WO2018148585A1 - Anti-tryptase antibodies, compositions thereof, and uses thereof - Google Patents

Anti-tryptase antibodies, compositions thereof, and uses thereof Download PDF

Info

Publication number
WO2018148585A1
WO2018148585A1 PCT/US2018/017680 US2018017680W WO2018148585A1 WO 2018148585 A1 WO2018148585 A1 WO 2018148585A1 US 2018017680 W US2018017680 W US 2018017680W WO 2018148585 A1 WO2018148585 A1 WO 2018148585A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
amino acid
acid sequence
composition
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/017680
Other languages
English (en)
French (fr)
Inventor
Xiaocheng Chen
Mark Dennis
Janet Jackman
James T. KOERBER
Mason Lu
Henry R. Maun
Kathila RAJAPAKSA
Saroja Ramanujan
Tracy STATON
Lawren Wu
Tangsheng YI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
F Hoffmann La Roche AG
Genentech Inc
Original Assignee
F Hoffmann La Roche AG
Genentech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to SG11201907364WA priority Critical patent/SG11201907364WA/en
Priority to CA3051700A priority patent/CA3051700A1/en
Priority to MYPI2019004606A priority patent/MY197534A/en
Priority to JP2019541323A priority patent/JP6995127B2/ja
Priority to BR112019016595-9A priority patent/BR112019016595A2/pt
Priority to UAA201909161A priority patent/UA126574C2/uk
Priority to MX2019009485A priority patent/MX2019009485A/es
Priority to RU2019127870A priority patent/RU2771485C2/ru
Priority to EP18707205.3A priority patent/EP3580240A1/en
Priority to CN202310592021.6A priority patent/CN116715775A/zh
Priority to CN201880024550.3A priority patent/CN110494453B/zh
Application filed by F Hoffmann La Roche AG, Genentech Inc filed Critical F Hoffmann La Roche AG
Priority to AU2018217816A priority patent/AU2018217816A1/en
Priority to CR20190387A priority patent/CR20190387A/es
Priority to KR1020197026305A priority patent/KR102362006B1/ko
Priority to PE2019001580A priority patent/PE20191548A1/es
Publication of WO2018148585A1 publication Critical patent/WO2018148585A1/en
Priority to IL268249A priority patent/IL268249A/en
Priority to ZA2019/05023A priority patent/ZA201905023B/en
Anticipated expiration legal-status Critical
Priority to PH12019501872A priority patent/PH12019501872A1/en
Priority to CONC2019/0009787A priority patent/CO2019009787A2/es
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39591Stabilisation, fragmentation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/10Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/16Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
    • A61K47/18Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
    • A61K47/183Amino acids, e.g. glycine, EDTA or aspartame
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/02Nasal agents, e.g. decongestants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/14Antitussive agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/04Antipruritics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y304/00Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/21Serine endopeptidases (3.4.21)
    • C12Y304/21059Tryptase (3.4.21.59)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/22Heterocyclic compounds, e.g. ascorbic acid, tocopherol or pyrrolidones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51Complete heavy chain or Fd fragment, i.e. VH + CH1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/515Complete light chain, i.e. VL + CL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the invention relates to anti-tryptase antibodies, pharmaceutical compositions, and methods of using the same.
  • Human tryptase beta is a trypsin-like serine protease that is abundant in mast cells and, to a lesser extent, in basophils. Human tryptase beta (of which there are three subtypes, tryptase beta 1 , tryptase beta 2, and tryptase beta 3) produced by the TPSAB1 and TPSB2 loci is the predominant active tryptase produced by human mast cells. These two loci produce four tryptase isoforms; TPSAB1 produces tryptase alpha and tryptase beta 1 , while TPSB2 produces tryptase beta 2 and tryptase beta 3. Tryptase alpha, as well as other isoforms such as tryptase gamma, tryptase delta, and tryptase epsilon are largely inactive.
  • the proteolytically processed, active tryptase beta is stored in the secretory granules of mast cells as a tetramer in complex with heparin.
  • Mast cell degranulation which can be caused by IgE- dependent stimuli (e.g., allergens), or non-lgE-dependent stimuli (e.g., substance P or active tryptase), leads to release of tryptase beta along with other granule enzymes and histamine.
  • IgE- dependent stimuli e.g., allergens
  • non-lgE-dependent stimuli e.g., substance P or active tryptase
  • tryptase contributes to airway bronchoconstriction and hyperresponsiveness, and has also been suggested to play a role in fibrosis and extracellular matrix turnover, which are hallmarks of the airway remodeling process.
  • Tryptase has been suggested to be involved in various diseases and disorders, including asthma and other pulmonary, inflammatory, autoimmune, and fibrotic disorders, for which there remains a need for improved therapeutics, including therapeutic anti-tryptase antagonists, and methods of treatment.
  • There have been attempts to develop small molecule tryptase inhibitors see, e.g., Cairns, J.A., 2005, Pulmonary Pharmacology & Therapeutics 18:55-66); however, to our knowledge, no biologic tryptase antagonistic therapeutics, especially anti-tryptase antagonistic antibodies, have been reported. Summary of the Invention
  • the present invention relates to anti-tryptase antibodies and pharmaceutical compositions thereof, as well as methods of using the same.
  • the invention features an isolated antibody that binds to human tryptase beta 1 , or an antigen-binding fragment thereof, wherein the antibody comprises the following six hypervariable regions (HVRs): (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR- H3 comprising the amino acid sequence of RNYDDWYFDV (SEQ ID NO: 8); (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6).
  • HVRs hypervariable regions
  • the antibody is defined by the six HVRs comprising the amino acid sequence of SEQ ID NO: 7, 2, 8, 4, 5, and 6.
  • the antibody further comprises S43, P46, and W47 in the light chain variable (VL) domain framework region L2 (FR-L2) (Kabat numbering).
  • VL light chain variable domain framework region L2
  • the antibody comprises (a) a heavy chain variable (VH) domain comprising an amino sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 9; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% identity to the amino acid sequence of SEQ ID NO: 10; or (c) a VH domain as in (a) and a VL domain as in (b).
  • VH heavy chain variable
  • VL light chain variable domain
  • the antibody further comprises the following VH domain framework regions (FRs): (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 1 1); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 12); (c) an FR-H3 comprising the amino acid sequence of RFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 13); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 14).
  • FRs VH domain framework regions
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 9.
  • the antibody further comprises the following VL domain FRs: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 15); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKPWIY (SEQ ID NO: 16); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 17); and (d) an FR-L4 comprising the amino acid sequence of FGQGTKVEIK (SEQ ID NO: 18).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 10.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 76 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 77.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 78 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 79.
  • the invention features an isolated antibody that binds to human tryptase beta
  • the antibody comprises (a) a VH domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 9 and (b) a VL domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 10.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 9 and a VL domain comprising the amino acid sequence of SEQ ID NO: 10.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 76 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 77. In other embodiments, the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 78 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 79.
  • the invention features an isolated antibody comprising (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 76 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 77.
  • the invention features an isolated antibody comprising (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 78 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 79.
  • the invention features an isolated antibody that binds to human tryptase beta 1 , or an antigen-binding fragment thereof, wherein the antibody comprises the following six HVRs: (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RDNYDWYFDV (SEQ ID NO: 29); (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and
  • the antibody further comprises the following VH domain FRs: (a) an FR-H1 comprising the amino acid sequence of EVKLVESGGGSVQPGGSRKLSCAASGFTFS (SEQ ID NO: 21 ); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 22); (c) an FR-H3 comprising the amino acid sequence of RFTISRDNPKNTLFLQMSSLRSEDTAMYYCAR (SEQ ID NO: 23); and (d) an FR-H4 comprising the amino acid sequence of WGTGTTVTVSS (SEQ ID NO: 24).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 19.
  • the antibody further comprises the following VL domain FRs: (a) an FR-L1 comprising the amino acid sequence of QIVLTQSPAIMSASPGEKVTISC (SEQ ID NO: 25); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGSSPKPWIY (SEQ ID NO: 26); (c) an FR-L3 comprising the amino acid sequence of GVPARFSGSGSGTSYSLTISSMEAEDAATYYC (SEQ ID NO: 27); and (d) an FR-L4 comprising the amino acid sequence of FGAGTKLELK (SEQ ID NO: 28).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 20.
  • the invention features an isolated antibody that binds to human tryptase beta 1 , or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino sequence having at least 90%, at least 95% sequence, or at least 99% identity to the amino acid sequence of SEQ ID NO: 19; (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 20; or (c) a VH domain as in (a) and a VL domain as in (b).
  • the antibody further comprises the following VH domain FRs: (a) an FR-H1 comprising the amino acid sequence of
  • VH domain comprises the amino acid sequence of SEQ ID NO: 19.
  • the antibody further comprises the following VL domain FRs: (a) an FR-L1 comprising the amino acid sequence of
  • QIVLTQSPAIMSASPGEKVTISC (SEQ ID NO: 25); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGSSPKPWIY (SEQ ID NO: 26); (c) an FR-L3 comprising the amino acid sequence of
  • GVPARFSGSGSGTSYSLTISSMEAEDAATYYC (SEQ ID NO: 27); and (d) an FR-L4 comprising the amino acid sequence of FGAGTKLELK (SEQ ID NO: 28).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 20.
  • the invention features an isolated antibody that binds to human tryptase beta 1 , or an antigen-binding fragment thereof, comprising (a) a VH domain comprising an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 19 and (b) a VL domain comprising an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 20.
  • the antibody binds to an epitope on human tryptase beta 1 comprising at least one, at least two, at least three, or all four residues selected from the group consisting of His51 , Val80, Lys81 , and Asp82 of SEQ ID NO: 71 . In some embodiments, the antibody binds to an epitope on human tryptase beta 1 comprising at least one, at least two, at least three, or all four residues selected from the group consisting of His51 , Val80, Lys81 , and Asp82 of SEQ ID NO: 71 .
  • the antibody binds to an epitope on human tryptase beta 1 comprising His51 and at least one, at least two, or all three residues selected from the group consisting of Val80, Lys81 , and Asp82 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 further comprises one or more amino acid residues selected from the group consisting of Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or all twelve amino acid residues selected from the group consisting of Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 comprises His51 , Gln67, Val80, Lys81 , Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO:71 .
  • the epitope is relative to a human tryptase beta 1 monomer or tetramer.
  • the epitope is determined by an X-ray crystallography model.
  • the antibody is capable of dissociating both the small interface of tetrameric human tryptase beta 1 and the large interface of tetrameric human tryptase beta 1 .
  • the invention features an isolated antibody that binds to human tryptase beta 1 , or an antigen-binding fragment thereof, wherein the antibody comprises the following six HVRs: (a) an HVR-H1 comprising the amino acid sequence of GYAIT (SEQ ID NO: 30); (b) an HVR-H2 comprising the amino acid sequence of GISSAATTFYSSWAKS (SEQ ID NO: 31); (c) an HVR-H3 comprising the amino acid sequence of DPRGYGAALDRLDL (SEQ ID NO: 32); (d) an HVR-L1 comprising the amino acid sequence of QSIKSVYNNRLG (SEQ ID NO: 33); (e) an HVR-L2 comprising the amino acid sequence of ETSILTS (SEQ ID NO: 34); and (f) an HVR-L3 comprising the amino acid sequence of AGGFDRSGDTT (SEQ ID NO: 35).
  • the antibody is defined by the six HVRs comprising the amino acid sequence of SEQ ID NO: 30, 31 , 32, 33, 34, and 35. In some embodiments, the antibody further comprises Arg71 and Val78 in VH domain FR-H3 (Kabat numbering).
  • the antibody further comprises the following VH domain FRs: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGPGLVKPSETLSLTCTVSRFSLI (SEQ ID NO: 38); (b) an FR-H2 comprising the amino acid sequence of WIRQPPGKGLEWIG (SEQ ID NO: 42); (c) an FR-H3 comprising the amino acid sequence of RVTISRDTSKNQVSLKLSSVTAADTAVYYCAR (SEQ ID NO: 43); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 41).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 36.
  • the antibody comprises the following VL domain FRs: (a) an FR-L1 comprising the amino acid sequence of
  • DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 64); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKLLIY (SEQ ID NO: 65); (c) an FR-L3 comprising the amino acid sequence of
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 80 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 81 .
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 82 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 83.
  • the invention features an isolated antibody that binds to human tryptase beta
  • the antibody comprises (a) a VH domain comprising an amino sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 36, 47, 48, 49, 50, 51 , and 52; (b) a VL domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% identity to the amino acid sequence of any one of SEQ ID NO: 37, 53, 58, or 59; or (c) a VH domain as in (a) and a VL domain as in
  • the antibody further comprises the following VH domain FRs: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGPGLVKPSETLSLTCTVSRFSLI (SEQ ID NO: 38); (b) an FR-H2 comprising the amino acid sequence of WIRQPPGKGLEWIG (SEQ ID NO: 42); (c) an FR-H3 comprising the amino acid sequence of RVTISRDTSKNQVSLKLSSVTAADTAVYYCAR (SEQ ID NO: 43); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 41).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 36.
