- ITAM immunoreceptor tyrosine-based activation motif
- the CAR used in the present invention may also comprise a transmembrane domain.
- the transmembrane domain may comprise the transmembrane sequence from any protein which has a transmembrane domain, including any of the type I, type II or type III transmembrane proteins.
- the transmembrane domain of the CAR used in the present invention may also comprise an artificial hydrophobic sequence.
- the transmembrane domains of the CARs used in the present invention may be selected so as not to dimerize. Additional transmembrane domains will be apparent to those of skill in the art.
- transmembrane (TM) regions used in CAR constructs are: 1 ) The CD28 TM region (Pule et al, Mol Ther, 2005, Nov; 12(5):933-41 ; Brentjens et al, CCR, 2007, Sep 15; 13(18 Pt 1 ):5426- 35; Casucci et al, Blood, 2013, Nov 14; 122(20):3461-72.); 2) The OX40 TM region (Pule et al, Mol Ther, 2005, Nov; 12(5):933-41 ); 3) The 41 BB TM region (Brentjens et al, CCR, 2007, Sep 15; 13(18 Pt 1 ):5426-35); 4) The CD3 zeta TM region (Pule et al, Mol Ther, 2005, Nov; 12(5):933-41 ; Savoldo B, Blood, 2009, Jun 18; 1 13(25):6392-402.); 5) The CD8a TM
- immune checkpoint inhibitor refers to a molecule, compound, antibody or drug that inhibits, blocks, prevents, reduces or downregulates the expression of, or is otherwise antagonistic to, an inhibitory checkpoint molecule.
- an inhibitory checkpoint molecule When expressed on the cell surface, an inhibitory checkpoint molecule inhibits or dampens the T-cell-mediated immune response to said cell.
- expression of inhibitory checkpoint molecules may prevent a cell from being killed by a T-cell response. This mechanism is particularly deleterious where a cancer cell expresses inhibitory checkpoint molecules as this may allow the cancer cell to evade the host T-cell response. Accordingly, when inhibitory checkpoint molecules on tumor cells are inhibited by an immune checkpoint inhibitor, an enhanced host T-cell response against the tumor cell should occur.
- the immune checkpoint inhibitor inhibits an inhibitory checkpoint molecule selected from the group consisting of A2AR (Adenosine A2A receptor), B7-H3 (CD276), B7-H4 (VTCN1 ), BTLA (B and T Lymphocyte Attenuator; CD272), HVEM (Herpesvirus Entry Mediator), CTLA-4 (Cytotoxic T-Lymphocyte-Associated protein 4; CD152), IDO (Indoleamine 2,3-dioxygenase), TDO (tryptophan 2,3-dioxygenase), KIR (Killer-cell Immunoglobulin-like Receptor), LAG3 (Lymphocyte Activation Gene-3), PD-1 (Programmed Death 1 receptor), PD-L1 (PD-1 ligand 1 ), PD-L2 (PD-1 ligand 2), TIM-3 (T- cell Immunoglobulin domain and Mucin domain 3), VISTA (V-domain Ig Suppressor of T
- the immune checkpoint inhibitor is a PD-1 inhibitor; preferably the PD-1 inhibitor is an anti-PD-1 antibody.
- the immune checkpoint inhibitor is a PD-L1 inhibitor; preferably the PD-L1 inhibitor is an anti-PD-L1 antibody.
- the immune checkpoint inhibitor is a PD-L2 inhibitor, preferably the PD-L2 inhibitor is an anti-PD-L2 antibody.
- the immune checkpoint inhibitor is a CTLA4 inhibitor, preferably the CTLA4 inhibitor is an anti-CTLA4 antibody.
- the immune checkpoint inhibitor is a LAG-3 inhibitor; preferably the LAG-3 inhibitor is an anti-LAG-3 antibody.
- the term “antibody” is understood as a polypeptide substantially encoded by an immunoglobulin gene or immunoglobulin genes, or fragments thereof, which specifically bind and recognize an antigen (e.g. a cell surface marker).
- an antigen e.g. a cell surface marker.
- the term “antibody” refers to a whole or intact antibody molecule (e.g., IgM, IgG (including lgG1 , lgG2, lgG3, and lgG4), IgA, IgD, or IgE) or any antigen-binding fragment thereof.
- An antibody may be a polyclonal antibody or a monoclonal antibody.
- Monoclonal antibodies are produced by identical immune cells (e.g. hybridomas that may be generated from the fusion of an antibody producing B-cell line and a cancerous B-cell line).
- a monoclonal antibody directed to a particular antigen will recognise a single specific epitope on said antigen.
- polyclonal antibodies are produced from multiple non-identical cell lines and therefore recognise several different epitopes on a particular antigen.
- Antigen-binding fragments of an antibody include, e.g., a single chain antibody, a single chain Fv fragment (scFv), an Fd fragment, an Fab fragment, an Fab' fragment, or an F(ab') 2 fragment.
- An scFv fragment is a single polypeptide chain that includes both the heavy and light chain variable regions of the antibody from which the scFv is derived.
- intrabodies, minibodies, triabodies, and diabodies see, e.g., Todorovska et al.
- antibody also includes antibody fragments either produced by the modification of whole antibodies or those synthesized de novo using recombinant methods.
- Suitable methods for producing an antibody or antigen binding fragments thereof directed to a particular antigen are known in the art (see, e.g., Greenfield (2014) Antibodies: A Laboratory Manual, Second Edition 201 -221 ).
- the present invention also encompasses the use of variants, derivatives, analogues, homologues and fragments thereof.
- a variant of any given sequence is a sequence in which the specific sequence of residues (whether amino acid or nucleic acid residues) has been modified in such a manner that the polypeptide or polynucleotide in question substantially retains at least one of its endogenous functions.
- a variant sequence can be obtained by addition, deletion, substitution, modification, replacement and/or variation of at least one residue present in the naturally-occurring protein.
- derivative in relation to proteins or polypeptides of the present invention includes any substitution of, variation of, modification of, replacement of, deletion of and/or addition of one (or more) amino acid residues from or to the sequence providing that the resultant protein or polypeptide substantially retains at least one of its endogenous functions.
- analogue in relation to polypeptides or polynucleotides includes any mimetic, that is, a chemical compound that possesses at least one of the endogenous functions of the polypeptides or polynucleotides which it mimics.
- Proteins used in the present invention may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent protein.
- Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity and/or the amphipathic nature of the residues as long as the endogenous function is retained.
- negatively charged amino acids include aspartic acid and glutamic acid
- positively charged amino acids include lysine and arginine
- amino acids with uncharged polar head groups having similar hydrophilicity values include asparagine, glutamine, serine, threonine and tyrosine.
- a substitution may involve replacement of an amino acid for a similar amino acid (a conservative substitution).
- a similar amino acid is one which has a side chain moiety with related properties as grouped together, for example as shown below:
- non-polar side chains glycine (G), alanine (A), valine (V), leucine (L), isoleucine (I), proline (P), phenylalanine (F), methionine (M), tryptophan (W) and cysteine (C).
- Variant sequences may comprise amino acid substitutions, additions, deletions and/or insertions.
- the present invention also encompasses homologous substitution (substitution and replacement are both used herein to mean the interchange of an existing amino acid residue, with an alternative residue), e.g. like-for-like substitution such as basic for basic, acidic for acidic, polar for polar etc.
- Non-homologous substitution may also occur e.g. from one class of residue to another or alternatively involving the inclusion of unnatural amino acids, such as ornithine.
- variant as used herein may mean an entity having a certain homology with the wild type amino acid sequence or the wild type nucleotide sequence.
- homology can be equated with “identity”.
- a variant sequence may include an amino acid sequence which may be at least 50%, 55%, 65%, 75%, 85% or 90% identical, preferably at least 95%, at least 97%, or at least 99% identical to the subject sequence.
- the variants will comprise the same active sites etc. as the subject amino acid sequence.
- homology can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express homology in terms of sequence identity.
- a variant sequence may include a nucleotide sequence which may be at least 40%, 45%, 50%, 55%, 65%, 75%, 85% or 90% identical, preferably at least 95%, at least 97%, or at least 99% identical to the subject sequence.
- homology can also be considered in terms of similarity, in the context of the present invention it is preferred to express homology in terms of sequence identity.
- reference to a sequence which has a percent identity to any one of the SEQ ID NOs detailed herein refers to a sequence which has the stated percent identity over the entire length of the SEQ ID NO referred to.
- Identity comparisons can be conducted by eye or, more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs can calculate percentage homology or identity between two or more sequences.
- Percentage homology may be calculated over contiguous sequences, i.e. one sequence is aligned with the other sequence and each amino acid in one sequence is directly compared with the corresponding amino acid in the other sequence, one residue at a time. This is called an "ungapped" alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues.
- the alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pairwise comparison based on chemical similarity or evolutionary distance.
- An example of such a matrix commonly used is the BLOSUM62 matrix - the default matrix for the BLAST suite of programs.
- GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table if supplied (see the user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62.
- “Fragments” are also variants and the term typically refers to a selected region of the polypeptide or polynucleotide that is of interest either functionally or, for example, in an assay. “Fragment” thus refers to an amino acid or nucleic acid sequence that is a portion of a full-length polypeptide or polynucleotide.
- Such variants may be prepared using standard recombinant DNA techniques such as site- directed mutagenesis. Where insertions are to be made, synthetic DNA encoding the insertion together with 5' and 3' flanking regions corresponding to the naturally-occurring sequence either side of the insertion site may be made. The flanking regions will contain convenient restriction sites corresponding to sites in the naturally-occurring sequence so that the sequence may be cut with the appropriate enzyme(s) and the synthetic DNA ligated into the cut. The DNA is then expressed in accordance with the invention to make the encoded protein. These methods are only illustrative of the numerous standard techniques known in the art for manipulation of DNA sequences and other known techniques may also be used.
- HSCs The HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with an immune checkpoint inhibitor.