  • the antibody comprises the following VL domain FRs: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 64); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKLLIY (SEQ ID NO: 65); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 66); and (d) an FR-L4 comprising the amino acid sequence of FGQGTKVEIK (SEQ ID NO: 63).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 80 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 81 .
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 82 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 83.
  • the invention features an isolated antibody that binds to human tryptase, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 36 and (b) a VL domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 36 and a VL domain comprising the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 80 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 81 . In other embodiments, the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 82 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 83.
  • the invention features an isolated antibody comprising (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 80 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 81 .
  • the invention features an isolated antibody comprising (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 82 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 83.
  • the invention features an isolated antibody that binds to human tryptase, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 52 and (b) a VL domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 53.
  • the antibody binds to an epitope on human tryptase beta 1 comprising at least one, at least two, or all three residues selected from the group consisting of Gln100, Leu101 , and Leu102 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 further comprises one or more amino acid residues selected from the group consisting of Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu 126, Leu127, Glu128, and Glu129 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, at least thirteen, or all fourteen amino acid residues selected from the group consisting of Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, and Glu129 of SEQ ID NO: 71 .
  • Trp55 Trp55
  • Gln67 Asp82
  • Leu83 Ala84
  • Arg87 Pro103
  • Val104 Val104
  • Ser105, Arg106, Glu126, Leu127, Glu128, and Glu129 of SEQ ID NO: 71 amino acid residues
  • the epitope comprises Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101 , Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129, and Arg216 of SEQ ID NO: 71 .
  • the epitope is relative to a human tryptase beta 1 monomer or tetramer.
  • the epitope is relative to a human tryptase beta 1 tetramer, and the epitope on human tryptase beta 1 further comprises one or both of Gln35 and Arg216 of SEQ ID NO: 71 .
  • the epitope is determined by an X-ray crystallography model.
  • the antibody is capable of dissociating the small interface and/or the large interface of human tryptase beta 1 .
  • the antibody further binds cynomolgus monkey (cyno) tryptase. In some embodiments, the antibody further binds human tryptase alpha. In some embodiments, the antibody further binds human tryptase beta 2 or human tryptase beta 3. In some embodiments, the antibody binds human tryptase beta 2 and human tryptase beta 3.
  • the antibody binds the tryptase with a KD of about 1 nM or less. In some embodiments, the KD is measured by a surface plasmon resonance (SPR) assay. In some embodiments, the antibody binds the tryptase with a KD of between about 120 pM and about 0.5 nM. In some embodiments, the antibody binds the tryptase with a KD of between about 120 pM and about 300 pM. In some embodiments, the antibody binds the tryptase with a KD of between about 120 pM and about 200 pM.
  • SPR surface plasmon resonance
  • the antibody binds the tryptase with a KD of about 180 pM. In some embodiments, the antibody binds tryptase with a KD of about 400 pM. In some embodiments, the SPR assay is performed at 25°C. In some embodiments, the KD is measured using a BIACORE® SPR assay, for example, as described in Example 1 , Section (A)(vii). In some embodiments, the SPR assay can use a BIAcore® T200 or an equivalent device.
  • BIAcore® Series S CM5 sensor chips are immobilized with monoclonal mouse anti- human IgG (Fc) antibody and anti-tryptase antibodies are subsequently captured on the flow cell.
  • Serial 3-fold dilutions of the His-tagged human tryptase beta 1 monomer (SEQ ID NO: 128) are injected at a flow rate of 30 ⁇ /min. Each sample is analyzed with 3 min association and 10 min dissociation. The assay is performed at 25°C. After each injection, the chip is regenerated using 3 M MgC . Binding response is corrected by subtracting the response units (RU) from a flow cell capturing an irrelevant IgG at similar density.
  • a 1 :1 Languir model of simultaneous fitting of k and koff is used for kinetics analysis.
  • the antibody is capable of inhibiting the enzymatic activity of human tryptase beta 1 .
  • the antibody inhibits the activity of tryptase with an IC50 of about 2.5 nM or lower as determined by a human tryptase beta enzymatic assay using a synthetic peptide S-2288 as a substrate.
  • the antibody inhibits the activity of tryptase with an IC50 of between about 550 pM and about 2.5 nM.
  • the antibody inhibits the activity of tryptase with an IC50 of between about 500 pM and about 2 nM.
  • the antibody inhibits the activity of tryptase with an IC50 of between about 550 nM and 1 .5 nM. In some embodiments, the antibody inhibits the activity of tryptase with an IC50 of between about 500 pM and about 700 pM. In some embodiments, the inhibitory activity of the antibody is determined as described in Example 1 (A)(viii)(a)). In some embodiments, the final concentration of heparin in the human tryptase beta enzymatic assay using the synthetic peptide S-2288 is 66 ⁇ g/ml.
  • recombinant human tryptase beta 1 tetramer active enzyme is diluted to 0.75 nM in TNH Buffer (200 mM Tris, 150 mM NaCi, 0,1 mg/mL heparin, 0.01 % TRITONTM X-100, pH 8.0), and combined 1 :1 with anti-tryptase antibodies (diluted in PBS) in 384-well plates. Plates are incubated for 1 h at ambient temperature with gentle agitation. Colorimetric substrate S-2288 (Chromogenix, Part No.
  • the 82- 0852-39 is diluted to 1200 ⁇ in TNH Buffer and added to the plate, in some embodiments, the final in-well concentrations are 400 ⁇ S-2288, 0.25 nM recombinant human tryptase beta 1 tetramer, 66 pg/mL heparin, and from 0.10 to 222 n anti-tryptase antibody. Plates are incubated for 40 min at ambient temperature with gentle agitation and then read at A405. The IC50 of the anti-tryptase antibodies is determined from a four-parameter fit. of their respective curves.
  • the antibody is capable of inhibiting the enzymatic activity of human tryptase beta 1 at pH 6.
  • the inhibitory activity of the antibody may be determined at pH 6.
  • the antibody is capable inhibiting tryptase-mediated stimulation of bronchial smooth muscle cell proliferation and/or collagen-based contraction. In some embodiments, the antibody is capable of inhibiting mast cell histamine release. In some embodiments, the antibody is capable of inhibiting IgE-triggered histamine release and/or tryptase-triggered histamine release. In some embodiments, the antibody is capable of inhibiting cyno tryptase D1 as assessed by an active tryptase ELISA assay. In some embodiments, the antibody is capable of inhibiting tryptase activity in cynomolgus monkey broncheoloar lavage (BAL) or nasosorption samples.
  • BAL cynomolgus monkey broncheoloar lavage
  • the antibody is capable of dissociating tetrameric human tryptase beta 1 . In some embodiments, the antibody is capable of dissociating tetrameric human tryptase beta 1 when in a monovalent format. In some embodiments, the monovalent format is a Fab format. In some embodiments, the antibody is capable of dissociating tetrameric human tryptase beta 1 in the presence of heparin. In some embodiments, the antibody is capable of dissociating tetrameric tryptase beta in the presence of 66 pg/ml heparin.
  • the invention features an antibody that binds to the same epitope as any one of the preceding antibodies.
  • whether the antibody binds to the same epitope or competes for binding to human tryptase beta 1 is determined by an epitope binning assay.
  • the epitope binning assay is an OCTET® epitope binning assay such as described in Example 3, Section C.
  • human tryptase beta 1 monomer protein is biotinylated at Lys residue by reacting with NHS-PEG4-biotin.
  • Biotinylated monomer is diluted to 5 pg/ml in kinetics buffer (ForteBio, Inc.) and immobilized onto streptavidin sensor tips (ForteBio, Inc.). After the immobilization step, human tryptase beta 1 -immobilized sensors are saturated with the first antibody, diluted at 10-20 pg/ml, followed by binding with second antibody diluted at 2.5 pg/ml.
  • the epitope binning assay is performed at 30°C.
  • the invention features an antibody that competes for binding to human tryptase beta 1 with, or cross-blocks or is cross-blocked by any one of the preceding antibodies.
  • the antibody is monoclonal, human, humanized, or chimeric. In some embodiments, the antibody is humanized.
  • the antibody is an antibody fragment that binds tryptase.
  • the antibody fragment is selected from the group consisting of Fab, Fab'-SH, Fv, scFv, and (Fab')2 fragments.
  • the antibody is a full-length antibody.
  • the antibody is an IgG antibody.
  • the IgG antibody is an lgG1 antibody.
  • the IgG antibody is an lgG4 antibody.
  • the lgG4 antibody comprises a mutation in the hinge region.
  • the mutation is a substitution mutation.
  • the substitution mutation is at amino acid residue S228 (EU numbering).
  • the lgG4 antibody comprises an S228P mutation (EU numbering).
  • the antibody is a monospecific antibody.
  • the antibody is a multispecific antibody. In some embodiments, the antibody is a bispecific antibody. In some embodiments, the antibody comprises a first binding domain that binds to tryptase and a second binding domain that binds to a second biological molecule, wherein the second biological molecule is selected from the group consisting of interleukin-13 (IL-13), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-17 (IL-17), IgE, and interleukin-33 (IL-33). In some embodiments, the second biological molecule is IL-13. In some embodiments, the second biological molecule is IL-33. In some embodiments, the second biological molecule is IgE.
  • the invention features an isolated nucleic acid encoding any of the antibodies described herein or a set of isolated nucleic acids together encoding the antibody.
  • the invention features an isolated nucleic acid encoding an antibody comprising a VH domain comprising the amino acid sequence of SEQ ID NO: 9 and/or a VL domain comprising the amino acid sequence of SEQ ID NO: 10, or a set of isolated nucleic acids together encoding the antibody, wherein the nucleic acid comprises a sequence that is at least 85%, at least 90%, at least 95%, or at least 99% identical to the sequence of SEQ ID NO: 104 and/or SEQ ID NO: 105.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 76 and/or (b) a light chain comprising the amino acid sequence of SEQ ID NO: 77, and wherein the nucleic acid or set comprises a sequence that is at least 85%, at least 90%, at least 95%, or at least 99% identical to the sequence of SEQ ID NO: 106 and/or SEQ ID NO: 107.
  • the nucleic acid or set comprises a sequence that is at least 85%, at least 90%, at least 95%, or at least 99% identical to the sequence of SEQ ID NO: 106 and/or SEQ ID NO: 107.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 78 and/or (b) a light chain comprising the amino acid sequence of SEQ ID NO: 79, and wherein the nucleic acid or set comprises a sequence that is at least 85%, at least 90%, at least 95%, or at least 99% identical to the sequence of SEQ ID NO: 108 and/or SEQ ID NO: 107.
  • the nucleic acid or set comprises the sequence of SEQ ID NO: 108 and/or SEQ ID NO: 107.
  • the invention features an isolated nucleic acid encoding the antibody comprising a VH domain comprising the amino acid sequence of SEQ ID NO: 36 and/or a VL domain comprising the amino acid sequence of SEQ ID NO: 37, or a set of isolated nucleic acids together encoding the antibody, wherein the nucleic acid comprises a sequence that is at least 85%, at least 90%, at least 95%, or at least 99% identical to the sequence of SEQ ID NO: 109 and/or SEQ ID NO: 1 10.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 80 and/or (b) a light chain comprising the amino acid sequence of SEQ ID NO: 81 , and wherein the nucleic acid or set comprises a sequence that is at least 85%, at least 90%, at least 95%, or at least 99% identical to the sequence of SEQ ID NO: 1 11 and/or SEQ ID NO: 1 12.
  • the nucleic acid or set comprises a sequence that is at least 85%, at least 90%, at least 95%, or at least 99% identical to the sequence of SEQ ID NO: 1 11 and/or SEQ ID NO: 1 12.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 82 and/or (b) a light chain comprising the amino acid sequence of SEQ ID NO: 83, and wherein the nucleic acid or set comprises a sequence that is at least 85%, at least 90%, at least 95%, or at least 99% identical to the sequence of SEQ ID NO: 1 13 and/or SEQ ID NO: 1 12.
  • the nucleic acid or set comprises the sequence of SEQ ID NO: 1 13 and/or SEQ ID NO: 1 12.
  • the invention features a vector (e.g., an expression vector) or set of vectors comprising any of the isolated nucleic acids or set of isolated nucleic acids described herein.
  • the invention features host cells comprising the preceding nucleic acids and/or vectors and/or sets of nucleic acids and/or sets of vectors.
  • the host cell is a mammalian cell.
  • the mammalian cell is a Chinese hamster ovary (CHO) cell.
  • the host cell is a prokaryotic cell.
  • the prokaryotic cell is E. coli.
  • the invention features a method of producing any of the antibodies described herein, the method comprising culturing a host cell that comprises any of the preceding vectors (e.g., expression vectors) or set of vectors in a culture medium under suitable conditions that allow production of the antibody. In some embodiments, the method further comprises recovering the antibody from the host cell or the culture medium.
  • the preceding vectors e.g., expression vectors
  • the method further comprises recovering the antibody from the host cell or the culture medium.
  • the invention features composition (e.g., a pharmaceutical composition) comprising any one of the preceding antibodies.
  • the composition further comprises a pharmaceutically acceptable carrier, excipient, or diluent.
  • the invention features a pharmaceutical composition
  • a pharmaceutical composition comprising an isolated monoclonal antibody that binds to human tryptase beta 1 , or an antigen-binding fragment thereof, and a pharmaceutically acceptable carrier, excipient, or diluent, wherein the antibody binds to monomeric tryptase beta 1 with a KD of about 0.1 nM to about 1 nM, and/or wherein the antibody is capable of inhibiting the enzymatic activity of the tryptase with a half-maximal inhibitory concentration (IC50) of about 0.1 nM to about 5 nM as determined by an in vitro tryptase enzymatic assay using S-2288 as a substrate.
  • IC50 half-maximal inhibitory concentration
  • the antibody binds the tryptase with a KD between about 0.5 nM to about 1 nM. In some embodiments, the antibody binds the tryptase with a KD between about 0.1 nM to about 0.5 nM. In some embodiments, the antibody binds the tryptase with a KD of about 0.4 nM. In some embodiments, the antibody binds the tryptase with a KD of about 0.2 nM. In some embodiments, the KD is measured by a surface plasmon resonance (SPR) assay. In some embodiments, the SPR assay is performed at 25°C.
  • SPR surface plasmon resonance
  • the KD is measured using a BIACORE® SPR assay, for example, as described in Example 1 , Section (A)(vii).
  • the SPR assay can use a BIAcore® T200 or an equivalent device.
  • BIAcore® Series S CM5 sensor chips (or equivalent sensor chips) are immobilized with monoclonal mouse anti-human IgG (Fc) antibody and anti-tryptase antibodies are subsequently captured on the flow cell.
  • Serial 3-fold dilutions of the His-tagged human tryptase beta 1 monomer (SEQ ID NO: 128) are injected at a flow rate of 30 ⁇ /min. Each sample is analyzed with 3 min association and 10 min dissociation.
  • the assay is performed at 25°C. After each injection, the chip is regenerated using 3 M MgC . Binding response is corrected by subtracting the response units (RU) from a flow cell capturing an irrelevant IgG at similar density.
  • RU response units
  • the antibody is capable of inhibiting the activity of the tryptase with an IC50 of about 0.5 nM to about 5 nM. In some embodiments, the antibody is capable of inhibiting the activity of the tryptase with an IC50 of about 0.1 nM to about 2 nM. In some embodiments, the antibody is capable of inhibiting the activity of human tryptase with an IC50 of about 4 nM. In some embodiments, the antibody is capable of inhibiting the activity of the tryptase with an IC50 of about 0.6 nM.
  • the antibody is capable of inhibiting the tryptase activity at pH 6 in an in vitro tryptase enzymatic assay using S-2288 as a substrate.
  • the inhibitory activity of the antibody is determined as described in the Examples (e.g., Example 1 , Section (A)(viii)(a)).
  • recombinant human tryptase beta 1 tetramer active enzyme is diluted to 0.75 nM in TNH Buffer (200 mM Tris, 150 mM NaCI, 0.1 mg/mL heparin, 0.01 % TRITONTM X-100, pH 8.0), and combined 1 :1 with anti-trypiase antibodies (diluted in PBS) in 384-weii plates. Plates are incubated for 1 h at ambient temperature with gentle agitation. Colorimetric substrate S-2288 (Chromogenix, Part No.
  • the final in-well concentrations are 400 ⁇ S-2288, 0.25 nM recombinant human tryptase beta 1 tetramer, 66 g/mL heparin, and from 0.10 to 222 nM anti-tryptase antibody. Plates are incubated for 40 min at ambient temperature with gentle agitation and then read at A405. The IC50 of the anti-tryptase antibodies is determined from a four-parameter fit of their respective curves. In some embodiments, the final concentration of heparin in the human tryptase beta enzymatic assay using the synthetic peptide S-2288 is 66 pg/ml.
  • the antibody is capable inhibiting tryptase- mediated stimulation of bronchial smooth muscle cell proliferation and/or collagen-based contraction. In some embodiments, the antibody is capable of inhibiting mast cell histamine release. In some embodiments, the antibody is capable of inhibiting IgE-triggered histamine release and/or tryptase- triggered histamine release. In some embodiments, the antibody is capable of inhibiting tryptase activity in cynomolgus monkey broncheoloar lavage (BAL) or nasosorption samples. In some embodiments, the antibody is capable of dissociating tetrameric human tryptase beta 1 .
  • the antibody is capable of dissociating tetrameric human tryptase beta 1 when in a monovalent format.
  • the monovalent format is a Fab format.
  • the antibody is capable of dissociating tetrameric human tryptase beta 1 in the presence of heparin.
  • the antibody is capable of dissociating tetrameric tryptase beta in the presence of 66 pg/ml heparin.
  • the antibody comprises the following six hypervariable regions (HVRs): (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RNYDDWYFDV (SEQ ID NO: 8); (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6).
  • HVRs hypervariable regions
  • the antibody comprises (a) a heavy chain variable (VH) domain comprising an amino sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 9; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% identity to the amino acid sequence of SEQ ID NO: 10; or (c) a VH domain as in (a) and a VL domain as in (b).
  • VH heavy chain variable
  • VL light chain variable domain
  • the antibody further comprises the following VH domain FRs: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 1 1); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 12); (c) an FR- H3 comprising the amino acid sequence of RFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 13); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 14).
  • VH domain FRs (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 1 1); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 12); (c) an FR-
  • the VH domain of the antibody comprises the amino acid sequence of SEQ ID NO: 9.
  • the antibody further comprises the following VL domain FRs: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 15); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKPWIY (SEQ ID NO: 16); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 17); and (d) an FR-L4 comprising the amino acid sequence of FGQGTKVEIK (SEQ ID NO: 18).
  • the VL domain of the antibody comprises the amino acid sequence of SEQ ID NO: 10.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 76 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 77.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 78 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 79.
  • the antibody binds to an epitope on human tryptase beta 1 comprising at least one, at least two, at least three, or all four residues selected from the group consisting of His51 , Val80, Lys81 , and Asp82 of SEQ ID NO: 71 . In some embodiments, the antibody binds to an epitope on human tryptase beta 1 comprising His51 and at least one, at least two, or all three residues selected from the group consisting of Val 80, Lys81 , and Asp82 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 further comprises one or more amino acid residues selected from the group consisting of Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or all twelve amino acid residues selected from the group consisting of Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 comprises His51 , Gln67, Val80, Lys81 , Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO:71 .
  • the epitope is relative to a human tryptase beta 1 monomer or tetramer.
  • the epitope is determined by an X-ray crystallography model.
  • the antibody is capable of dissociating both the small interface of tetrameric human tryptase beta 1 and the large interface of tetrameric human tryptase beta 1 .
  • the antibody comprises the following six HVRs: (a) an HVR-H1 comprising the amino acid sequence of GYAIT (SEQ ID NO: 30); (b) an HVR-H2 comprising the amino acid sequence of GISSAATTFYSSWAKS (SEQ ID NO: 31); (c) an HVR-H3 comprising the amino acid sequence of DPRGYGAALDRLDL (SEQ ID NO: 32); (d) an HVR-L1 comprising the amino acid sequence of QSIKSVYNNRLG (SEQ ID NO: 33); (e) an HVR-L2 comprising the amino acid sequence of ETSILTS (SEQ ID NO: 34); and (f) an HVR-L3 comprising the amino acid sequence of AGGFDRSGDTT (SEQ ID NO: 35).
  • the antibody comprises (a) a VH domain comprising an amino sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 36, 47, 48, 49, 50, 51 , and 52; (b) a VL domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% identity to the amino acid sequence of any one of SEQ ID NO: 37, 53, 58, or 59; or (c) a VH domain as in (a) and a VL domain as in (b).
  • the antibody further comprises the following VH domain FRs: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGPGLVKPSETLSLTCTVSRFSLI (SEQ ID NO: 38); (b) an FR-H2 comprising the amino acid sequence of WIRQPPGKGLEWIG (SEQ ID NO: 42); (c) an FR-H3 comprising the amino acid sequence of RVTISRDTSKNQVSLKLSSVTAADTAVYYCAR (SEQ ID NO: 43); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 41).
  • the VH domain of the antibody comprises the amino acid sequence of SEQ ID NO: 36.
  • the antibody further comprises the following VL domain FRs: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 64); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKLLIY (SEQ ID NO: 65); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 66); and (d) an FR-L4 comprising the amino acid sequence of FGQGTKVEIK (SEQ ID NO: 63).
  • the VL domain of the antibody comprises the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 80 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 81 .
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 82 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 83.
  • the antibody binds to an epitope on human tryptase beta 1 comprising at least one, at least two, or all three residues selected from the group consisting of Gln100, Leu101 , and Leu102 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 further comprises one or more amino acid residues selected from the group consisting of Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, and Glu129 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, at least thirteen, or all fourteen amino acid residues selected from the group consisting of Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, and Glu129 of SEQ ID NO: 71 .
  • the epitope comprises Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101 , Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129, and Arg216 of SEQ ID NO: 71 .
  • the epitope is relative to a human tryptase beta 1 monomer or tetramer.
  • the epitope is relative to a human tryptase beta 1 tetramer, and the epitope on human tryptase beta 1 further comprises one or both of Gln35 and Arg216 of SEQ ID NO: 71 .
  • the epitope is determined by an X-ray crystallography model.
  • the antibody is capable of dissociating the small interface and/or the large interface of human tryptase beta 1 .
  • the invention features a composition (e.g., a pharmaceutical composition) comprising an isolated monoclonal antibody that binds to human tryptase beta 1 , or an antigen-binding fragment thereof, and a pharmaceutically acceptable carrier, excipient, or diluent, wherein the antibody binds to an epitope on human tryptase beta 1 comprising at least one, at least two, at least three, or all four residues selected from the group consisting of His51 , Val80, Lys81 , and Asp82 of SEQ ID NO: 71 .
  • a composition e.g., a pharmaceutical composition
  • the antibody binds to an epitope on human tryptase beta 1 comprising His51 and at least one, at least two, or all three residues selected from the group consisting of Val80, Lys81 , and Asp82 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 further comprises one or more amino acid residues selected from the group consisting of Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or all twelve amino acid residues selected from the group consisting of Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 comprises His51 , Gln67, Val80, Lys81 , Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO:71 .
  • the epitope is relative to a human tryptase beta 1 monomer or tetramer.
  • the epitope is determined by an X-ray crystallography model.
  • the antibody is capable of dissociating both the small interface of tetrameric human tryptase beta 1 and the large interface of tetrameric human tryptase beta 1 .
  • the antibody comprises the following six hypervariable regions (HVRs): (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RNYDDWYFDV (SEQ ID NO: 8); (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6
  • the antibody comprises (a) a heavy chain variable (VH) domain comprising an amino sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of SEQ ID NO: 9; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% identity to the amino acid sequence of SEQ ID NO: 10; or (c) a VH domain as in (a) and a VL domain as in (b).
  • the antibody further comprises the following VH domain FRs: (a) an FR-H1 comprising the amino acid sequence of
  • the VH domain of the antibody comprises the amino acid sequence of SEQ ID NO: 9.
  • the antibody further comprises the following VL domain FRs: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 15); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKPWIY (SEQ ID NO: 16); (c) an FR-L3 comprising the amino acid sequence of
  • the VL domain of the antibody comprises the amino acid sequence of SEQ ID NO: 10.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 76 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 77.
  • the antibody comprises
  • the invention features a composition (e.g., a pharmaceutical composition) comprising an isolated monoclonal antibody that binds to human tryptase beta 1 , or an antigen-binding fragment thereof, and a pharmaceutically acceptable carrier, excipient, or diluent, wherein the antibody binds to an epitope on human tryptase beta 1 comprising at least one, at least two, or all three residues selected from the group consisting of GInl OO, Leu101 , and Leu102 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 further comprises one or more amino acid residues selected from the group consisting of Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104,
  • the epitope on human tryptase beta 1 comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, at least thirteen, or all fourteen amino acid residues selected from the group consisting of Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, and Glu129 of SEQ ID NO: 71 .
  • the epitope comprises Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, GInl OO, Leu101 , Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129, and Arg216 of SEQ ID NO: 71 .
  • the epitope is relative to a human tryptase beta 1 monomer or tetramer.
  • the epitope is relative to a human tryptase beta 1 tetramer, and the epitope on human tryptase beta 1 further comprises one or both of Gln35 and Arg216 of SEQ ID NO: 71 .
  • the epitope is determined by an X-ray crystallography model.
  • the antibody is capable of dissociating the small interface and/or the large interface of human tryptase beta 1 .