- the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with a TAA- specific T cell.
- the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with a TAA- specific T cell expressing a CAR.
- the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with a TAA- specific T cell expressing a transgenic TCR.
- the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with an immune checkpoint inhibitor and a TAA-specific T cell expressing a transgenic TCR.
- the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with an immune checkpoint inhibitor and a TAA-specific T cell expressing a CAR.
- the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with 1 - methyl-tryptophan (1-MT).
- the phrase "used in combination with” encompasses administration of the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention sequentially, separately or simultaneously with an immune checkpoint inhibitor and/or a TAA-specific T cell.
- the HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least 5 minutes, at least 10 minutes, at least 15 minutes, at least 30 minutes, at least 45 minutes, at least 60 minutes prior a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- the HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least 1 hour, at least 2 hours, at least 3 hours, at least 4 hours, at least 5 hours, at least 6 hours, at least 12 hours, at least 24 hours, at least 48 hours, at least 72 hours prior to a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- the HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one day, at least two days, at least three days, at least four days, at least five days, at least six days, at least seven days, or at least 14 days prior to a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- the HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one week, at least two weeks, at least three weeks, at least four weeks, at least five weeks, at least six weeks, at least seven weeks, at least eight weeks, at least nine weeks, at least 10 weeks, at least 1 1 weeks, or at least 12 weeks prior to a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- the HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 1 1 months, or at least 12 months prior to a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- the HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 1 1 months, or at least 12 months prior to a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- the phrase "used in combination with” encompasses administration of the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention sequentially, separately or simultaneously with 1-methyl- tryptophan (1 -MT).
- the HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least 5 minutes, at least 10 minutes, at least 15 minutes, at least 30 minutes, at least 45 minutes, at least 60 minutes prior to 1 -methyl-tryptophan (1-MT).
- the HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least 1 hour, at least 2 hours, at least 3 hours, at least 4 hours, at least 5 hours, at least 6 hours, at least 12 hours, at least 24 hours, at least 48 hours, at least 72 hours prior to 1-methyl-tryptophan (1-MT).
- the HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one day, at least two days, at least three days, at least four days, at least five days, at least six days, at least seven days, or at least 14 days prior to 1-methyl-tryptophan (1 -MT).
- the HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one week, at least two weeks, at least three weeks, at least four weeks, at least five weeks, at least six weeks, at least seven weeks, at least eight weeks, at least nine weeks, at least 10 weeks, at least 1 1 weeks, or at least 12 weeks prior to 1-methyl-tryptophan (1 -MT).
- the HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 1 1 months, or at least 12 months prior to 1-methyl-tryptophan (1 -MT).
- the HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 1 1 months, or at least 12 months prior to 1-methyl-tryptophan (1 -MT).
- the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes immune checkpoint inhibitors, TAA-specific T-cells, vectors, 1 -methyl-tryptophan (1 -MT) and combinations thereof for use according to the present invention may be formulated with a pharmaceutically acceptable carrier, diluent or excipient.
- the patient may be a human patient.
- the patient may be a non-human animal.
- the patient may be afflicted with a cancer.
- the patient may be at risk of developing a cancer.
- the patient may have been previously determined to be at risk of developing a cancer.
- the increased risk may have been determined by genetic screening and/or by reviewing the patient's family history.
- the patient may have been determined to express one or more genetic markers indicative of an increased risk of developing a cancer.
- a person skilled in the art will be aware of genetic risk factors (e.g. genetic markers) associated with increased risk of developing a cancer.
- genetic risk factors e.g. genetic markers
- the skilled person may use any suitable method or technique known in the art to determine whether the subject has an increased risk of developing a cancer.
- the subject may have previously received treatment for the cancer.
- the subject may be in remission from the cancer.
- the subject may be resistant to chemotherapy.
- the patient has been previously administered a hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC), a myeloid/monocyte- committed progenitor cell, a macrophage or a monocyte of the invention prior to administration of a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- HSC hematopoietic stem cell
- HPC hematopoietic progenitor cell
- myeloid/monocyte- committed progenitor cell a macrophage or a monocyte of the invention prior to administration of a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least 6 hours, at least 12 hours, at least 24 hours, at least 48 hours, at least 72 hours prior to administration with a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one day, at least two days, at least three days, at least four days, at least five days, at least six days, at least seven days, or at least 14 days prior to administration with a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one week, at least two weeks, at least three weeks, at least four weeks, at least five weeks, at least six weeks, at least seven weeks, at least eight weeks, at least nine weeks, at least 10 weeks, at least 1 1 weeks, or at least 12 weeks prior to administration with a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 1 1 months, or at least 12 months prior to administration with a TAA-specific T-cell and/or an immune checkpoint inhibitor.
- the patient has been previously administered a hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC), a myeloid/monocyte- committed progenitor cell, a macrophage or a monocyte of the invention prior to administration of 1-methyl-tryptophan (1 -MT).
- HSC hematopoietic stem cell
- HPC hematopoietic progenitor cell
- myeloid/monocyte- committed progenitor cell a macrophage or a monocyte of the invention prior to administration of 1-methyl-tryptophan (1 -MT).
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least 6 hours, at least 12 hours, at least 24 hours, at least 48 hours, at least 72 hours prior to administration with 1 -methyl-tryptophan (1-MT).
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one day, at least two days, at least three days, at least four days, at least five days, at least six days, at least seven days, or at least 14 days prior to administration 1-methyl-tryptophan (1 -MT).
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one week, at least two weeks, at least three weeks, at least four weeks, at least five weeks, at least six weeks, at least seven weeks, at least eight weeks, at least nine weeks, at least 10 weeks, at least 1 1 weeks, or at least 12 weeks prior to administration with 1-methyl- tryptophan (1 -MT).
- the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 1 1 months, or at least 12 months prior to administration with 1 -methyl-tryptophan (1-MT).
- Example 1 Tumor-targeted IFNa boosts T cell-mediated anti-tumor responses in a ALL model
- mice C57BI/6 mice with HSC transduced with either m77e2-IFN-mirT LV (IFN mice) or m77e2-GFP-mirT LV or Mock-transduced (both used as control mice), to target IFN/GFP expression to the differentiated TIE2+ monocyte progeny, which is highly enriched in tumors 15,16 .
- IFN mice m77e2-IFN-mirT LV
- Mock-transduced both used as control mice
- aCTLA4 blocking antibody had no effects in control mice but further and significantly improved ALL inhibition in IFN mice, suggesting an immune contribution to the observed response in IFN mice.
- LV lentiviral vector
- Ovalbumin Ovalbumin
- NGFR nerve growth factor receptor
- Example 2 Adoptively transferred transgenic OT-I T cells only expand and contain leukemia in IFN mice
- OT-I naive transgenic OVA-specific T cells
- Example 3 Primed immune gene signature towards M1 and Th1 responses in IFN mice; and IFN gene therapy offsets leukemia-induced changes in the tumor microenvironment (TME) and imposes an immunostimulatory program
- Leukemia growth in the spleen of control mice was accompanied by expansion of immature myeloid cells (CD1 1 cint MHCII-F4/80-) and increased percentage of MHC-II negative M2 macrophages, whereas none of these changes were seen in IFN mice (Fig. 1 1 b-d).
- Leukemia-associated changes were also absent in the BM myeloid cells of IFN mice, which showed instead an increase in DCs and in the fraction of DC presenting the immune-dominant OVA257-264 peptide on MHC-I (Fig. 12a, b and Figure 18).
- the changes in NK and NKT cells seen in the spleen and BM of leukemic mice - including decreased expression of the activating NKG2D receptor - were absent in IFN mice (Fig. 13a-e).
- RNA-sequencing (RNA-Seq) analyses revealed leukemia-induced transcriptional changes in macrophages, which were substantially counteracted by IFN gene therapy ( Figure 22a, b).
- Spleen macrophages from ALL vs. control mice up-regulated genes encoding for the immunosuppressive cytokine IL-10, the inhibitory immune checkpoint PD-1 as well as genes linked to cell division and response to immune stimuli gene ontology (GO) terms.
- GO immune stimuli gene ontology
- IFN gene therapy in ALL mice elicited an immunostimulatory program characterized by up-regulation of IFN-Stimulated Genes (ISGs) enriched in defense response, leukocyte migration and response to interferon GO terms, and abrogated leukemia-induced up-regulation of 1110 and down-regulation of MHC II genes (Figure 19b-d).
- IFN gene therapy in ALL mice induced ISGs at levels higher than those triggered in controls, ( Figure 19d and Figure 22a), and the transcriptomes of macrophages from control and IFN tumor-free mice showed high correlation, while they were clearly distinct from the ALL and IFN+ALL groups ( Figure 22b).
- IFN gene therapy imposed an ISG-driven immunostimulatory program to non-classical monocytes from ALL mice, as evidenced by up-regulation of genes enriched in GO terms related to defense and innate immune response, as well as MHC II genes (Figure 19g,h).
- Transcriptional reprogramming of the TME by IFN gene therapy was less effective in non- classical monocytes from mice that did not respond to IFN gene therapy ( Figure 25a), as revealed by graph-based clustering and differential gene expression (Figure 19f,h).
- Subdustering of scRNA-Seq data from non-classical monocytes identified four major subclusters (1A to 1 D; Figure 25b).
- Subcluster 1 A was comprised of cells from disease-free mice from both control and IFN mice, whereas the other three subclusters largely overlapped with cells from IFN+ALL responder (1 B), IFN+ALL non responder (1 C), and ALL (1 D).
- Minimum-spanning tree (MST) analyses revealed a trajectory from 1A to 1 D, confirming partial vs. effective reprogramming in cells from non responder vs. responder IFN mice ( Figure 19i).
- Example 4 - IFN treatment induces durable anti-tumor responses targeting multiple tumor antigens
- mice euthanized at later time points showed induction of variable percentages of circulating OVA-specific T cells and the appearance of NGFR- negative ALL clones (Fig. 14b).