  • the antibody comprises the following six HVRs: (a) an HVR-H1 comprising the amino acid sequence of GYAIT (SEQ ID NO: 30); (b) an HVR-H2 comprising the amino acid sequence of GISSAATTFYSSWAKS (SEQ ID NO: 31); (c) an HVR-H3 comprising the amino acid sequence of DPRGYGAALDRLDL (SEQ ID NO: 32); (d) an HVR-L1 comprising the amino acid sequence of QSIKSVYNNRLG (SEQ ID NO: 33); (e) an HVR-L2 comprising the amino acid sequence of ETSILTS (SEQ ID NO: 34); and (f) an HVR-L3 comprising the amino acid sequence of AGGFDRSGDTT (SEQ ID NO: 35).
  • the antibody comprises (a) a VH domain comprising an amino sequence having at least 90%, at least 95%, or at least 99% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 36, 47, 48, 49, 50, 51 , and 52; (b) a VL domain comprising an amino acid sequence having at least 90%, at least 95%, or at least 99% identity to the amino acid sequence of any one of SEQ ID NO: 37, 53, 58, or 59; or (c) a VH domain as in (a) and a VL domain as in
  • the antibody further comprises the following VH domain FRs: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGPGLVKPSETLSLTCTVSRFSLI (SEQ ID NO: 38); (b) an FR-H2 comprising the amino acid sequence of WIRQPPGKGLEWIG (SEQ ID NO: 42); (c) an FR-H3 comprising the amino acid sequence of RVTISRDTSKNQVSLKLSSVTAADTAVYYCAR (SEQ ID NO: 43); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 41).
  • the VH domain of the antibody comprises the amino acid sequence of SEQ ID NO: 36.
  • the antibody further comprises the following VL domain FRs: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 64); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKLLIY (SEQ ID NO: 65); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 66); and (d) an FR-L4 comprising the amino acid sequence of FGQGTKVEIK (SEQ ID NO: 63).
  • the VL domain of the antibody comprises the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 80 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 81 .
  • the antibody comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 82 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 83.
  • the antibody is capable of further binding to human tryptase alpha, tryptase beta 2, tryptase beta 3 and/or cyno tryptase D1 .
  • the antibody may be monoclonal, human, humanized, or chimeric. In some embodiments, the antibody is humanized.
  • compositions may be for use in a human.
  • any of the preceding compositions may be lyophilized. In other embodiments, any of the preceding compositions (e.g., pharmaceutical compositions) may be a liquid.
  • the excipient may be an antioxidant.
  • the composition comprises one or more antioxidants selected from the group consisting of N-acetyltryptophan, tryptophan, methionine, cysteine, glutathione, thiosorbitol, ascorbic acid, monothioglycerol, cyclodextrins, Trolox (6-hydroxy-2, 5,7,8- tetramethylchroman-2-carboxylic acid), pyridoxine, mannitol, and a metal chelator.
  • the composition comprises N-acetyltryptophan or methionine. In some embodiments, the composition comprises N-acetyltryptophan and methionine.
  • the invention features a composition (e.g., a pharmaceutical composition) comprising: (i) an isolated antibody that binds to human tryptase beta 1 , or an antigen-binding fragment thereof, wherein the antibody comprises the following six hypervariable regions (HVRs): (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RNYDDWYFDV (SEQ ID NO: 8); (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6
  • the oxidation of tryptophan at position 6 of HVR-H3 is no more than 28%, 25%, 20%, 15%, 10%, or 6%. In some embodiments, the oxidation of tryptophan at position 6 of HVR-H3 (SEQ ID NO: 8) is determined following an AAPH stress test. In some embodiments, the oxidation of tryptophan at position 6 of HVR-H3 (SEQ ID NO: 8) is determined within one year from the initial production of the composition. Any of the preceding compositions (e.g., pharmaceutical compositions) may comprise N- acetyltryptophan at a concentration of about 0.1 mM to about 5 mM.
  • the concentration of N-acetyltryptophan is about 0.1 mM to about 1 mM. In some embodiments, the concentration of N-acetyltryptophan is about 0.3 mM. In some embodiments, the composition comprises methionine at a concentration of about 1 mM to about 20 mM. In some embodiments, the concentration of methionine is about 1 mM to about 10 mM. In some embodiments, the concentration of methionine is about 5 mM.
  • the invention features a composition (e.g., a pharmaceutical composition) comprising: (i) an isolated antibody that binds to human tryptase, or an antigen-binding fragment thereof, wherein the antibody comprises the following six hypervariable regions (HVRs): (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RNYDDWYFDV (SEQ ID NO: 8); (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and
  • HVRs hypervariable regions
  • an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6); (ii) N- acetyltryptophan at a concentration of about 0.1 mm to about 1 mM; and (iii) methionine at a
  • the antibody concentration may be about 1 mg/ml to about 250 mg/ml. In some embodiments, the antibody concentration is about 150 mg/ml.
  • compositions may further include one or more additional excipients selected from the group consisting of a stabilizer, a buffer, a surfactant, and a tonicity agent.
  • the composition further comprises a buffer.
  • the buffer is arginine succinate and/or histidine succinate.
  • the buffer comprises arginine succinate and histidine succinate.
  • the concentration of arginine succinate is about 50 mM to about 500 mM.
  • concentration of arginine succinate is about 100 mM to about 300 mM.
  • concentration of arginine succinate is about 200 mM.
  • the concentration of histidine succinate is about 1 mM to about 50 mM. In some embodiments, the concentration of histidine succinate is about 15 mM to about 25 mM. In some embodiments, the concentration of histidine succinate is about 20 mM.
  • the composition further comprises a surfactant. In some embodiments, the surfactant is poloxamer 188 or polysorbate 20. In some embodiments, the surfactant is poloxamer 188. In some embodiments, the concentration of poloxamer 188 is about 0.005% to about 0.1 %. In some embodiments, the concentration of poloxamer 188 is about 0.005% to about 0.05%.
  • the concentration of poloxamer 188 is about 0.02%.
  • the pH of the composition is about 4.5 to about 7.0. In some embodiments, the pH of the composition is about 4.5 to about 6.5. In some embodiments, the pH of the composition is about 5.5. In some embodiments, the composition is in a light-proof container. In some embodiments, the composition is in a pre-filled syringe.
  • compositions may further include an IL- 13 axis binding antagonist, an IL-5 axis binding antagonist, an IL-33 axis binding antagonist, an M1 prime antagonist, an IgE antagonist, a TRPA1 antagonist, a CRTH2 antagonist, a broncodilator or asthma symptom controller medication, an immunomodulator, a corticosteroid, a Th2 pathway inhibitor, a tyrosine kinase inhibitor, or a phosphodiesterase inhibitor.
  • the IL-13 axis binding antagonist is an anti-IL-13 antibody.
  • the anti-IL-13 antibody is lebrikizumab.
  • the IL-5 axis binding antagonist is an IL-5 binding antagonist or an IL-5 receptor binding antagonist.
  • the IL-33 axis binding antagonist is an IL-33 binding antagonist or an ST2 binding antagonist.
  • the IL-33 binding antagonist is an anti- IL-33 antibody.
  • the M1 prime antagonist is quilizumab.
  • the IgE antagonist is omalizumab (XOLAIR®).
  • compositions may be formulated for administration to a human.
  • the pharmaceutical compositions comprise antibodies that do not comprise non-human constant region sequences.
  • the pharmaceutical compositions comprise antibodies that do not comprise non-human framework and non- human constant region sequences.
  • the pharmaceutical compositions comprise antibodies that are human antibodies, humanized antibodies, or chimeric antibodies.
  • any one of the preceding antibodies can be used as a medicament.
  • any of the preceding antibodies can be used in treating a disorder.
  • the disorder is selected from the group consisting of a pulmonary disorder, an autoimmune disorder, an inflammatory disorder, a fibrotic disorder, a granulocytic (neutrophilic or eosinophilic) disorder, a monocytic disorder, a lymphocytic disorder, or a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • the disorder is a pulmonary disorder.
  • the pulmonary disorder is selected from the group consisting of asthma, airway hyperresponsiveness, and chronic obstructive pulmonary disease (COPD).
  • COPD chronic obstructive pulmonary disease
  • the pulmonary disorder is asthma.
  • the asthma is Th2-high asthma or Th2-low asthma.
  • the autoimmune disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, eosinophilic esophagitis, inflammatory bowel disease (IBD), and Crohn's disease.
  • the inflammatory disorder is chronic idiopathic urticaria (CIU, also known as chronic spontaneous urticaria, CSU), anaphylaxis, anaphylactic shock, atopic dermatitis, or allergic rhinitis.
  • CSU chronic idiopathic urticaria
  • the fibrotic disorder is idiopathic pulmonary fibrosis (IPF).
  • the disorder is a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • the disorder is mastocytosis.
  • the antibody is for use in combination with an additional therapeutic agent.
  • the additional therapeutic agent is an IL-13 axis binding antagonist, an IL-5 axis binding antagonist, an IL-33 axis binding antagonist, an M1 prime antagonist, an IgE antagonist, a TRPA1 antagonist, a CRTH2 antagonist, a broncodilator or asthma symptom controller medication, an immunomodulator, a corticosteroid, a Th2 pathway inhibitor, a tyrosine kinase inhibitor, or a phosphodiesterase inhibitor.
  • the IL-13 axis binding antagonist is an anti-IL-13 antibody.
  • the anti-IL-13 antibody is lebrikizumab.
  • the IL-5 axis binding antagonist is an IL-5 binding antagonist or an IL-5 receptor binding antagonist.
  • the IL-33 axis binding antagonist is an IL-33 binding antagonist or an ST2 binding antagonist.
  • the IL-33 binding antagonist is an anti-IL-33 antibody.
  • the M1 prime antagonist is quilizumab.
  • the antibody is for administration subcutaneously, intravenously, intramuscularly, topically, orally, transdermal ⁇ , intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
  • the antibody is for administration subcutaneously.
  • the antibody is for use in a human subject.
  • any one of the preceding compositions can be used as a medicament.
  • any of the preceding compositions can be used in treating a disorder.
  • the disorder is selected from the group consisting of a pulmonary disorder, an autoimmune disorder, an inflammatory disorder, a fibrotic disorder, a granulocytic (neutrophilic or eosinophilic) disorder, a monocytic disorder, a lymphocytic disorder, or a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • the disorder is a pulmonary disorder.
  • the pulmonary disorder is selected from the group consisting of asthma, airway hyperresponsiveness, and chronic obstructive pulmonary disease (COPD).
  • the pulmonary disorder is asthma.
  • the asthma is Th2-high asthma or Th2-low asthma.
  • the autoimmune disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, eosinophilic esophagitis, inflammatory bowel disease (IBD), and Crohn's disease.
  • the inflammatory disorder is chronic idiopathic urticaria (CIU or CSU), anaphylaxis, anaphylactic shock, atopic dermatitis, or allergic rhinitis.
  • the fibrotic disorder is idiopathic pulmonary fibrosis (IPF).
  • the disorder is a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • the disorder is mastocytosis.
  • the composition e.g., pharmaceutical composition
  • the additional therapeutic agent is an IL-13 axis binding antagonist, an IL-5 axis binding antagonist, an IL-33 axis binding antagonist, an M1 prime antagonist, an IgE antagonist, a TRPA1 antagonist, a CRTH2 antagonist, a broncodilator or asthma symptom controller medication, an immunomodulator, a corticosteroid, a Th2 pathway inhibitor, a tyrosine kinase inhibitor, or a phosphodiesterase inhibitor.
  • the IL-13 axis binding antagonist is an anti-IL-13 antibody.
  • the anti-IL-13 antibody is lebrikizumab.
  • the IL-5 axis binding antagonist is an IL-5 binding antagonist or an IL-5 receptor binding antagonist.
  • the IL-33 axis binding antagonist is an IL-33 binding antagonist or an ST2 binding antagonist.
  • the IL-33 binding antagonist is an anti- IL-33 antibody.
  • the M1 prime antagonist is quilizumab.
  • the composition e.g., pharmaceutical composition
  • the composition e.g., pharmaceutical composition
  • the composition is for administration subcutaneously.
  • the composition is for use in a human subject.
  • any one of the preceding antibodies can be used in the manufacture of a medicament for treating a disorder.
  • the disorder is selected from the group consisting of a pulmonary disorder, an autoimmune disorder, an inflammatory disorder, a fibrotic disorder, a granulocytic (neutrophilic or eosinophilic) disorder, a monocytic disorder, a lymphocytic disorder, or a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • the disorder is a pulmonary disorder.
  • the pulmonary disorder is selected from the group consisting of asthma, airway hyperresponsiveness, and chronic obstructive pulmonary disease (COPD).
  • COPD chronic obstructive pulmonary disease
  • the pulmonary disorder is asthma.
  • the asthma is Th2-high asthma or Th2-low asthma.
  • the autoimmune disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, eosinophilic esophagitis, inflammatory bowel disease (IBD), and Crohn's disease.
  • the inflammatory disorder is chronic idiopathic urticaria (CIU or CSU), anaphylaxis, anaphylactic shock, atopic dermatitis, or allergic rhinitis.