- mice succumbing to the disease either failed to mount an immune response and died very early, or mounted anti-OVA responses but ultimately died due to the failure of these cells to protect the mice, either because of exhaustion or the emergence of immune-selected OVA negative ALL clones.
- Long-term survivors showed stable circulating OVA-specific T cells and, when re-challenged with OVA-ALL, remained disease-free (Fig. 4b and Fig. 14c).
- Example 5 Combination of IFN treatment and CTLA-4 blockade enhances survival to leukemia
- IFN or aCTLA-4 treatment increased the percentage of OVA207 specific T cells in PB, which was further increased in the combination group (Fig. 16b). Accordingly, immune selection of NGFR-negative ALL was more evident in the IFN+aCTLA4 and aCTLA4 groups, although it was not consistently accompanied by delayed disease course (Fig. 16a), suggesting that immune response to a single neo-antigen may not afford tumor protection.
- our ALL model also express OFP (which is co-expressed with miR- 126) and the prokaryotic trans-activator tTA (which up-regulates miR-126 expression) as potential neo-antigens that help driving the transformed phenotype (see Fig. 1 a).
- mice peripheral blood mononuclear cells (PBMC) of long-term surviving mice (from experiment shown in Fig. 4f) with target cells transduced with LV expressing tTA, OFP, NGFR or OVA, and measured ⁇ -IFN production by ELISPOT.
- PBMC peripheral blood mononuclear cells
- mice showing an anti-tumor repertoire encompassing multiple TAAs had a much higher likelihood of long-term survival than mice responding to a single or no TAA, which all died of the disease (Fig. 4j,k).
- Example 6 - IFN gene therapy boosts activation and expansion of adoptively transferred CAR19-transduced T cells and enhances survival
- mice were conditioned with cyclophosphamide prior to infusion (Figure 20a).
- CART19 cells alone had hardly any impact on the rapidly growing ALL in control mice in our experimental conditions, they significantly inhibited leukemia burden and depleted normal B cells in IFN mice ( Figure 20b and Figure 26c).
- Reminiscent of the finding with OT-I T cells CART19 cells revealed early and transient LAG3 and PD1 up-regulation in IFN but not control mice, reaching the highest peak in a long-term IFN survivor ( Figure 20c and Figure 26d, IFN long- term survivor shown in green).
- NGFR expression was also upregulated on CART19 cells of IFN mice, likely reflecting increased activity of the phosphoglycerate kinase promoter (PGK) in response to higher metabolic activation of CART cells in IFN mice ( Figure 26e,f). Since in our LV NGFR and CAR19 expression are co-regulated by the PGK promoter, higher expression of the latter may have also favored more efficient CD19+ ALL killing in IFN mice.
- iCAR19 an improved CD19 CAR version (iCAR19), which contains inactivating mutations in the first and third CD3zeta ITAM domains and was reported to improve killing efficiency and increase T cell viability as compared to the standard CAR19 (Kochenderfer, J.N. et al.
- Sample size was chosen according to previous experience with experimental models and assays. No sample or animal was excluded from the analyses. Mice were randomly assigned to each experimental group. Investigators were not blinded.
- the m 7/ ' e2-IFN-mirT, m7/ ' e2-GFP-mirT, PGK-OFP, PGK-tTA LV were previously described 9 ' 10 ' 14 .
- the NGFR-OVA transfer BdLV was generated by cloning the OVA cDNA (Agel - Sail) amplified from the PGK-OVA LV37 by PCR in place of the GFP cDNA (Agel - Sail) in the NGFR-GFP Bdl_V38 .
- the primers used were the followings: primer Fw: 5'- CGACCGGTCCACAAAGACAGCACCATGACA; primer Rv: 5'-
- the NGFR-CD20 transfer BdLV was generated by cloning the codon optimized human CD20 cDNA from a synthetized plasmid (Kpnl blunt - Sail) in place of the GFP cDNA (Agel blunt - Sail) in the NGFR-GFP BdLV.
- the NGFR-CAR19 and NGFR-iCAR19 transfer BdLVs were generated by cloning the CAR19 and inactive CAR19 sequences previously described (Kochenderfer, J.N. et al.
- C57BI/6 Ly45.2 and Ly45.1 mice were purchased from Charles River Laboratory.
- C57BI/6 Ly45.1/Ly45.2 were obtained by crossing C57BI/6 Ly45.2 and C57BI/6 Ly45.1 mice in the San Raffaele Scientific Institute animal research facility and used as donors for HPC transplant.
- Transgenic OT-I C57BI/6 Ly45.2 mice were maintained as colony at the San Raffaele Scientific Institute animal research facility. All animal procedures were performed according to protocols approved by the Animal Care and Use Committee of the San Raffaele Scientific Institute (IACUC 600) and communicated to the Ministry of Health and local authorities according to the Italian law.
- HSPC Hematopoietic stem progenitor cell transplantation
- mice Six-week-old C57BI/6 Ly45.2/Ly45.1 mice were euthanized with C02 and BM was harvested by flushing the femurs and tibias. Lineage-negative cells enriched in HS/PCs were isolated from total BM using an immuno-magnetic column-based cell purification system (lineage cell depletion kit mouse, Miltenyi, #130-090-858).
- 10 6 lineage negative cells/ml were then pre- stimulated for 3-4 hr in a serum-free StemSpan medium (StemCell Technologies) containing a cocktail of cytokines (20 ng/ml IL-3, 100 ng/ml SCF, 100 ng/ml FLT-3L, 50 ng/ml TPO all from Peprotech) and then transduced with the indicated lentiviral vectors at a dose of 10 8 transducing units/ml for 12 hr in the same cytokine-containing medium. After transduction, cells were washed and 10 6 cells were infused into the tail vein of lethally irradiated 6-week- old C57BI/6 Ly45.1 females.
- StemSpan medium StemSpan medium
- cytokines 20 ng/ml IL-3, 100 ng/ml SCF, 100 ng/ml FLT-3L, 50 ng/ml TPO all from Peprotech
- Transduced cells were also cultured in vitro for 15 days in IMDM supplemented with 10% FBS, SCF (100 ng/ml), FLT3L (100ng/ml), penicillin (100 Ill/ml), streptomycin (100ug/ml) and 2% glutamine and then tested together with the PBMC cells isolated from transplanted mice at stable hematopoietic reconstitution (6 weeks) to quantify the VCN by qPCR as previously described (De Palma et al., Blood 2005).
- the OVA-ALL sub-clone was generated by transducing the parental ALL clone #1 1 14 with the NGFR-OVA BdLV. Briefly, ALL were kept in culture at a concentration of 2x10 6 cell/ml in Stem Span supplemented with 10% FBS, penicillin (100 lU/ml), streptomycin (100ug/ml), 2% glutamine, IL3 (20ng/ml), SCF (100ng/ml), FLT3L (100ng/ml), TPO (50ng/ml) and transduced at 2x107 TU/ml with the NGFR-OVA BdLV.
- ALL were kept in culture at a concentration of 2x10 6 cell/ml in Stem Span supplemented with 10% FBS, penicillin (100 lU/ml), streptomycin (100ug/ml), 2% glutamine, IL3 (20ng/ml), SCF (100ng/ml), FLT3L (100ng/ml), T
- transduced ALL were washed and intravenously injected in sub-lethally irradiated (450 cGy) recipient C57BI/6 Ly45.2 mice.
- Leukemic mice were sacrificed 14 days later, when ALL reached 90% of total PB cells, and BM was harvested by flushing the femurs and tibias.
- NGFR+ transduced cells were isolated by immune-magnetic cell labeling (CD271 MicroBead Kit, Miltenyi, #130-099-023). Purity of selected ALL was determined by flow cytometer analysis by labeling cells with an anti NGFR antibody and was estimated to be 98% (NGFR+ ALL; see Fig. 5a). The OVA-ALL batch was then frozen in multiple aliquots, stored in liquid nitrogen and used for all experiments. For tumor challenge mice were intravenously injected with a dose of 10 5 OVA-ALL or 3x10 4 parental ALL resuspended in 200 ⁇ of phosphate buffer saline (PBS).
- PBS phosphate buffer saline
- OVA-ALL For re-challenge experiments we mixed OVA-ALL and parental (OVA- negative) ALL at a ratio of 1 :1 (105 total ALL).
- a mouse anti-mouse CTLA4 blocking monoclonal antibody (mAb clone 9D9 BioXCell, #BE0164) or the mouse isotype control antibody (mAb clone MCP-1 1 BioXCell, #BE0086) were administered intra-peritoneally from day 3 upon parental ALL or OVA-ALL injection at an initial dose of 200 ⁇ g/mouse and followed by doses of 100 ⁇ g/mouse every 3- 4 days for a total of five antibody infusions.
- an anti CD8 depleting monoclonal antibody (mAb 53-6.72 BioXCell, #BE0004-1 ) was administered intra-peritoneally to the mice at a dose of 200ug/mouse one day before OVA-ALL injection and then every 3 days for the entire duration of the experiment.
- OT-I T cells were purified from the spleen of 8 week-old transgenic female OT-I C57BI/6 Ly45.2 mice by immune-magnetic selection (CD8+ T cell isolation kit, Miltenyi, #130-104-075). Purity of selected OT-I T cells was evaluated by cytofluorimetric analysis using a panel of anti CD8, CD4 and CD3 antibodies. 1x10 6 naive OT-I T cells were intravenously injected in transplanted I FN or CTRL mice at the indicated time upon OVA-ALL injection.
- T cells were first purified from the spleen of 8 weeks-old female C57BI/6 CD45.2+ mice by immune-magnetic selection (Pan T cell isolation kit, Miltenyi, # 130-095-130) and subsequently activated with anti-CD3/CD28 Dyna beads (ThermoFisher # 1 1452D), according to manufacturer's instructions.
- T cells were cultured in RPMI supplemented with 10%FBS, penicillin (100U/ml), streptomycin (100ug/ml), 1 % glutamine, IL2 (30u/ml), IL7 (5ng/ml), IL15 (5ng/ml), Na Pyruvate (1 mM), Hepes (20mM), NEAA (1 uM) and Beta- Mercaptoethanol (0.05mM).
- T cells were transduced at a concentration of 1x10 6 cells/ml with 10 8 TU/ml of the NGFR-CAR19 or NGFR-iCAR19 BdLVs.
- In vivo proliferation assays were performed using 5-ethynyl-2'deoxyuridine (EdU, Invitrogen), a thymidine analogue used in alternative to BrdU.
- EdU was dissolved in sterile 1x PBS at a concentration of 10 mg/ml. Mice were injected i.p. with 100 ⁇ g of EdU 24h before analysis. BM and spleen were harvested and processed according to manufacturer's instructions (Click-iT® EdU Flow Cytometry Assay Kit, Invitrogen, #C10636), and percentages of EdU incorporation into leukemic cell were measured by flow cytometric analysis.
- the mouse EL4 C57BI/6-derived lymphoma cell line was maintained in IMDM supplemented with 10% FBS, penicillin (100 lU/ml), streptomycin (100 Mg/ml) and 2% glutamine. Transduction was performed at a concentration of 106 cell/ml with a dose of 10 8 TU/ml of the indicated vector stock. Cells were incubated for 12 hours and then washed to remove the vector. OFP on transduced cells was assessed upon 7 days of culture by flow cytometric analysis. NGFR and CD20 expression were evaluated by staining the cells with an anti- NGFR or anti-CD20 antibody at 7 days upon transduction (see flow cytometry section). The VCN of transduced cells was determined by real-time qPCR upon 15 days of culture as previously described (De Palma et al., Blood 2005).
- EL4 cells were washed and resuspended in PBS containing 2% FBS.
- FBS fetal bovine serum
- cells were incubated with anti-mouse Fc receptor blocking antibodies for 15 min at 4 °C and then stained for 20 min at 4 °C with the anti NGFR or anti CD20 antibodies (for antibodies see Supplementary Table 1 ).
- anti-mouse Fc receptor blocking antibodies for 15 min at 4 °C and then stained for 20 min at 4 °C with the anti NGFR or anti CD20 antibodies (for antibodies see Supplementary Table 1 ).
- PBS containing 10 ng/ml 7-aminoactinomycin D (7-AAD).
- peripheral blood For each mouse, 250 ⁇ of peripheral blood were added to 10 ⁇ _ of PBS containing 45 mg/mL EDTA.
- a known volume of whole blood 100 ⁇ was first incubated with anti-mouse Rev' 11/11 receptor (Cd16/Cd32) blocking antibodies for 10 min at room temperature and then incubated in the presence of monoclonal antibodies (for antibodies see Supplementary Table 1 ) for 15 min at room temperature.
- Erythrocytes were removed by lyses with the TQ-Prep workstation (Beckman-Coulter) in the presence of an equal volume of FBS (100 ⁇ ) to protect white blood cells.
- Treg cells staining in PB we first performed surface staining on 50 ⁇ of whole blood (for antibodies see Supplementary Table 1 ), as described above. Stained whole blood was then washed and resuspended in 10Oul of the Fixation/Permeabiliation solution (eBioscience, #00-5523-00) and incubated for 20 min at room temperature, washed and resuspended in 50 ⁇ of Permeabilization solution containing the anti-mouse FoxP3 or isotype control antibodies and incubated for 20 min at room temperature.
- Fixation/Permeabiliation solution eBioscience, #00-5523-00
- BM cells were obtained by flushing the femurs in PBS 2% FBS solution and by passing cell suspension through a 40 ⁇ nylon filter.
- Cells (1 x106 - 3x106 cells) were washed, resuspended in 100 ⁇ of PBS containing 2mM EDTA and 0.5% bovine BSA, and incubated with anti-mouse Rev' I l/l I receptor (Cd16/Cd32) blocking antibodies for 15 min at 4°C. Staining was then performed with monoclonal antibodies (for antibodies see Supplementary Table 1 ) for 20 min at 4°C. For OVA-specific pentamer staining, 1 x10 6 BM cells were stained as described above for PB.
- LIVE/DEAD Fixable Dead Cell Staining (ThermoFisher, #L34959) was used to discriminate alive and dead cells according to manufacturer's instructions.
- Treg staining in BM we first performed surface staining on 1x10 6 BM cells, as described above for PB.
- BM cells and splenocytes from OVA-ALL injected mice were harvested as described above. Cells were then stained for surface markers, washed and fixed using BD Cytofix buffer (BD #554655), washed and permeabilized with BD Perm 2 (BD #347692), washed and stained with PerCP-Cy5.5- or APC-conjugated Ki67 antibody and finally resuspended in BD Cytofix buffer with Hoechst at 1 ⁇ g/mL. Cells were then analyzed on a BD LSRFortessa machine with UV laser.
- BM cells and splenocytes from OVA-ALL injected mice were harvested as descrived above. Cells were then stained with surface markers as described above. Stained cells were then washed twice with the cell staining buffer (BioLegend, #420201 ) and resuspended in the Annexin V Binding Buffer (Biolegend #422201 ) and incubated with 5ul of Pacific blue conjugated Annexin V and 10ul of 7-AAD (Biolegend, #420403/420404) for 15 minutes at room temperature. 400ul of Annexin V Binding Buffer is then added to each sample and percentages of apoptotic/dead cells in OVA-ALL were measured by flow cytometric analysis within 30 min from staining.
- This measure is equivalent to S0rensen-Dice similarity index and it was evaluated including all / observed templates at time t.
- RNA-Seq libraries generated using reagents from the Nextera XT DNA Library Prep Kit (lllumina). Sequencing was performed on a NextSeq 500 machine (lllumina, San Diego, CA) using the NextSeq 500/550 High Output v2 kit (75 cycles).
- Droplet-based digital 3' end scRNA-Seq was performed on a Chromium Single-Cell Controller (10X Genomics, Pleasanton, CA) using the Chromium Single Cell 3' Reagent Kit v2 according to the manufacturer's instructions. Briefly, suspended single cells were partitioned in Gel Beads in Emulsion (GEMs) and lysed, followed by RNA barcoding, reverse transcription and PCR amplification (12-14 cycles). Sequencing-ready scRNA-Seq were prepared according to the manufacturer's instructions, checked and quantified on 2100 Bioanalyzer (Agilent Genomics, Santa Clara, CA) and Qubit 3.0 (Invitrogen, Carlsbad, CA) instruments. Sequencing was performed on a NextSeq 500 machine (lllumina, San Diego, CA) using the NextSeq 500/550 High Output v2 kit (75 cycles).
- GEMs Gel Beads in Emulsion
- Sequencing-ready scRNA-Seq were prepared
- Raw reads were processed and aligned to the ENSEMBL mm10 transcriptome using CellRanger version 1.3 (https://support.10xgenomics.com/single-cell-gene- expression/software/pipelines/latest/what-is-cell-ranger) with default parameters. Only confidently mapped reads, non-PCR duplicates, with valid barcodes and UMIs (Unique Molecular Identifiers) were retained. We filtered out low quality cells. A minimum of 300 unique genes detected for cell was required, additionally cells with a ratio of mitochondrial versus endogenous gene expression exceeding 0.1 were discarded. Resulting 10,821 cells were retained for further analysis. Gene expression values were quantified in log transformed transcript per million [log(TPM + 1 )].
- RNA expression was evaluated on an nCounter SPRINT instrument using the nCounter PanCancer Immune Profiler for Mouse panel (Nanostring Technologies) following manufacturer's instructions. Transcript counts obtained with NanoString® were processed as follows. Raw counts in RCC files were normalized using R/Bioconductor library NanoStringNorm (v 1.1 .21 ) 40 ; technical assay variation was normalized using geometric mean of internal controls, background was estimated calculating the mean of negative controls, RNA counts were normalized using the geometric mean of housekeeping genes expression, additional variance stabilization was applied. Differential expression of normalized data was evaluated by means of linear models implemented in the R/Bioconductor limma library 41 . Transcripts were considered differentially expressed with a threshold of adjusted p-value ⁇ 0.05 (Benjamini-Hochberg correction). Statistical analysis
- Nonparametric log-rank (Mantel-Haenszel) test statistics were used to compare the k survival curves related to the k-samples 48 . In the presence of more than 2 groups, multiple comparison issue was addressed by adjusting p-value by the Bonferroni method.
- Tumour-specificity is provided by transcriptional control through enhancer/promoter sequences from the Tie2 (Tek) locus driving transgene expression selectively in a subset of tumour-infiltrating myeloid cells, while preventing expression in hematopoietic stem and progenitor cells with the help of microRNA target sequences recognized by miR-126-3p and miR-130a, as described previously (Escobar, G. et al. (2014) Sci Transl Med 6: 217ra3). This construct was termed "Tig126/130a”.
- B-ALL B-acute lymphoblastic leukaemia
- mice 6- to 8-week old C57/BL6 mice were reconstituted with Lineage-negative HSPCs transduced with either Tig126/130a, Tta126/130a or a control lentiviral vector expressing the biologically inactive, truncated nerve growth factor receptor (NGFR) gene.
- Tig126/130a and Tta126/130a dosage was quantified as a vector copy number of 1 ,39 and 2,01 , respectively in vitro, and 0,44 and 0,83, respectively in vivo.
- Eight weeks post transplant upon reconstitution of the peripheral blood, animals received the B-ALL that is then followed by frequent blood collection. Compared to control animals, mice engineered to express IFNy showed significantly slower disease progression (Figure 29A).
- Tta126/130a vector had no measurable effect on leukaemia growth if deployed as a monotherapy.