  • CUA or CSU chronic idiopathic urticaria
  • anaphylaxis anaphylactic shock
  • atopic dermatitis or allergic rhinitis.
  • the fibrotic disorder is idiopathic pulmonary fibrosis (IPF).
  • the disorder is a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • the disorder is mastocytosis.
  • the medicament is formulated for use in combination with an additional therapeutic agent.
  • the additional therapeutic agent is an IL-13 axis binding antagonist, an IL-5 axis binding antagonist, an IL-33 axis binding antagonist, an M1 prime antagonist, an IgE antagonist, a TRPA1 antagonist, a CRTH2 antagonist, a broncodilator or asthma symptom controller medication, an immunomodulator, a corticosteroid, a Th2 pathway inhibitor, a tyrosine kinase inhibitor, or a phosphodiesterase inhibitor.
  • the IL-13 axis binding antagonist is an anti-IL-13 antibody.
  • the anti-IL-13 antibody is lebrikizumab.
  • the IL-5 axis binding antagonist is an IL-5 binding antagonist or an IL-5 receptor binding antagonist.
  • the IL-33 axis binding antagonist is an IL-33 binding antagonist or an ST2 binding antagonist.
  • the IL-33 binding antagonist is an anti- IL-33 antibody.
  • the M1 prime antagonist is quilizumab.
  • the medicament is formulated for administration subcutaneously, intravenously, intramuscularly, topically, orally, transdermal ⁇ , intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally. In some embodiments, the medicament is formulated for administration subcutaneously.
  • the medicament is formulated for use in a human subject.
  • any one of the preceding compositions can be used in the manufacture of a medicament for treating a disorder.
  • the disorder is selected from the group consisting of a pulmonary disorder, an autoimmune disorder, an inflammatory disorder, a fibrotic disorder, a granulocytic (neutrophilic or eosinophilic) disorder, a monocytic disorder, a lymphocytic disorder, or a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • tissue resident cells such as mast cells, macrophages, or lymphocytes
  • stromal cells such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia.
  • the disorder is a pulmonary disorder.
  • the pulmonary disorder is selected from the group consisting of asthma, airway hyperresponsiveness, and chronic obstructive pulmonary disease (COPD).
  • COPD chronic obstructive pulmonary disease
  • the pulmonary disorder is asthma.
  • the asthma is Th2-high asthma or Th2-low asthma.
  • the autoimmune disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, eosinophilic esophagitis, inflammatory bowel disease (IBD), and Crohn's disease.
  • the inflammatory disorder is chronic idiopathic urticaria (CIU or CSU), anaphylaxis, anaphylactic shock, atopic dermatitis, or allergic rhinitis.
  • the fibrotic disorder is idiopathic pulmonary fibrosis (IPF).
  • the disorder is a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • the disorder is mastocytosis.
  • the medicament is formulated for use in combination with an additional therapeutic agent.
  • the additional therapeutic agent is an IL-13 axis binding antagonist, an IL-5 axis binding antagonist, an IL-33 axis binding antagonist, an M1 prime antagonist, an IgE antagonist, a TRPA1 antagonist, a CRTH2 antagonist, a broncodilator or asthma symptom controller medication, an immunomodulator, a corticosteroid, a Th2 pathway inhibitor, a tyrosine kinase inhibitor, or a phosphodiesterase inhibitor.
  • the IL-13 axis binding antagonist is an anti-IL-13 antibody.
  • the anti-IL-13 antibody is lebrikizumab.
  • the IL-5 axis binding antagonist is an IL-5 binding antagonist or an IL-5 receptor binding antagonist.
  • the IL-33 axis binding antagonist is an IL-33 binding antagonist or an ST2 binding antagonist.
  • the IL-33 binding antagonist is an anti- IL-33 antibody.
  • the M1 prime antagonist is quilizumab.
  • the medicament is formulated for administration subcutaneously, intravenously, intramuscularly, topically, orally, transdermal ⁇ , intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
  • the medicament is formulated for administration subcutaneously.
  • the medicament is formulated for use in a human subject.
  • the invention features a method of treating a disorder in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of any one of the preceding antibodies.
  • the disorder is selected from the group consisting of a pulmonary disorder, an autoimmune disorder, an inflammatory disorder, a fibrotic disorder, a granulocytic (neutrophilic or eosinophilic) disorder, a monocytic disorder, a lymphocytic disorder, or a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • the disorder is a pulmonary disorder.
  • the pulmonary disorder is selected from the group consisting of asthma, airway hyperresponsiveness, and chronic obstructive pulmonary disease (COPD).
  • COPD chronic obstructive pulmonary disease
  • the pulmonary disorder is asthma.
  • the asthma is Th2-high asthma or Th2-low asthma.
  • the autoimmune disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, eosinophilic esophagitis, inflammatory bowel disease (IBD), and Crohn's disease.
  • the inflammatory disorder is chronic idiopathic urticaria (CIU or CSU), anaphylaxis, anaphylactic shock, atopic dermatitis, or allergic rhinitis.
  • the fibrotic disorder is idiopathic pulmonary fibrosis (IPF).
  • the disorder is a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • tissue resident cells such as mast cells, macrophages, or lymphocytes
  • stromal cells such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia.
  • the disorder is mastocytosis.
  • the method further comprises administering an additional therapeutic agent to the subject.
  • the additional therapeutic agent is an IL-13 axis binding antagonist, an IL-5 axis binding antagonist, an IL-33 axis binding antagonist, an M1 prime antagonist, an IgE antagonist, a TRPA1 antagonist, a CRTH2 antagonist, a broncodilator or asthma symptom controller medication, an immunomodulator, a corticosteroid, a Th2 pathway inhibitor, a tyrosine kinase inhibitor, or a phosphodiesterase inhibitor.
  • the IL-13 axis binding antagonist is an anti-IL-13 antibody.
  • the anti-IL-13 antibody is lebrikizumab.
  • the IL-5 axis binding antagonist is an IL-5 binding antagonist or an IL-5 receptor binding antagonist.
  • the IL-33 axis binding antagonist is an IL-33 binding antagonist or an ST2 binding antagonist.
  • the IL-33 binding antagonist is an anti- IL-33 antibody.
  • the M1 prime antagonist is quilizumab.
  • the IgE antagonist is omalizumab (Xolair®).
  • the antibody is administered subcutaneously, intravenously, intramuscularly, topically, orally, transdermal ⁇ , intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
  • the subject is a human.
  • the invention features a method of treating a disorder in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of any one of the preceding compositions (e.g., pharmaceutical compositions).
  • the disorder is selected from the group consisting of a pulmonary disorder, an autoimmune disorder, an inflammatory disorder, a fibrotic disorder, a granulocytic (neutrophilic or eosinophilic) disorder, a monocytic disorder, a lymphocytic disorder, or a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • tissue resident cells such as mast cells, macrophages, or lymphocytes
  • stromal cells such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia.
  • the disorder is a pulmonary disorder.
  • the pulmonary disorder is selected from the group consisting of asthma, airway hyperresponsiveness, and chronic obstructive pulmonary disease (COPD).
  • COPD chronic obstructive pulmonary disease
  • the pulmonary disorder is asthma.
  • the asthma is Th2-high asthma or Th2-low asthma.
  • the autoimmune disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, eosinophilic esophagitis, inflammatory bowel disease (IBD), and Crohn's disease.
  • the inflammatory disorder is chronic idiopathic urticaria (CIU or CSU), anaphylaxis, anaphylactic shock, atopic dermatitis, or allergic rhinitis.
  • the fibrotic disorder is idiopathic pulmonary fibrosis (IPF).
  • the disorder is a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • the disorder is mastocytosis.
  • the method further comprises administering an additional therapeutic agent to the subject.
  • the additional therapeutic agent is an IL-13 axis binding antagonist, an IL-5 axis binding antagonist, an IL-33 axis binding antagonist, an M1 prime antagonist, an IgE antagonist, a TRPA1 antagonist, a CRTH2 antagonist, a broncodilator or asthma symptom controller medication, an immunomodulator, a corticosteroid, a Th2 pathway inhibitor, a tyrosine kinase inhibitor, or a phosphodiesterase inhibitor.
  • the IL-13 axis binding antagonist is an anti-IL-13 antibody.
  • the anti-IL-13 antibody is lebrikizumab.
  • the IL-5 axis binding antagonist is an IL-5 binding antagonist or an IL-5 receptor binding antagonist.
  • the IL-33 axis binding antagonist is an IL-33 binding antagonist or an ST2 binding antagonist.
  • the IL-33 binding antagonist is an anti- IL-33 antibody.
  • the M1 prime antagonist is omalizumab (Xolair®).
  • the composition is administered subcutaneously, intravenously, intramuscularly, topically, orally, transdermal ⁇ , intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
  • the subject is a human.
  • FIG. 1 is a sequence alignment of the VH and VL domains of hu31A.v1 1 and huE104.v2 showing the complementarity determining regions (CDRs) according to the Kabat, Chothia and Contact designations.
  • CDRs complementarity determining regions
  • HVRs hypervariable regions
  • FSG. 2A is a series of graphs showing the results of an inhibition analysis of hu31 A.vl 1 and huE104.v2 IgG as determined by a human tryptase enzymatic assay. Both antibodies completely inhibited tryptase enzymatic activity.
  • FIGS. 2B and 2C are graphs showing the results of human primary airway smooth muscle cell (SMC) proliferation (Fig. 2B) and contraction (Fig. 2C) assays.
  • SMC smooth muscle cell
  • Fig. 2B Addition of tryptase beta stimulated human primary airway SMC proliferation, which was inhibited in a dose-dependent manner by addition of the anti-tryptase antibody hu31 A.v1 1 lgG4 or huE104.v2 lgG4
  • Fig. 2B Addition of tryptase also stimulated human primary airway SMC contraction, which was also inhibited by addition of hu31 A.v1 1 igG4 and huE104.v2 lgG4 (Fig. 2C).
  • FIGS. 2D and 2E are graphs showing the results of mast cell degranulation assays in which mast ceils were stimulated in vitro by addition of tryptase beta or anti-4-hydroxy-3-nitrophenylacetyl (NP) IgE and NP.
  • Addition of tryptase resulted in histamine release, which was blocked by addition of hu31 A.v1 1 (Fig. 2D).
  • a catalytically-inactive mutant tryptase (S195A) served as a control.
  • Addition of IgE and NP also resulted in histamine release, which was inhibited (30-50%) by addition of a trypiase small molecule inhibitor (SMI) or hu31 A.v1 1 (Fig.
  • SMI trypiase small molecule inhibitor
  • FIG. 3A is a graph showing the results of dissociation of human tryptase beta 1 tetramer by hu31 A.v1 1 Fab analyzed by size exclusion chromatography (SEC).
  • SEC size exclusion chromatography
  • FIG. 3B is a graph showing the results of dissociation of human tryptase beta 1 tetramer by huE104.v2 Fab.
  • Three runs were analyzed by SEC: run 1 contained His-tagged monomeric tryptase + Fab huE104. v2, which resulted in peak 2 (Tr 25.8 min) and peak 6 (31 .6 min); run 2 contained WT tetrameric tryptase + Fab huE104.
  • FIGS. 4A and 4B are series of graphs showing the results of a pharmacokinetic (PK) simulation that compares the PK and neutralizing activity of a dissociating anti-tryptase antibody with a tryptase tetramer-specific stabilizing antibody at a baseline tryptase level (4 ng/ml serum, 10 ng/ml lung tissue, Fig. 4A) or a high tryptase level (10 ng/ml serum, 40 ng/ml lung tissue, Fig. 4B).
  • PK pharmacokinetic
  • FIG. 4C is a series of graphs showing the results of neutralizing activity simulation comparing a dissociating anti-tryptase antibody and a tryptase tetramer-specific stabilizing antibody at the baseline tryptase level or a high tryptase level.
  • FIGS. 5A and SB show images of Coomassie blue-stained sodium dodecyi sulfate- polyacrylamide gel electrophoresis (SDS-PAGE) gels (top panels), showing that human tryptase beta 1 cleaved fibrinogen into peptide fragments at both pH 6 (Fig. 5A) and 7.5 (Fig. 5B).
  • the anti-tryptase antibody hu31A.v1 1 Fab blocked fibrinogen cleavage at both pH 6 and pH 7.5, while huE1 Q2.v2 Fab did not, under the experimental conditions of high concentration of heparin.
  • Lane 1 fibrinogen only, showing the alpha, beta, and gamma chains of uncieaved fibrinogen; lane 2, fibrinogen and tryptase beta; lane 3, fibrinogen, tryptase beta, and hu31 A.v1 1 Fab; lane 4, fibrinogen, tryptase beta, and B12 IgG; lane 5, fibrinogen, tryptase beta 1 , and huE1 Q4.v2 Fab; and lane 6 shows B12 mlgG1 alone. The decrease in intensity of the alpha chain indicates tryptase proteolytic activity, which was analyzed and quantified in the bottom panels.
  • FIG. 6A is a graph showing the results of dissociation of WT or mutant tetramer by hu31 A.v1 1 Fab.