- Vector copy number of the single vectors measured by specific quantitative PCR assays was rather low ranging from 0.1 to 0.3 in the reconstituted mice. Mice were challenged with B-ALL, as described above. Tia126 alone showed a reduction in leukaemia growth compared to control, similarly to combinations with either Tig126/130a or Tta126/130a ( Figure 30A).
- nucera, S. et al. miRNA-126 Orchestrates an Oncogenic Program in B Cell Precursor Acute Lymphoblastic Leukemia. Cancer Cell 29, 905-921 (2016). 15. De Palma, M., Venneri, M. A., Roca, C. & Naldini, L. Targeting exogenous genes to tumor angiogenesis by transplantation of genetically modified hematopoietic stem
- De Palma, M. et al. Tie2 identifies a hematopoietic lineage of proangiogenic
- NanoStringNorm An extensible R package for the pre-processing of nanostring mRNA and miRNA data. Bioinformatics 28, 1546-1548 (2012).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- General Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Developmental Biology & Embryology (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Virology (AREA)
- Environmental Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Endocrinology (AREA)
- Animal Husbandry (AREA)
- Biodiversity & Conservation Biology (AREA)
- Physics & Mathematics (AREA)
Priority Applications (25)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IL270028A IL270028B2 (en) | 2017-04-21 | 2018-04-20 | Garden care |
| SG11201909814W SG11201909814WA (en) | 2017-04-21 | 2018-04-20 | Gene therapy |
| EP24202037.8A EP4491233A3 (en) | 2017-04-21 | 2018-04-20 | Gene therapy |
| IL320674A IL320674A (en) | 2017-04-21 | 2018-04-20 | Garden care |
| LTEPPCT/EP2018/060238T LT3612624T (lt) | 2017-04-21 | 2018-04-20 | Genų terapija |
| BR112019021953-6A BR112019021953A2 (pt) | 2017-04-21 | 2018-04-20 | célula-tronco hematopoiética, célula progenitora hematopoiética, célula progenitora mieloide/monócito-comprometida, macrófago ou monócito, célula-t específica para antígeno associado a tumor, inibidor de ponto de checagem imune, 1-metil-triptofano, combinação de um inibidor de ponto de checagem imune e uma célula-t específica para antígeno associado a tumor, método para tratamento ou prevenção de um câncer, e, população de células-tronco hematopoiéticas, células progenitoras hematopoiéticas, células progenitoras mieloide/monócito-comprometidas, macrófagos ou monócitos. |
| KR1020197034111A KR102733541B1 (ko) | 2017-04-21 | 2018-04-20 | 유전자 치료법 |
| CA3060145A CA3060145A1 (en) | 2017-04-21 | 2018-04-20 | Cytokine gene therapy for treating or preventing cancer |
| US16/604,484 US20200078408A1 (en) | 2017-04-21 | 2018-04-20 | Gene therapy |
| DK18724470.2T DK3612624T3 (da) | 2017-04-21 | 2018-04-20 | Genterapi |
| PL18724470.2T PL3612624T3 (pl) | 2017-04-21 | 2018-04-20 | Terapia genowa |
| SM20240506T SMT202400506T1 (it) | 2017-04-21 | 2018-04-20 | Terapia genica |
| EP18724470.2A EP3612624B1 (en) | 2017-04-21 | 2018-04-20 | Gene therapy |
| RS20241344A RS66264B1 (sr) | 2017-04-21 | 2018-04-20 | Genska terapija |
| ES18724470T ES2995785T3 (en) | 2017-04-21 | 2018-04-20 | Gene therapy |
| HRP20241603TT HRP20241603T1 (hr) | 2017-04-21 | 2018-04-20 | Genska terapija |
| JP2019556929A JP7252135B2 (ja) | 2017-04-21 | 2018-04-20 | 遺伝子療法 |
| AU2018253959A AU2018253959B2 (en) | 2017-04-21 | 2018-04-20 | Gene therapy |
| CN201880040639.9A CN110785488A (zh) | 2017-04-21 | 2018-04-20 | 基因疗法 |
| EA201992514A EA201992514A1 (ru) | 2018-01-30 | 2018-04-20 | Генная терапия |
| SI201831181T SI3612624T1 (sl) | 2017-04-21 | 2018-04-20 | Genska terapija |
| FIEP18724470.2T FI3612624T3 (fi) | 2017-04-21 | 2018-04-20 | Geeniterapia |
| MX2024012023A MX2024012023A (es) | 2017-04-21 | 2019-10-21 | Combinaciones para usarse en el tratamiento o la prevencion del cancer |
| MX2024012024A MX2024012024A (es) | 2017-04-21 | 2019-10-21 | Combinaciones para usarse en el tratamiento o la prevencion del cancer |
| JP2023046113A JP2023078376A (ja) | 2017-04-21 | 2023-03-23 | 遺伝子療法 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB1706410.6A GB201706410D0 (en) | 2017-04-21 | 2017-04-21 | Type 1 interferon gene therapy |
| GB1706410.6 | 2017-04-21 | ||
| GB1801511.5 | 2018-01-30 | ||
| GBGB1801511.5A GB201801511D0 (en) | 2018-01-30 | 2018-01-30 | Gene therapy |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018193119A1 true WO2018193119A1 (en) | 2018-10-25 |
Family
ID=62165525
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2018/060238 Ceased WO2018193119A1 (en) | 2017-04-21 | 2018-04-20 | Gene therapy |
Country Status (23)
| Country | Link |
|---|---|
| US (1) | US20200078408A1 (https=) |
| EP (2) | EP4491233A3 (https=) |
| JP (2) | JP7252135B2 (https=) |
| KR (1) | KR102733541B1 (https=) |
| CN (1) | CN110785488A (https=) |
| AU (1) | AU2018253959B2 (https=) |
| BR (1) | BR112019021953A2 (https=) |
| CA (1) | CA3060145A1 (https=) |
| DK (1) | DK3612624T3 (https=) |
| ES (1) | ES2995785T3 (https=) |
| FI (1) | FI3612624T3 (https=) |
| HR (1) | HRP20241603T1 (https=) |
| HU (1) | HUE069690T2 (https=) |
| IL (2) | IL270028B2 (https=) |
| LT (1) | LT3612624T (https=) |
| MX (2) | MX2024012023A (https=) |
| PL (1) | PL3612624T3 (https=) |
| PT (1) | PT3612624T (https=) |
| RS (1) | RS66264B1 (https=) |
| SG (1) | SG11201909814WA (https=) |
| SI (1) | SI3612624T1 (https=) |
| SM (1) | SMT202400506T1 (https=) |
| WO (1) | WO2018193119A1 (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113710796A (zh) * | 2019-02-09 | 2021-11-26 | 美国卫生和人力服务部 | 作为减少或预防转移、治疗自身免疫和炎性病症以及重新平衡免疫环境和失调的小生境的平台的基因修饰的造血干细胞和祖细胞(hspc)及间充质细胞 |
| CN113825522A (zh) * | 2019-02-22 | 2021-12-21 | 昂科利蒂克斯生物科技公司 | T细胞库动态和溶瘤病毒疗法 |
| EP3941490A4 (en) * | 2019-03-20 | 2023-01-04 | 2seventy bio, Inc. | ADOPTIVE CELLULAR THERAPY |
| JP2023529841A (ja) * | 2020-06-04 | 2023-07-12 | カリスマ セラピューティクス インコーポレイテッド | キメラ抗原受容体のための新規コンストラクト |
| WO2024068617A1 (en) * | 2022-09-26 | 2024-04-04 | Institut Curie | Myeloid cells expressing il-2 and uses thereof for quick anticancer therapy |
| WO2024194223A3 (en) * | 2023-03-17 | 2024-12-05 | Ospedale San Raffaele S.R.L. | Gene therapy |
| WO2025217427A1 (en) * | 2024-04-11 | 2025-10-16 | Genenta Science S.P.A. | Combination immunotherapy of solid cancers |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112280829B (zh) * | 2020-04-07 | 2023-12-26 | 南方科技大学 | 一种试剂盒、样本标记方法、单细胞测序方法 |
| KR20230010231A (ko) * | 2020-05-11 | 2023-01-18 | 아빈투스 바이오, 인코포레이티드 | 생체내 형질도입을 위한 벡터 및 방법 |
| GB202007169D0 (en) * | 2020-05-14 | 2020-07-01 | Ospedale San Raffaele Srl | Epidermal growth factor receptor |
| CN114426953A (zh) * | 2020-10-29 | 2022-05-03 | 未来智人再生医学研究院(广州)有限公司 | 一种表达il-12的多能干细胞衍生物及应用 |
| JP2023547692A (ja) * | 2020-11-03 | 2023-11-13 | ▲広▼州▲輯▼因医▲療▼科技有限公司 | 細胞製剤、造血幹細胞を特徴付けるためのタンパク質の使用、及び造血幹細胞を判定するための方法 |
| CN114807155A (zh) * | 2021-01-18 | 2022-07-29 | 华东师范大学 | 用于基因编辑的组合物及其应用 |
| CN115819612A (zh) * | 2022-03-11 | 2023-03-21 | 郑州大学第一附属医院 | 表达载体、宿主细胞、抗肿瘤药物组合物及其应用 |
| CN120603934A (zh) * | 2023-02-08 | 2025-09-05 | 国立大学法人九州大学 | 能够在肿瘤组织内分化成m2巨噬细胞且分化成m2巨噬细胞时表达炎性细胞因子的细胞和含有该细胞的组合物 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1999041397A1 (en) | 1998-02-17 | 1999-08-19 | Oxford Biomedica (Uk) Limited | Anti-viral vectors |
| WO2001079518A2 (en) | 2000-04-19 | 2001-10-25 | Oxford Biomedica (Uk) Limited | Codon optimisation for expression in retrovirus packaging cells |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SI2856876T1 (en) * | 2007-03-30 | 2018-04-30 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| PL2424571T3 (pl) * | 2009-04-30 | 2020-10-19 | Ospedale San Raffaele S.R.L | Wektor genowy |
| AU2013374345A1 (en) * | 2013-01-17 | 2015-08-06 | Moderna Therapeutics, Inc. | Signal-sensor polynucleotides for the alteration of cellular phenotypes |
| US10562952B2 (en) * | 2015-09-10 | 2020-02-18 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-CD276 chimeric antigen receptors |
| WO2017093969A1 (en) * | 2015-12-04 | 2017-06-08 | Novartis Ag | Compositions and methods for immunooncology |
-
2018
- 2018-04-20 IL IL270028A patent/IL270028B2/en unknown
- 2018-04-20 BR BR112019021953-6A patent/BR112019021953A2/pt unknown
- 2018-04-20 RS RS20241344A patent/RS66264B1/sr unknown
- 2018-04-20 HU HUE18724470A patent/HUE069690T2/hu unknown
- 2018-04-20 HR HRP20241603TT patent/HRP20241603T1/hr unknown
- 2018-04-20 LT LTEPPCT/EP2018/060238T patent/LT3612624T/lt unknown
- 2018-04-20 DK DK18724470.2T patent/DK3612624T3/da active
- 2018-04-20 WO PCT/EP2018/060238 patent/WO2018193119A1/en not_active Ceased
- 2018-04-20 CN CN201880040639.9A patent/CN110785488A/zh active Pending
- 2018-04-20 IL IL320674A patent/IL320674A/en unknown
- 2018-04-20 EP EP24202037.8A patent/EP4491233A3/en active Pending
- 2018-04-20 SI SI201831181T patent/SI3612624T1/sl unknown
- 2018-04-20 PT PT187244702T patent/PT3612624T/pt unknown
- 2018-04-20 SM SM20240506T patent/SMT202400506T1/it unknown
- 2018-04-20 FI FIEP18724470.2T patent/FI3612624T3/fi active
- 2018-04-20 AU AU2018253959A patent/AU2018253959B2/en active Active
- 2018-04-20 SG SG11201909814W patent/SG11201909814WA/en unknown
- 2018-04-20 KR KR1020197034111A patent/KR102733541B1/ko active Active
- 2018-04-20 ES ES18724470T patent/ES2995785T3/es active Active
- 2018-04-20 CA CA3060145A patent/CA3060145A1/en active Pending
- 2018-04-20 EP EP18724470.2A patent/EP3612624B1/en active Active
- 2018-04-20 JP JP2019556929A patent/JP7252135B2/ja active Active
- 2018-04-20 US US16/604,484 patent/US20200078408A1/en active Pending
- 2018-04-20 PL PL18724470.2T patent/PL3612624T3/pl unknown
-
2019
- 2019-10-21 MX MX2024012023A patent/MX2024012023A/es unknown
- 2019-10-21 MX MX2024012024A patent/MX2024012024A/es unknown
-
2023
- 2023-03-23 JP JP2023046113A patent/JP2023078376A/ja active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1999041397A1 (en) | 1998-02-17 | 1999-08-19 | Oxford Biomedica (Uk) Limited | Anti-viral vectors |
| WO2001079518A2 (en) | 2000-04-19 | 2001-10-25 | Oxford Biomedica (Uk) Limited | Codon optimisation for expression in retrovirus packaging cells |
Non-Patent Citations (102)
| Title |
|---|
| "Current Protocols in Molecular Biology", JOHN WILEY & SONS, article CHAPT. 9,13,16 |
| "R Development Core Team. R: A Language and Environment for Statistical Computing", R FOUNDATION FOR STATISTICAL COMPUTING VIENNA, 2016, ISBN: 3-900051-07-0 |
| AMENDOLA, M.; VENNERI, M. A.; BIFFI, A.; VIGNA, E.; NALDINI, L.: "Coordinate dual-gene transgenesis by lentiviral vectors carrying synthetic bidirectional promoters", NAT. BIOTECHNOL., vol. 23, 2005, pages 108 - 116, XP002389318, DOI: doi:10.1038/nbt1049 |
| ATSCHUL ET AL., J. MOL. BIOL., 1990, pages 403 - 410 |
| BACHIREDDY, P.; BURKHARDT, U. E.; RAJASAGI, M.; WU, C. J.: "Haematological malignancies: at the forefront of immunotherapeutic innovation", NAT. REV. CANCER, vol. 15, 2015, pages 201 - 215, XP055341031, DOI: doi:10.1038/nrc3907 |
| BERGE ET AL., J PHARM SCI, vol. 66, 1977, pages 1 - 19 |
| BRENTJENS ET AL., CCR, vol. 13, no. 18, 15 September 2007 (2007-09-15), pages 5426 - 35 |
| BRUNNER, E.; DOMHOF, S.; LANGER, F.: "Nonparametric analysis of longitudinal data in factorial experiments", WILEY SER. PROBAB. STAT., vol. xvii, 2002, pages 261 |
| BRUNNER, E.; PURI, M. L.: "Nonparametric methods in factorial designs", STAT. PAP., vol. 42, 2001, pages 1 - 52 |
| CASUCCI ET AL., BLOOD, vol. 122, no. 20, 14 November 2013 (2013-11-14), pages 3461 - 72 |
| CASUCCI, M. ET AL., BLOOD, vol. 122, 2013, pages 3461 - 3472 |
| CATARINELLA M ET AL: "IFNalpha gene/cell therapy curbs colorectal cancer colonization of the liver by acting on the hepatic microenvironment", EMBO MOLECULAR MEDICINE, vol. 8, no. 2, 14 January 2016 (2016-01-14), pages 155 - 170, XP055492868, ISSN: 1757-4676, DOI: 10.15252/emmm.201505395 * |
| CATARINELLA, M. ET AL., EMBO MOL. MED., vol. 8, 2016, pages 155 - 170 |
| CATARINELLA, M. ET AL.: "IFNa gene/cell therapy curbs colorectal cancer colonization of the liver by acting on the hepatic microenvironment", EMBO MOL. MED., vol. 8, 2016, pages 155 - 70 |
| CHIRIACO M ET AL: "Dual-regulated Lentiviral Vector for Gene Therapy of X-linked Chronic Granulomatosis", MOLECULAR THERAPY, vol. 22, no. 8, 24 June 2014 (2014-06-24), US, pages 1472 - 1483, XP055492876, ISSN: 1525-0016, DOI: 10.1038/mt.2014.87 * |
| COFFIN ET AL.: "Retroviruses", 1997, COLD SPRING HARBOUR LABORATORY PRESS, pages: 758 - 763 |
| DAVILA, M.L. ET AL., PLOS ONE, vol. 8, 2013, pages 1 - 14 |
| DE PALMA ET AL., BLOOD, 2005 |
| DE PALMA, M. ET AL., CANCER CELL, vol. 14, 2008, pages 299 - 311 |
| DE PALMA, M. ET AL., CANCER CELL, vol. 8, 2005, pages 211 - 226 |
| DE PALMA, M. ET AL.: "Tie2 identifies a hematopoietic lineage of proangiogenic monocytes required for tumor vessel formation and a mesenchymal population of pericyte progenitors", CANCER CELL, vol. 8, 2005, pages 211 - 26, XP055124188, DOI: doi:10.1016/j.ccr.2005.08.002 |
| DE PALMA, M. ET AL.: "Tumor-Targeted Interferon-Alpha Delivery by Tie2-Expressing Monocytes Inhibits Tumor Growth and Metastasis", CANCER CELL, vol. 14, 2008, pages 299 - 311, XP055343537, DOI: doi:10.1016/j.ccr.2008.09.004 |
| DE PALMA, M.; VENNERI, M. A.; ROCA, C.; NALDINI, L.: "Targeting exogenous genes to tumor angiogenesis by transplantation of genetically modified hematopoietic stem cells", NAT. MED., vol. 9, 2003, pages 789 - 95, XP002527465, DOI: doi:10.1038/nm871 |
| DEVEREUX ET AL., NUCLEIC ACIDS RES., vol. 12, 1984, pages 387 |
| ESCOBAR G ET AL: "Genetic Engineering of Hematopoiesis for Targeted IFN-alpha Delivery Inhibits Breast Cancer Progression", SCIENCE TRANSLATIONAL MEDICINE, vol. 6, no. 217, 217RA3, 1 January 2014 (2014-01-01), XP055492866, ISSN: 1946-6234, DOI: 10.1126/scitranslmed.3006353 * |
| ESCOBAR, G. ET AL., SCI TRANSL MED, vol. 6, 2014, pages 217ra3 |
| ESCOBAR, G. ET AL., SCI. TRANSL. MED., vol. 6, 2014, pages 217ra3 |
| ESCOBAR, G. ET AL.: "Genetic engineering of hematopoiesis for targeted IFN-a delivery inhibits breast cancer progression", SCI. TRANSL. MED., vol. 6, 2014, pages 217ra3 |
| FEMS MICROBIOL. LETT., vol. 174, 1999, pages 247 - 50 |
| FEMS MICROBIOL. LETT., vol. 177, 1999, pages 187 - 8 |
| FESNAK, A. D.; JUNE, C. H.; LEVINE, B. L.: "Engineered T cells: the promise and challenges of cancer immunotherapy", NAT. REV. CANCER, vol. 16, 2016, pages 566 - 81, XP055356975, DOI: doi:10.1038/nrc.2016.97 |
| FEYS, J., NEW NONPARAMETRIC RANK TESTS FOR INTERACTIONS IN FACTORIAL DESIGNS WITH REPEATED MEASURES NEW NONPARAMETRIC RANK TESTS FOR, vol. 15, 2016 |
| FOLLENZI, A. ET AL., NAT. GENET., vol. 25, 2000, pages 217 - 222 |
| FUERTES, M. B.; WOO, S. R.; BURNETT, B.; FU, Y. X.; GAJEWSKI, T. F.: "Type I interferon response and innate immune sensing of cancer", TRENDS IMMUNOL., vol. 34, 2013, pages 67 - 73 |
| GAIT, M.J.: "Oligonucleotide Synthesis: A Practical Approach", 1984, IRL PRESS |