  • FIG. 8B shows the results of a Coomassie-blue stained SDS-PAGE gel analysis of size exclusion chromatography peaks a Fig. 6A. hu31 A.v1 1 Fab formed complexes with tryptase mutants Y75C and I99C and dissociated the tetramer into covalently linked dimers.
  • FIG. 8C is a graph showing the results of dissociation of WT or mutant tetramer by huE104. v2 Fab.
  • FIG. 7 shows the amino acid sequence of mature human tryptase beta 1 along with the gene sequential numbering and the chymotrypsinogen numbering ("chymo-numb”) system typically used for mammalian serine trypsin.
  • chymo-numb chymotrypsinogen numbering
  • FIG. 8 shows the binding epitope of Fab hu31 A.v1 1 on human tryptase beta 1 (tryptase residues all chymotrypsinogen numbering).
  • FIG. 9 is a rendering showing modeling of Fab hu31 A.v1 1 onto the tryptase tetramer.
  • the tryptase monomers in complex with Fab hu31A.v1 1 were aligned to protomers A and C in the tryptase tetramer. Heavy chains and light chains are indicated. Clashes between the light chains of Fab hu31 A.v1 1 on adjacent tryptase protomers in this model are highlighted by a dashed oval.
  • FIG. 10 shows conformational changes in the 60s loop of tryptase detected in the complex structure.
  • Val60c and Val90 (shown in sticks) create a hydrophobic pocket for binding of Tyr173d from the neighboring protomer as part of the protein-protein interaction in the large interface of tetrameric tryptase. Tryptase protomers in the tetramer conformation are indicated. Tryptase bound to Fab hu31 A.v1 1 is superposed to one protomer of the tetramer complex.
  • Val60c changes when Fab hu31A.v1 1 is bound, which creates steric hindrance that is expected to prevent Tyr173d from binding to that pocket (tryptase residues all chymotrypsinogen numbering).
  • FIG. 11 shows conformational changes in the 30s loop of tryptase located in the small interface detected in the complex structure after binding to hu31 A.v1 1 .
  • FIG. 12A is a rendering of the crystal structure of WT tryptase tetramer in complex with four huE104.v1 Fabs. Tryptase protomers are indicated according to the letter labeling or the protomers (see Pereira et al. Nature 392:306-31 1 , 1998).
  • FIG. 12B is a rendering of the effect of huE104.v1 binding on the small interface of the tryptase tetramer as assessed by hydrogen-deuterium exchange (HDX).
  • FIG. 13 is a graph showing the results of a pharmacokinetic (PK) analysis of humanized anti- tryptase antibodies huE104.v2 and hu31A.v1 1 , each administered by intravenous (IV) injection at 1 or 10 mg/kg to C57BL/6 mice.
  • the graph shows anti-tryptase antibody concentration (pg/mL) as a function of time (days). The results are from three animals.
  • FIG. 14 is a graph showing the results of a PK analysis of humanized anti-tryptase antibodies huE104.v2 and hu31A.v1 1 compared to a control anti-gD lgG4 antibody. Each antibody was
  • FIG. 15 is a schematic diagram of assays for measuring the amount of active tryptase (left panel) and total tryptase (right panel) in a sample. Tryptase monomers and tetramers are indicated. In the left panel, soy bean trypsin inhibitor (SBTI) is added.
  • SBTI soy bean trypsin inhibitor
  • an exemplary biotinylated activity-based probe (ABP) was added to a tryptase-containing sample (e.g., broncoalveolar lavage fluid (BAL)) to label active tryptase. Labeling was stopped by addition of an exemplary small molecule inhibitor G02849855 (e.g., BMS-262084, Sutton et al. Bioorg. Med. Chem. Lett. 12:3229-33, 2002, Qian et al., J. Org. Chem. 2002, 67:3595-3600). The hu31 A.v1 1 antibody was added to dissociate the tryptase tetramers.
  • G02849855 e.g., BMS-262084, Sutton et al. Bioorg. Med. Chem. Lett. 12:3229-33, 2002, Qian et al., J. Org. Chem. 2002, 67:3595-3600.
  • the labeled tryptase was then detected in an enzyme-linked immunosorbent assay (ELISA) using horseradish peroxidase conjugated to streptavidin.
  • ELISA enzyme-linked immunosorbent assay
  • hu31 A.v1 1 was added to a sample to dissociate tryptase tetramers in the sample.
  • the amount of tryptase was then determined using ELISA.
  • FIG. 16 shows the results of an active tryptase assay performed on BAL samples obtained from cyno monkeys that were administered the anti-tryptase antibody hu31 A.v1 1 by intravenous (IV) administration at 30 mg/kg.
  • the top panel shows a schematic diagram of the experimental protocol.
  • FIG. 17 is a schematic diagram showing the experimental protocol of the cyno Ascaris challenge model described in Example 6.
  • FIGS. 18A and 18B are graphs showing the results of an active tryptase assay (Fig. 18A) and a total tryptase assay (Fig. 18B) performed on BAL obtained from individual animals in the cyno Ascaris challenge experiment described in Example 6.
  • FIG. 18C is a graph showing the results of a total tryptase assay to determine the amount of total tryptase in nasal mucosal lining fluid (MLF) obtained by nasosorption using a synthetic absorptive matrix (SAM) from individual animals in the cyno Ascaris challenge experiment described in Example 6.
  • MLF nasal mucosal lining fluid
  • SAM synthetic absorptive matrix
  • FIG. 19 is a graph showing that administration of the anti-tryptase antibody hu31A.v1 1 inhibited IgE-mediated passive systemic anaphylaxis in human engrafted mice.
  • mice treated with the anti-tryptase antibody hu31A.v1 1 showed an improved body temperature maintenance as compared to mice treated with a control anti-gD antibody.
  • *** P ⁇ 0.0001 (Paired T test).
  • acceptor human framework for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below.
  • An acceptor human framework "derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
  • the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
  • Binding affinity refers to intrinsic binding affinity which reflects a 1 :1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described in the following.
  • KD is measured by a surface plasmon resonance assay
  • a surface plasmon resonance assay when used in the context of the claims, means that the KD is measured according the method described in Example 1 (A)(vii), which measures kinetic parameters for binding of anti-tryptase antibodies to human tryptase beta 1 monomer, e.g., His6-tagged tryptase monomer as shown in SEQ ID NO: 128, which does not spontaneously form a tryptase tetramer.
  • the assay can use a BIAcore® T200 or an equivalent device.
  • BIAcore® Series S CM5 sensor chips are immobilized with monoclonal mouse anti- human IgG (Fc) antibody and anti-tryptase antibodies are subsequently captured on the flow cell.
  • Serial 3-fold dilutions of the human tryptase beta 1 monomer are injected at a flow rate of 30 ⁇ /min. Each sample is analyzed with 3 min association and 10 min dissociation. The assay is performed at 25°C. After each injection, the chip is regenerated using 3 M MgC . Binding response is corrected by subtracting the response units (RU) from a flow cell capturing an irrelevant IgG at similar density.
  • a 1 :1 Languir model of simultaneous fitting of k 0 n and koff is used for kinetics analysis.
  • affinity-matured antibody is one with one or more alterations in one or more HVRs and/or framework regions which result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s).
  • Preferred affinity- matured antibodies will have nanomolar or even picomolar affinities for the target antigen.
  • Affinity-matured antibodies are produced by procedures known in the art. For example, Marks et al. Bio/Technology 10:779-783, 1992 describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of HVR and/or framework residues is described by: Barbas et al. Proc. Natl. Acad. Sci.
  • antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
  • tryptase refers to any native tryptase from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. Tryptase is also known in the art as mast cell tryptase, mast cell protease II, skin tryptase, lung tryptase, pituitary tryptase, mast cell neutral proteinase, and mast cell serine proteinase II.
  • tryptase encompasses tryptase alpha (encoded in humans by TPSAB1), tryptase beta (encoded in humans by TPSAB1 and TPSB2; see below), tryptase delta (encoded in humans by TPSD1), tryptase gamma (encoded in humans by TPSG1), and tryptase epsilon (encoded in humans by PRSS22). Tryptase alpha, beta, and gamma proteins are soluble, whereas tryptase epsilon proteins are membrane anchored. Tryptase beta and gamma are active serine proteases, although they have different specificities.
  • Tryptase alpha and delta proteins are largely inactive proteases as they have residues in critical position that differ from typical active serine proteases.
  • An exemplary tryptase alpha full length protein sequence can be found under NCBI GenBank Accession No. ACZ98910.1 (SEQ ID NO: 1 18).
  • Exemplary tryptase gamma full length protein sequences can be found under Uniprot Accession No. Q9NRR2 or GenBank Accession Nos. Q9NRR2.3, AAF03695.1 , NP_036599.3 or AAF76457.1 .
  • Exemplary tryptase delta full length protein sequences can be found under Uniprot Accession No. Q9BZJ3 or GenBank Accession No.
  • Tryptase beta is the main tryptase expressed in mast cells, while tryptase alpha is the main tryptase expressed in basophils. Tryptase alpha and tryptase beta typically include a leader sequence of approximately 30 amino acids and a catalytic sequence of approximately 245 amino acids (see, e.g., Schwartz, Immunol. Allergy Clin. N. Am. 26:451 -463, 2006).
  • tryptase beta refers to any native tryptase beta from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. Tryptase beta is a serine protease that is a major constituent of mast cell secretory granules. As used herein, the term encompasses tryptase beta 1 (encoded by the TPSAB1 gene, which also encodes tryptase alpha 1), tryptase beta 2 (encoded by the TPSB2 gene), and tryptase beta 3 (also encoded by the TPSB2 gene).
  • An exemplary human tryptase beta 1 sequence is shown in SEQ ID NO: 71 (see also GenBank Accession No. NP_003285.2).
  • An exemplary human tryptase beta 2 sequence is shown in SEQ ID NO: 72 (see also GenBank Accession No. AAD13876.1).
  • An exemplary human tryptase beta 3 sequence is shown in SEQ ID NO: 73 (see also GenBank Accession No. NP_077078.5).
  • the term tryptase beta encompasses "full-length,” unprocessed tryptase beta as well as tryptase beta that results from post-translational modifications, including proteolytic processing.
  • pro- tryptase beta is thought to be processed in two proteolytic steps. First, autocatalytic intermolecular cleavage at R 3 occurs, particularly at acidic pH and in the presence of a polyanion (e.g., heparin or dextran sulfate). Next, the remaining pro' dipeptide is removed (likely by dipeptidyl peptidase I).
  • a polyanion e.g., heparin or dextran sulfate
  • tryptase beta is typically a homotetramer or heterotetramer, although active monomer has been reported (see, e.g., Fukuoka et al. J. Immunol. 176:3165, 2006).
  • the subunits of the tryptase beta tetramer are held together by hydrophobic and polar interactions between subunits and stabilized by polyanions (particularly heparin and dextran sulfate).
  • tryptase can refer to tryptase tetramer or tryptase monomer.
  • Exemplary sequences for mature human tryptase beta 1 , beta 2, and beta 3 are shown in SEQ ID NO: 97, SEQ ID NO: 1 16, and SEQ ID NO: 1 17, respectively.
  • the active site of each subunit faces into a central pore of the tetramer, which measures approximately 50 x 30 angstroms (see, e.g., Pereira et al. Nature 392:306-31 1 , 1998).
  • the size of the central pore typically restricts access of the active sites by inhibitors.
  • Exemplary substrates of tryptase beta include, but are not limited to, PAR2, C3, fibrinogen, fibronectin, and kininogen.
  • anti-tryptase antibody an “antibody that binds to tryptase,” and “antibody that specifically binds tryptase” refer to an antibody that is capable of binding tryptase with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting tryptase.
  • the extent of binding of an anti-tryptase antibody to an unrelated, non-tryptase protein is less than about 10% of the binding of the antibody to tryptase as measured, e.g., by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an antibody that binds to tryptase has a dissociation constant (KD) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 -8 M or less, e.g., from 10 " 8 M to 10 "13 M, e.g., from 10 -9 M to 10 -13 M).
  • KD dissociation constant
  • an anti-tryptase antibody binds to an epitope of tryptase that is conserved among tryptase from different species.
  • an "antibody that binds to the same epitope" as a reference antibody refers to an antibody that contacts an overlapping set of amino acid residues of the antigen as compared to the reference antibody or blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, 60% or more, 70% or more, 80% or more, or 90% or more.
  • the set of amino acid residues contacted by the antibody may be completely overlapping or partially overlapping with the set of amino acid residues contacted by the reference antibody.
  • an antibody that binds to the same epitope as a reference antibody blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, 60% or more, 70% or more, 80% or more, or 90% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more, 60% or more, 70% or more, 80% or more, or 90% or more.
  • An exemplary competition assay is provided herein.
  • a reference anti- tryptase antibody e.g., hu31A.v1 1 or huE104.v2
  • human tryptase beta 1 monomer protein is biotinylated at Lys residue by reacting with NHS-PEG4-biotin.