| GENTLES, A. J. ET AL.: "The prognostic landscape of genes and infiltrating immune cells across human cancers", NAT. MED., vol. 21, 2015, pages 938 - 945 |
| GENTNER B ET AL: "Identification of Hematopoietic Stem Cell-Specific miRNAs Enables Gene Therapy of Globoid Cell Leukodystrophy", SCIENCE TRANSLATIONAL MEDICINE, vol. 2, no. 58, 58RA84, 17 November 2010 (2010-11-17), XP055492874, ISSN: 1946-6234, DOI: 10.1126/scitranslmed.3001522 * |
| GREENFIELD: "Antibodies: A Laboratory Manual", 2014, pages: 201 - 221 |
| HERVAS-STUBBS, S. ET AL.: "Direct effects of type I interferons on cells of the immune system", CLIN. CANCER RES., vol. 17, 2011, pages 2619 - 27 |
| HUANG, T.-H.; CHINTALACHARUVU, K. R.; MORRISON, S. L.: "Targeting IFN-alpha to B Cell Lymphoma by a Tumor-Specific Antibody Elicits Potent Antitumor Activities", J. IMMUNOL., vol. 179, 2007, pages 6881 - 6888, XP009158288, DOI: doi:10.4049/jimmunol.179.10.6881 |
| HUDSON; KORTT, J IMMUNOL METHODS, vol. 231, no. 1, 1999, pages 177 - 189 |
| IMAI C, LEUKEMIA, vol. 18, no. 4, April 2004 (2004-04-01), pages 676 - 84 |
| JOSEPH BENCI, A. L. ET AL.: "Tumor Interferon Signaling Regulates a Multigenic Resistance Program to Immune Checkpoint Blockade", CELL, vol. 167, 2016, pages 1540 - 1554 |
| JOYCE JOHANNA A.; FEARON DOUGLAS T.: "T cell exclusion, immune privilege, and the tumor microenvironment", SCIENCE, vol. 80, 2015, pages 348 |
| KHALIL, D. N.; SMITH, E. L.; BRENTJENS, R. J.; WOLCHOK, J. D.: "The future of cancer treatment: immunomodulation, CARs and combination immunotherapy", NAT. REV. CLIN. ONCOL., vol. 13, 2016, pages 273 - 290, XP055290129, DOI: doi:10.1038/nrclinonc.2016.25 |
| KOCHENDERFER, J.N. ET AL., BLOOD, vol. 116, 2010, pages 3875 - 3886 |
| KUMAR, V.; PATEL, S.; TCYGANOV, E.; GABRILOVICH, D. I.: "The Nature of Myeloid-Derived Suppressor Cells in the Tumor Microenvironment", TRENDS IMMUNOL., vol. 37, 2016, pages 208 - 220, XP029434236, DOI: doi:10.1016/j.it.2016.01.004 |
| LAVIN, Y. ET AL., CELL, vol. 159, 2014, pages 1312 - 1326 |
| LEWIS ET AL., EMBO J., 1992, pages 3053 - 3058 |
| LILLEY, D.M.; DAHLBERG, J.E.: "Methods in Enzymology: DNA Structures Part A: Synthesis and Physical Analysis of DNA", 1992, ACADEMIC PRESS |
| LINNEMANN ET AL., NATURE MEDICINE, vol. 19, 2013, pages 1534 - 1541 |
| LINNEMANN, C. ET AL.: "High-throughput epitope discovery reveals frequent recognition of neo-antigens by CD4+ T cells in human melanoma", NAT MED, vol. 21, 2015, pages 81 - 85 |
| LOMBARDO A., NATURE BIOTECHNOLOGY, vol. 25, 2007, pages 1298 - 1306 |
| LU, Y. C. ET AL.: "Efficient identification of mutated cancer antigens recognized by T cells associated with durable tumor regressions", CLIN. CANCER RES., vol. 20, 2014, pages 3401 - 3410, XP055161431, DOI: doi:10.1158/1078-0432.CCR-14-0433 |
| MAHER ET AL., NAT BIOTECHNOL, vol. 20, no. 1, January 2002 (2002-01-01), pages 70 - 5 |
| MATRAI, J. ET AL.: "Hepatocyte-targeted expression by integrase-defective lentiviral vectors induces antigen-specific tolerance in mice with low genotoxic risk", HEPATOLOGY, vol. 53, 2011, pages 1696 - 1707, XP055054208, DOI: doi:10.1002/hep.24230 |
| MATSUSHITA, H. ET AL.: "Cancer exome analysis reveals a T-cell-dependent mechanism of cancer immunoediting", NATURE, vol. 482, 2012, pages 400 - 4, XP055355530, DOI: doi:10.1038/nature10755 |
| MCGRANAHAN, N. ET AL.: "Clonal neoantigens elicit T cell immunoreactivity and sensitivity to immune checkpoint blockade", SCIENCE, vol. 80, no. 351, 2016, pages 1463 - 1469 |
| MELLMAN, I.; COUKOS, G.; DRANOFF, G.: "Cancer immunotherapy comes of age", NATURE, vol. 480, 2011, pages 480 - 9, XP055054665, DOI: doi:10.1038/nature10673 |
| MILONE ET AL., MOL THER, vol. 17, no. 8, August 2009 (2009-08-01), pages 1453 - 64 |
| MLECNIK, B. ET AL.: "Integrative Analyses of Colorectal Cancer Show Immunoscore Is a Stronger Predictor of Patient Survival Than Microsatellite Instability", IMMUNITY, vol. 44, 2016, pages 698 - 711, XP029449042, DOI: doi:10.1016/j.immuni.2016.02.025 |
| NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 556 |
| NOGUCHI, K.; GEL, Y. R.; BRUNNER, E.; KONIETSCHKE, F.: "nparLD: An R software package for the nonparametric analysis of longitudinal data in factorial experiments", J. STAT. SOFTW., vol. 50, 2012, pages 1 - 23 |
| NUCERA, S. ET AL., CANCER CELL, vol. 29, 2016, pages 905 - 921 |
| NUCERA, S. ET AL.: "miRNA-126 Orchestrates an Oncogenic Program in B Cell Precursor Acute Lymphoblastic Leukemia", CANCER CELL, vol. 29, 2016, pages 905 - 921, XP029601437, DOI: doi:10.1016/j.ccell.2016.05.007 |
| OKAMOTO S., CANCER RESEARCH, vol. 69, 2009, pages 9003 - 9011 |
| PARKER, B. S.; RAUTELA, J.; HERTZOG, P. J.: "Antitumour actions of interferons: implications for cancer therapy", NAT. REV. CANCER, vol. 16, 2016, pages 131 - 44, XP055325896, DOI: doi:10.1038/nrc.2016.14 |
| PESARIN, F.; SALMASO, L.: "Permutation Tests for Complex Data. Permutation Tests for Complex Data: Theory", APPLICATIONS AND SOFTWARE, 2010 |
| PICELLI, S. ET AL., NAT. PROTOC., vol. 9, 2014, pages 171 - 181 |
| PITT, J. M. ET AL.: "Resistance Mechanisms to Immune-Checkpoint Blockade in Cancer: Tumor-Intrinsic and -Extrinsic Factors", IMMUNITY, vol. 44, 2016, pages 1255 - 1269, XP029619117, DOI: doi:10.1016/j.immuni.2016.06.001 |
| POLAK, J.M.; MCGEE, J.O'D.: "In Situ Hybridization: Principles and Practice", 1990, OXFORD UNIVERSITY PRESS |
| POLJAK, STRUCTURE, vol. 2, no. 12, 1994, pages 1121 - 1123 |
| PROVASI E.; GENOVESE P., NATURE MEDICINE, vol. 18, no. 5, May 2012 (2012-05-01), pages 807 - 15 |
| PULE ET AL., MOL THER, vol. 12, no. 5, November 2005 (2005-11-01), pages 933 - 41 |
| RITCHIE, M. E. ET AL.: "limma powers differential expression analyses for RNA742 sequencing and microarray studies", NUCLEIC ACIDS RES., vol. 43, 2015, pages e47 |
| ROE, B.; CRABTREE, J.; KAHN, A.: "DNA Isolation and Sequencing: Essential Techniques", 1996, JOHN WILEY & SONS |
| RONDON; MARASCO, ANNUAL REVIEW OF MICROBIOLOGY, vol. 21, 1997, pages 257 - 283 |
| ROSENBERG, S. A.; RESTIFO, N. P.: "Adoptive cell transfer as personalized immunotherapy for human cancer", SCIENCE, vol. 80, no. 348, 2015, pages 62 - 68 |
| RUFFELL, B.; COUSSENS, L. M.: "Macrophages and therapeutic resistance in cancer", CANCER CELL, vol. 27, 2015, pages 462 - 472 |
| SAMBROOK, J.; FRITSCH, E.F.; MANIATIS, T.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SANDLER, N. G. ET AL.: "Type I interferon responses in rhesus macaques prevent SIV infection and slow disease progression", NATURE, vol. 511, 2014, pages 601 - 605 |
| SAVOLDO B, BLOOD, vol. 113, no. 25, 18 June 2009 (2009-06-18), pages 6392 - 402 |
| SCHADENDORF, D. ET AL.: "Pooled Analysis of Long-Term Survival Data From Phase II and Phase III Trials of Ipilimumab in Unresectable or Metastatic Melanoma", J. CLIN. ONCOL., vol. 33, 2015, pages 1889 - 94 |
| SCHILDBERG, F. A.; KLEIN, S. R.; FREEMAN, G. J.; SHARPE, A. H.: "Coinhibitory Pathways in the B7-CD28 Ligand-Receptor Family", IMMUNITY, vol. 44, 2016, pages 955 - 972, XP029537993, DOI: doi:10.1016/j.immuni.2016.05.002 |
| SCHUMACHER, T. N.; SCHREIBER, R. D.: "Neoantigens in cancer immunotherapy", SCIENCE, vol. 80, no. 348, 2015, pages 69 - 74 |
| SHARMA P & ALLISON J P: "Immune Checkpoint Targeting in Cancer Therapy: Toward Combination Strategies with Curative Potential", CELL, vol. 161, no. 2, 9 April 2015 (2015-04-09), pages 205 - 214, XP055427087, ISSN: 0092-8674, DOI: 10.1016/j.cell.2015.03.030 * |