  • Biotinylated monomer is diluted to 5 ⁇ g/ml in kinetics buffer (ForteBio, Inc.) and immobilized onto streptavidin sensor tips (ForteBio, Inc.). After the immobilization step, human tryptase beta 1 -immobilized sensors are saturated with the first antibody, diluted at 10-20 ⁇ g/ml, followed by binding with second antibody diluted at 2.5 ⁇ g/ml. The run temperature for such epitope binding assays is 30°C.
  • a binding signal by second antibody implies that the two antibodies can bind antigen simultaneously at distinct, non-overlapping epitopes, whereas no binding signal implies that they share a common epitope. In some instances, a partial signal by the second antibody is observed (i.e., the signal is less than the signal observed if the first antibody was not added, but greater than background), which implies the epitopes are partially overlapping.
  • Antibody fragments comprise a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody.
  • antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies (see U.S. Patent No. 5,641 ,870, Example 2; Zapata et al. Protein Eng. 8(10):1057-1062, 1995); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
  • Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, and a residual "Fc” fragment, a designation reflecting the ability to crystallize readily.
  • the Fab fragment consists of an entire L chain along with the variable region domain of the H chain (VH), and the first constant domain of one heavy chain (CH1).
  • Pepsin treatment of an antibody yields a single large F(ab')2 fragment which roughly corresponds to two disulfide linked Fab fragments having divalent antigen- binding activity and is still capable of cross-linking antigen.
  • Fab' fragments differ from Fab fragments by having an additional few residues at the carboxy terminus of the CH1 domain including one or more cysteines from the antibody hinge region.
  • Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
  • F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region.
  • the term includes native sequence Fc regions and variant Fc regions.
  • a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
  • the C-terminal lysine (Lys447) of the Fc region may or may not be present.
  • numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al. Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991 .
  • Fv consists of a dimer of one heavy- and one light-chain variable region domain in tight, non- covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three Hs specific for an antigen) has the ability to recognize and bind antigen, although often at a lower affinity than the entire binding site.
  • Single-chain Fv also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain.
  • the sFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding.
  • diabodies refers to small antibody fragments prepared by constructing sFv fragments
  • bispecific diabodies are heterodimers of two "crossover" sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains.
  • Diabodies are described more fully in, for example, EP 404,097; WO 93/1 1 161 ; and Hollinger et al. Proc. Natl. Acad. Sci. USA 90:6444-6448, 1993.
  • binding domain is meant a part of a compound or a molecule that specifically binds to a target epitope, antigen, ligand, or receptor. Binding domains include but are not limited to antibodies (e.g., monoclonal, polyclonal, recombinant, humanized, and chimeric antibodies), antibody fragments or portions thereof (e.g., Fab fragments, Fab'2, scFv antibodies, SMIP, domain antibodies, diabodies, minibodies, scFv-Fc, affibodies, nanobodies, and VH and/or VL domains of antibodies), receptors, ligands, aptamers, and other molecules having an identified binding partner.
  • antibodies e.g., monoclonal, polyclonal, recombinant, humanized, and chimeric antibodies
  • antibody fragments or portions thereof e.g., Fab fragments, Fab'2, scFv antibodies, SMIP, domain antibodies, diabodies, mini
  • a “blocking” antibody or an “antagonist” antibody is one which inhibits or reduces biological activity of the antigen it binds. Certain blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
  • the activity may be a tryptase enzymatic activity, e.g., protease activity.
  • the activity may be tryptase- mediated stimulation of bronchial smooth muscle cell proliferation and/or collagen-based contraction.
  • the activity may be mast cell histamine release (e.g., IgE-triggered histamine release and/or tryptase-triggered histamine release).
  • An antibody of the invention can inhibit a biological activity of tryptase at least about 1 %, about 5%, about 10%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100%.
  • a human tryptase beta enzymatic assay using a synthetic peptide S- 2288 as a substrate means that inhibitory activity is measured according to the assay described in Example 1 (A)(viii)(a). Briefly, recombinant human tryptase beta 1 tetramer active enzyme is diluted to 0.75 nM in TNH Buffer (200 mfvl Tris, 150 m NaCI, 0.1 mg/mL heparin, 0.01 % TRITONTM X-100, pH 8.0), and combined 1 :1 with anti-tryptase antibodies (diluted in PBS) in 384-weli plates.
  • TNH Buffer 200 mfvl Tris, 150 m NaCI, 0.1 mg/mL heparin, 0.01 % TRITONTM X-100, pH 8.0
  • Colorimetric substrate S-2288 (Chromogenix, Part No. 82-0852-39), or an equivalent substrate, is diluted to 1200 ⁇ in TNH Buffer and added to the plate. Final in-well concentrations are 400 ⁇ S-2288, 0.25 n recombinant human tryptase beta 1 tetramer, 66 pg/ mL heparin, and from 0.10 to 222 nM anti-tryptase antibody. Plates are incubated for 40 min at ambient temperature with gentle agitation and then read at A405. The IC50 of the anti-tryptase antibodies is determined from a four-parameter fit of their respective curves.
  • the "class" of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
  • the heavy chain constant domains that correspond to the different classes of immunoglobulins are called , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • Antibody effector functions refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: C1 q binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor); and B cell activation.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • FcRs Fc receptors
  • cytotoxic cells e.g., Natural Killer (NK) cells, neutrophils, and macrophages
  • NK Natural Killer
  • the antibodies “arm” the cytotoxic cells and are absolutely required for such killing.
  • ADCC activity on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch et al. Annu. Rev. Immunol. 9:457- 492, 1991 .
  • an in vitro ADCC assay such as that described in US Patent No. 5,500,362 or 5,821 ,337 can be performed.
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest can be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. USA 95:652-656, 1998.
  • Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
  • the preferred FcR is a native sequence human FcR.
  • a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • FcyRII receptors include FcyRIIA (an “activating receptor”) and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
  • Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
  • Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain (see review M. in Daeron, Annu. Rev. Immunol. 15:203-234, 1997).
  • FcRs are reviewed, for example, in Ravetch et al. Annu. Rev. Immunol. 9:457-492, 1991 ; Capel et al. Immunomethods 4:25-34, 1994; and de Haas et al. J. Lab. Clin. Med. 126:330-41 , 1995.
  • FcR FcR
  • FcRn neonatal receptor
  • Human effector cells are leukocytes which express one or more FcRs and perform effector functions. Preferably, the cells express at least FcyRIII and perform ADCC effector function. Examples of human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells, and neutrophils; with PBMCs and NK cells being preferred.
  • PBMC peripheral blood mononuclear cells
  • NK natural killer cells
  • monocytes cytotoxic T cells
  • neutrophils neutrophils
  • the effector cells can be isolated from a native source, e.g., from blood.
  • “Complement dependent cytotoxicity” or “CDC” refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (C1 q) to antibodies (of the appropriate subclass) which are bound to their cognate antigen.
  • C1 q the first component of the complement system
  • a CDC assay e.g., as described in Gazzano- Santoro et al. J. Immunol. Methods 202:163, 1996, can be performed.
  • an “epitope” is the portion of the antigen to which the antibody selectively binds.
  • a linear epitope can be a peptide portion of about 4-15 (e.g., 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, amino acid residues.
  • a non-linear, conformational epitope may comprise residues of a polypeptide sequence brought to close vicinity in the three-dimensional (3D) structure of the protein.
  • the epitope comprises amino acids that are within 4 angstroms (A) of any atom of an antibody.
  • the epitope comprises amino acids of a tryptase protomer that are within 4 A of any atom of a partner Fab.
  • the epitope comprises amino acids that are within 3.5 A, 3 A, 2.5 A, or 2 A of any atom of an antibody.
  • the amino acid residues of an antibody that contact an antigen can be determined, for example, by determining the crystal structure of the antibody in complex with the antigen or by performing hydrogen/deuterium exchange.
  • the epitope is determined by an X-ray crystallography model
  • an atom of a tryptase amino acid residue e.g., human tryptase beta 1 residue
  • an anti-tryptase antibody e.g.. any anti-tryptase antibody described herein, e.g., hu31A.v1 1 or huE104.v2
  • the X-ray crystallography model has a resolution of about 3.5 A or less, about 3 A or less, about 2.5 A or less, about 2.15 A or less, or about 2 A or less.
  • full-length antibody “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
  • a "human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • a "human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
  • the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroup of sequences is a subgroup as in Kabat et al. Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91 -3242, Bethesda MD, vols. 1 -3, 1991.
  • the subgroup is subgroup kappa III or kappa IV as in Kabat et al. supra.
  • the subgroup is subgroup III as in Kabat et al. supra.
  • Humanized forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
  • donor antibody such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
  • framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • an “immunoconjugate” is an antibody conjugated to one or more heterologous molecule(s), including but not limited to a cytotoxic agent.
  • an antibody when used to describe the various antibodies disclosed herein, means an antibody that has been identified and separated and/or recovered from a cell or cell culture from which it was expressed. Contaminant components of its natural environment are materials that would typically interfere with diagnostic or therapeutic uses for the polypeptide, and can include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes.
  • an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), isoelectric focusing (IEF), capillary
  • electrophoretic e.g., sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), isoelectric focusing (IEF), capillary
  • the antibody will be purified (1) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (2) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver stain.
  • Isolated antibody includes antibodies in situ within recombinant cells, because at least one component of the polypeptide natural environment will not be present. Ordinarily, however, isolated polypeptide will be prepared by at least one purification step.
  • monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope on an antigen, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
  • polyclonal antibody preparations which typically include different antibodies directed against different determinants
  • each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
  • the term "monoclonal antibody” encompasses bispecific antibodies.
  • bivalent antibody refers to an antibody that has two binding sites for the antigen.
  • a bivalent antibody can be, without limitation, in the IgG format or in the F(ab')2 format.
  • multispecific antibody is used in the broadest sense and covers an antibody that binds to two or more determinants or epitopes on one antigen or two or more determinants or epitopes on more than one antigen.
  • Such multispecific antibodies include, but are not limited to, full-length antibodies, antibodies having two or more VL and VH domains, antibody fragments such as Fab, Fv, dsFv, scFv, diabodies, bispecific diabodies and triabodies, antibody fragments that have been linked covalently or non-covalently.
  • Polyepitopic specificity refers to the ability to specifically bind to two or more different epitopes on the same or different target(s).
  • the multispecific antibody is a bispecific antibody.
  • “Dual specificity” or “bispecificity” refers to the ability to specifically bind to two different epitopes on the same or different target(s).
  • dual-specific antibodies have two antigen-binding arms that are identical in amino acid sequence and each Fab arm is capable of recognizing two antigens. Dual-specificity allows the antibodies to interact with high affinity with two different antigens as a single Fab or IgG molecule.
  • the multispecific antibody binds to each epitope with an affinity of 5 ⁇ to 0.001 pM, 3 ⁇ to 0.001 pM, 1 ⁇ to 0.001 pM, 0.5 ⁇ to 0.001 pM or 0.1 ⁇ to 0.001 pM.
  • “Monospecific” refers to the ability to bind only one epitope.
  • naked antibody refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety) or radiolabel.
  • the naked antibody may be present in a pharmaceutical composition.
  • the term “binds” or “binding” or “specific binding” or “specifically binds” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide target means binding that is measurably different from a non-specific interaction.
  • Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule. For example, specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target.
  • telomere binding or “specifically binds to” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide target as used herein can be exhibited, for example, by a molecule having a KD for the target of 1 0 -4 M or lower, alternatively 1 0 -5 M or lower, alternatively 1 0 6 M or lower, alternatively 1 0 7 M or lower, alternatively 1 0 8 M or lower, alternatively 1 0 9 M or lower, alternatively 1 0 0 M or lower, alternatively 1 0 1 M or lower, alternatively 1 0 2 M or lower or a KD in the range of 1 0 4 M to 1 0 6 M or 1 0 6 M to 1 0 0 M or 1 0 7 M to 1 0 9 M.
  • affinity and KD values are inversely related. A high affinity for an antigen is measured by a low KD value.
  • the term "specific binding" refers to binding where a molecule binds to a particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.
  • paratope is meant the part of an antibody which binds the epitope of an antigen.
  • the paratope is typically a region of about 1 5-22 amino acid residues of the antibody's Fv region and may contain amino acids from the antibody's VH and VL chains.
  • variable refers to the fact that certain segments of the variable domains differ extensively in sequence among antibodies.
  • the variable or "V” domain mediates antigen binding and defines specificity of a particular antibody for its particular antigen.
  • variability is not evenly distributed across the 1 1 0-amino acid span of the variable domains. Instead, the V regions consist of relatively invariant stretches called framework regions (FRs) of 1 5-30 amino acids separated by shorter regions of extreme variability called “hypervariable regions” that are each 9-12 amino acids long.
  • FRs framework regions
  • hypervariable regions refers to the amino acid residues of an antibody which are responsible for antigen-binding.