| SHARMA, P.; ALLISON, J. P: "Immune Checkpoint Targeting in Cancer Therapy : Toward Combination Strategies with Curative Potential", CELL, vol. 161, 2015, pages 205 - 214, XP055427087, DOI: doi:10.1016/j.cell.2015.03.030 |
| SOTILLO, E. ET AL.: "Convergence of acquired mutations and alternative splicing of CD19 enables resistance to CART-19 immunotherapy", CANCER DISCOV., vol. 5, 2015, pages 1282 - 1295, XP055376174, DOI: doi:10.1158/2159-8290.CD-15-1020 |
| TARHINI A A ET AL: "Safety and Efficacy of Combination Immunotherapy With Interferon Alfa-2b and Tremelimumab in Patients With Stage IV Melanoma", JOURNAL OF CLINICAL ONCOLOGY, vol. 30, no. 3, 20 January 2012 (2012-01-20), pages 322 - 328, XP055492880, ISSN: 0732-183X, DOI: 10.1200/JCO.2011.37.5394 * |
| THERNEAU, T. M.: "A Package for Survival Analysis in S", SURVIVAL, 2015 |
| TODOROVSKA ET AL., J IMMUNOL METHODS, vol. 248, no. 1, 2001, pages 47 - 66 |
| TOPALIAN, S. L.; DRAKE, C. G.; PARDOLL, D. M.: "Immune Checkpoint Blockade : A Common Denominator Approach to Cancer Therapy", CANCER CELL, vol. 27, 2015, pages 450 - 461, XP055372181, DOI: doi:10.1016/j.ccell.2015.03.001 |
| TUMEH, P.; HARVIEW, C.; YEARLEY, J.; AL, E: "PD-1 blockade induces responses by inhibiting adaptive immune resistance", NATURE, vol. 515, 2014, pages 568 - 571, XP055247294, DOI: doi:10.1038/nature13954 |
| UCKERT, J IMMUNOL, vol. 184, 2010, pages 6223 - 6231 |
| VAROL, D. ET AL., IMMUNITY, vol. 46, 2017, pages 1030 - 1044 |
| VERDEGAAL, E. M. E. ET AL.: "Neoantigen landscape dynamics during human melanoma-T cell interactions", NATURE, vol. 536, 2016, pages 91 - 5 |
| WAGGOTT, D. ET AL.: "NanoStringNorm: An extensible R package for the pre-processing of nanostring mRNA and miRNA data", BIOINFORMATICS, vol. 28, 2012, pages 1546 - 1548, XP055389668, DOI: doi:10.1093/bioinformatics/bts188 |
| WILSON, E. B. ET AL.: "Blockade of chronic type I interferon signaling to control persistent LCMV infection", SCIENCE, vol. 340, 2013, pages 202 - 7 |
| YANEZ, A. ET AL., IMMUNITY, vol. 47, 2017, pages 890 - 902 |
| YANG, X. ET AL.: "Targeting the Tumor Microenvironment with interferon-β Bridges Innate and Adaptive Immune Responses", CANCER CELL, vol. 25, 2014, pages 37 - 48, XP028808992, DOI: doi:10.1016/j.ccr.2013.12.004 |
| ZHENG, G.X. ET AL., NAT. COMMUN., vol. 8, 2017, pages 14049 |
| ZILBERBERG ET AL., BIOLOGY OF BLOOD AND MARROW TRANSPLANTATION, vol. 21, no. 6, June 2015 (2015-06-01), pages 1000 - 1007 |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113710796A (zh) * | 2019-02-09 | 2021-11-26 | 美国卫生和人力服务部 | 作为减少或预防转移、治疗自身免疫和炎性病症以及重新平衡免疫环境和失调的小生境的平台的基因修饰的造血干细胞和祖细胞(hspc)及间充质细胞 |
| CN113825522A (zh) * | 2019-02-22 | 2021-12-21 | 昂科利蒂克斯生物科技公司 | T细胞库动态和溶瘤病毒疗法 |
| EP3927359A4 (en) * | 2019-02-22 | 2023-01-25 | Oncolytics Biotech, Inc. | DYNAMICS OF T LYMPHOCYTE REPERTORY AND VIRAL ONCOLYTIC THERAPY |
| EP3941490A4 (en) * | 2019-03-20 | 2023-01-04 | 2seventy bio, Inc. | ADOPTIVE CELLULAR THERAPY |
| JP2023529841A (ja) * | 2020-06-04 | 2023-07-12 | カリスマ セラピューティクス インコーポレイテッド | キメラ抗原受容体のための新規コンストラクト |
| JP7824235B2 (ja) | 2020-06-04 | 2026-03-04 | カリスマ セラピューティクス インコーポレイテッド | キメラ抗原受容体のための新規コンストラクト |
| WO2024068617A1 (en) * | 2022-09-26 | 2024-04-04 | Institut Curie | Myeloid cells expressing il-2 and uses thereof for quick anticancer therapy |
| WO2024194223A3 (en) * | 2023-03-17 | 2024-12-05 | Ospedale San Raffaele S.R.L. | Gene therapy |
| WO2025217427A1 (en) * | 2024-04-11 | 2025-10-16 | Genenta Science S.P.A. | Combination immunotherapy of solid cancers |
Also Published As
| Publication number | Publication date |
|---|---|
| PL3612624T3 (pl) | 2025-02-24 |
| EP4491233A3 (en) | 2025-04-16 |
| MX2024012023A (es) | 2025-02-10 |
| IL320674A (en) | 2025-07-01 |
| IL270028A (https=) | 2019-12-31 |
| HUE069690T2 (hu) | 2025-04-28 |
| EP3612624B1 (en) | 2024-09-25 |
| DK3612624T3 (da) | 2024-12-09 |
| IL270028B2 (en) | 2025-10-01 |
| KR20200020677A (ko) | 2020-02-26 |
| AU2018253959B2 (en) | 2024-11-21 |
| JP7252135B2 (ja) | 2023-04-04 |
| HRP20241603T1 (hr) | 2025-01-31 |
| SI3612624T1 (sl) | 2025-03-31 |
| CA3060145A1 (en) | 2018-10-25 |
| IL270028B1 (en) | 2025-06-01 |
| JP2020517261A (ja) | 2020-06-18 |
| ES2995785T3 (en) | 2025-02-11 |
| RS66264B1 (sr) | 2024-12-31 |
| EP4491233A2 (en) | 2025-01-15 |
| FI3612624T3 (fi) | 2024-12-04 |
| LT3612624T (lt) | 2025-01-10 |
| MX2024012024A (es) | 2025-02-10 |
| EP3612624A1 (en) | 2020-02-26 |
| KR102733541B1 (ko) | 2024-11-22 |
| JP2023078376A (ja) | 2023-06-06 |
| SMT202400506T1 (it) | 2025-01-14 |
| PT3612624T (pt) | 2024-11-29 |
| SG11201909814WA (en) | 2019-11-28 |
| US20200078408A1 (en) | 2020-03-12 |
| CN110785488A (zh) | 2020-02-11 |
| BR112019021953A2 (pt) | 2020-07-21 |
| AU2018253959A1 (en) | 2019-11-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3612624B1 (en) | Gene therapy | |
| US11931381B2 (en) | Immunocompetent cell and expression vector expressing regulatory factors of immune function | |
| CN107106611B (zh) | 用于提高过继细胞免疫疗法效力的组合物和方法 | |
| JP7412666B2 (ja) | HPK1を標的とするgRNA及びHPK1遺伝子の編集方法 | |
| CN117802050A (zh) | 修饰的细胞群及组合物 | |
| CN115885038A (zh) | 表达嵌合抗原受体的免疫活性细胞 | |
| WO2023235440A2 (en) | Compositions and methods comprising chimeric adaptor polypeptides | |
| JP2026021420A (ja) | 二重car-t細胞 | |
| JP2024541976A (ja) | キメラアダプターポリペプチド | |
| JP2024502170A (ja) | 癌のための改良された養子細胞移植療法 | |
| US20260053856A1 (en) | Immunocompetent cell and expression vector expressing regulatory factors of immune function / a cell surface molecule specifically recognizing human mesothelin, il-7 and ccl19 | |
| EA046120B1 (ru) | Генная терапия | |
| US20230303643A1 (en) | Constitutively active tcf1 to promote memory-associated traits in car t cells | |
| WO2024194223A2 (en) | Gene therapy | |
| HK1260765B (en) | Immunocompetent cell and expression vector expressing regulatory factors of immune function |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18724470 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3060145 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019556929 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019021953 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20197034111 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018253959 Country of ref document: AU Date of ref document: 20180420 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018724470 Country of ref document: EP Effective date: 20191121 |
|
| ENP | Entry into the national phase |
Ref document number: 112019021953 Country of ref document: BR Kind code of ref document: A2 Effective date: 20191018 |
|
| WWR | Wipo information: refused in national office |
Ref document number: 519410327 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 519410327 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 519410327 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: P-2024/1344 Country of ref document: RS |
|
| WWG | Wipo information: grant in national office |
Ref document number: P-2024/1344 Country of ref document: RS |
|
| WWG | Wipo information: grant in national office |
Ref document number: 11201909814W Country of ref document: SG |
|
| WWP | Wipo information: published in national office |
Ref document number: 11201909814W Country of ref document: SG |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 320674 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523440326 Country of ref document: SA |