  • the hypervariable region generally comprises amino acid residues from e.g., around about residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the VL, and around about residues 26-35 (H1), 49-65 (H2) and 95-102 (H3) in the VH (in one embodiment, H1 is around about residues 31 -35); Kabat et al. supra) and/or those residues from a "hypervariable loop" (e.g., residues 26-32 (L1), 50-52 (L2), and 91 -96 (L3) in the VL, and 26-32 (H1), 53-55 (H2), and 96-101 (H3) in the VH; Chothia et al. J.
  • variable domains of native heavy and light chains each comprise four FRs, largely adopting a beta-sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
  • the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al. supra).
  • the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1 -H1 (L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
  • the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
  • variable domain residue numbering as in Kabat or "amino acid position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al. supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain.
  • a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
  • the Kabat numbering system is generally used when referring to a residue in the variable domain
  • EU numbering system or "EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region (e.g., the EU index reported in Kabat et al. supra).
  • EU index as in Kabat refers to the residue numbering of the human lgG1 EU antibody.
  • references to residue numbers in the variable domain of antibodies means residue numbering by the Kabat numbering system.
  • references to residue numbers in the constant domain of antibodies means residue numbering by the EU numbering system (e.g., see United States Provisional Application No. 60/640,323, Figures for EU numbering).
  • a “disorder” or “disease” is any condition that would benefit from treatment with the antibody (e.g., any anti-tryptase antibody described herein). This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question.
  • the disorder is a pulmonary disorder, an autoimmune disorder, an inflammatory disorder, a fibrotic disorder, a granulocytic (neutrophilic or eosinophilic) disorder, a monocytic disorder, a lymphocytic disorder, or a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • the disorder is a pulmonary disorder.
  • a disorder may be a tryptase-associated disorder or a tryptase-mediated disorder.
  • tryptase-associated disorder and “tryptase-mediated disorder,” as used herein, refers to any disorder or condition mediated by, or associated with, tryptase.
  • tryptase-associated disorders are associated with excess tryptase levels or activity in which atypical symptoms may manifest due to the levels or activity of tryptase locally and/or systemically in the body.
  • the pulmonary disorder is asthma.
  • the asthma is persistent chronic severe asthma with acute events of worsening symptoms (exacerbations or flares) that can be life threatening.
  • the asthma is atopic (also known as allergic) asthma, non-allergic asthma (e.g., often triggered by infection with a respiratory virus (e.g., influenza,
  • inhaled irritant air pollutants, smog, diesel particles, volatile chemicals and gases indoors or outdoors, or even by cold dry air.
  • the asthma is intermittent or exercise-induced, asthma due to acute or chronic primary or second-hand exposure to "smoke” (typically cigarettes, cigars, pipes), inhaling or “vaping” (tobacco, marijuana or other such substances), or asthma triggered by recent ingestion of aspirin or related NSAIDS.
  • the asthma is mild, or corticosteroid naive asthma, newly diagnosed and untreated asthma, or not previously requiring chronic use of inhaled topical or systemic steroids to control the symptoms (cough, wheeze, shortness of breath/breathlessness, or chest pain).
  • the asthma is chronic, corticosteroid resistant asthma, corticosteroid refractory asthma, asthma uncontrolled on corticosteroids or other chronic asthma controller medications.
  • the asthma is moderate to severe asthma. In certain embodiments, the asthma is Th2-high asthma. In some embodiments, the asthma is severe asthma. In some
  • the asthma is atopic asthma, allergic asthma, non-allergic asthma (e.g., due to infection and/or respiratory syncytial virus (RSV)), exercise-induced asthma, aspirin sensitive/exacerbated asthma, mild asthma, moderate to severe asthma, corticosteroid naive asthma, chronic asthma, corticosteroid resistant asthma, corticosteroid refractory asthma, newly diagnosed and untreated asthma, asthma due to smoking, asthma uncontrolled on corticosteroids.
  • the asthma is T helper lymphocyte type 2 (Th2) or type 2 (Th2) high, or Type 2 (T2)-driven asthma.
  • the asthma is eosinophilic asthma.
  • the asthma is allergic asthma.
  • the individual has been determined to be Eosinophilic Inflammation Positive (EIP). See WO 2015/061441 .
  • the asthma is periostin-high asthma (e.g., having periostin level at least about any of 20 ng/mL, 25 ng/mL, or 50 ng/mL serum).
  • the asthma is eosinophil-high asthma (e.g., at least about any of 150, 200, 250, 300, 350, 400 eosinophil counts/ml blood).
  • the asthma is Th2-low asthma or nonTh2-driven asthma.
  • the individual has been determined to be Eosinophilic Inflammation Negative (EIN).
  • the asthma is periostin-low asthma (e.g., having periostin level less than about 20 ng/mL serum).
  • the asthma is eosinophil-low asthma (e.g., less than about 150 eosinophil counts/ ⁇ blood or less than about 100 eosinophil counts/ ⁇ blood).
  • Th2-high asthma refers to asthma that exhibits high levels of one or more Th2 cell-related cytokines, for example, IL13, IL4, IL9, IL5, or that exhibits Th2 cytokine-associated inflammation.
  • the term Th2-high asthma may be used interchangeably with eosinophil-high asthma.
  • the Th2-high asthma is Th2 driven asthma.
  • the asthma patient has been determined to be Eosinophilic Inflammation Positive (EIP). See, e.g., International Patent Application Publication No. WO 2015/061441 , which is incorporated by reference herein in its entirety.
  • EIP Eosinophilic Inflammation Positive
  • the individual has been determined to have elevated levels of at least one of the eosinophilic signature genes as compared to a control or reference level. See WO2015/061441 .
  • the Th2-high asthma is periostin-high asthma.
  • the individual has high serum periostin.
  • the individual is eighteen years or older. In certain embodiments, the individual has been determined to have an elevated level of serum periostin as compared to a control or reference level. In certain embodiments, the control or reference level is the median level of periostin in a population. In certain embodiments, the individual has been determined to have 20 ng/ml or higher serum periostin. In certain embodiments, the individual has been determined to have 25 ng/ml or higher serum periostin. In certain embodiments, the individual has been determined to have 50 ng/ml or higher serum periostin. In certain embodiments, the control or reference level of serum periostin is 20 ng/ml, 25 ng/ml, or 50 ng/ml.
  • the asthma is eosinophil-high asthma.
  • the individual has been determined to have an elevated eosinophil count as compared to a control or reference level. In certain embodiments, the control or reference level is the median level of a population. In certain embodiments, the individual has been determined to have 150 or higher eosinophil count / ⁇ blood. In certain embodiments, the individual has been determined to have 200 or higher eosinophil count / ⁇ blood. In certain embodiments, the individual has been determined to have 250 or higher eosinophil count / ⁇ blood. In certain embodiments, the individual has been determined to have 300 or higher eosinophil count / ⁇ blood.
  • the individual has been determined to have 350 or higher eosinophil count / ⁇ blood. In certain embodiments, the individual has been determined to have 400 or higher eosinophil count / ⁇ blood. In certain embodiments, the individual has been determined to have 450 or higher eosinophil count / ⁇ blood. In certain embodiments, the individual has been determined to have 500 or higher eosinophil count / ⁇ blood. In certain preferred embodiments, the individual has been determined to have 300 or higher eosinophil count/ ⁇ blood. In certain embodiments, the eosinophils are peripheral blood eosinophils. In certain embodiments, the eosinophils are sputum eosinophils.
  • the individual exhibits elevated level of FeNO (fractional exhaled nitric acid) and/or elevated level of IgE.
  • FeNO fractional exhaled nitric acid
  • IgE elevated level of IgE.
  • the individual exhibits a FeNO level above about 250 parts per billion (ppb), above about 275 ppb, above about 300 ppb, above about 325 ppb, above about 325 ppb, or above about 350 ppb.
  • the individual has an IgE level that is above 50 lU/ml.
  • Th2-low asthma or “non-Th2-high asthma” as used herein, refers to asthma that exhibits low levels of one or more Th2 cell-related cytokines, for example, IL13, IL4, IL9, IL5, or exhibits non-Th2 cytokine-associated inflammation.
  • Th2-low asthma may be used interchangeably with eosinophil-low asthma.
  • the asthma patient has been determined to be Eosinophilic Inflammation Negative (EIN). See, e.g., WO 2015/061441 .
  • EIN Eosinophilic Inflammation Negative
  • the Th2-low asthma is Th17-driven asthma.
  • the Th2-low asthma is periostin-low asthma.
  • the individual is eighteen years or older. In certain embodiments, the individual has been determined to have a reduced level of serum periostin as compared to a control or reference level. In certain embodiments, the control or reference level is the median level of periostin in a population. In certain embodiments, the individual has been determined to have less than 20 ng/ml serum periostin. In certain embodiments, the asthma is eosinophil-low asthma. In certain embodiments, the individual has been determined to have a reduced esosinophil count as compared to a control or reference level. In certain embodiments, the control or reference level is the medium level of a population.
  • the individual has been determined to have less than 150 eosinophil count / ⁇ blood. In certain embodiments, the individual has been determined to have less than 100 eosinophil count / ⁇ blood. In certain preferred embodiments, the individual has been determined to have less than 300 eosinophil count/ ⁇ blood.
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, granulocytic (neutrophilic or eosinophilic) disorder, monocytic disorder, or lymphocytic disorder is esophagitis (e.g., eosinophilic esophagitis), allergic rhinitis, non-allergic rhinitis, rhinosinusitis with polyps, nasal polyposis, bronchitis, chronic pneumonia, allergic bronchopulmonary aspergillosis, airway inflammation, allergic rhinitis, bronchiectasis, and/or chronic bronchitis.
  • the autoimmune disorder inflammatory disorder, fibrotic disorder, granulocytic (neutrophilic or eosinophilic) disorder, monocytic disorder, or lymphocytic disorder
  • the arthritis is rheumatoid arthritis.
  • the arthritis is osteoarthritis, rheumatoid arthritis, juvenile arthritis, juvenile rheumatoid arthritis, early arthritis, polyarticular rheumatoid arthritis, systemic-onset rheumatoid arthritis, enteropathic arthritis, reactive arthritis, psoriatic arthritis, and/or arthritis as a result of injury.
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, granulocytic (neutrophilic or eosinophilic) disorder, monocytic disorder, or lymphocytic disorder is a gastrointestinal inflammatory condition.
  • the gastrointestinal inflammatory condition is IBD (inflammatory bowel disease), ulcerative colitis (UC), Crohn's disease (CD), colitis (e.g., colitis caused by environmental insults (e.g., caused by or associated with a therapeutic regimen, such as chemotherapy, radiation therapy, etc.)), infectious colitis, ischemic colitis, collagenous or lymphocytic colitis, necrotizing enterocolitis, colitis in conditions such as chronic granulomatous disease or celiac disease, food allergies, gastritis, gastroenteritis, infectious gastritis or enterocolitis (e.g., Helicobacter py/o/7-infected chronic active gastritis), esophagitis, and other forms of gastrointestinal inflammation caused by an IBD (inflammatory bowel disease
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, granulocytic (neutrophilic or eosinophilic) disorder, monocytic disorder, or lymphocytic disorder is a gastrointestinal inflammatory condition.
  • the gastrointestinal inflammatory condition is IBD (inflammatory bowel disease).
  • the inflammatory bowel disease is ulcerative colitis (UC) or Crohn's disease (CD).
  • the gastrointestinal inflammatory condition is colitis (e.g., colitis caused by environmental insults (e.g., caused by or associated with a therapeutic regimen, such as chemotherapy, radiation therapy, etc.), infectious colitis, ischemic colitis, collagenous or lymphocytic colitis, necrotizing enterocolitis, colitis in conditions such as chronic granulomatous disease or celiac disease, food allergies, gastritis, gastroenteritis, infectious gastritis or enterocolitis (e.g., Helicobacter pylori-infected chronic active gastritis), and other forms of gastrointestinal inflammation caused by an infectious agent, or indeterminate colitis.
  • the gastrointestinal inflammatory condition is ulcerative colitis (UC) or Crohn's disease (CD).
  • the gastrointestinal inflammatory condition is ulcerative colitis (UC).
  • UC ulcerative colitis
  • the ulcerative colitis is mild to moderate distal colitis. In some embodiments, the ulcerative colitis is mild to moderate extensive colitis. In some embodiments, the ulcerative colitis is severe colitis.
  • the gastrointestinal inflammatory condition is Crohn's disease (CD). In some embodiments, the Crohn's disease is in acute disease stage, in some embodiments, the Crohn's disease is in induced clinical remission stage, in some embodiments, the Crohn's disease is in maintain
  • the Crohn's disease is mild to moderate disease. In some embodiments, the Crohn's disease is moderate to severe disease, in some embodiments, the Crohn's disease is severe fuiiminant disease, in some embodiments, the Crohn's disease is ileal, ileocolonic, or colonic disease.
  • tissue resident cells such as mast cells, macrophages
  • the autoimmune disorder, inflammatory disorder, or fibrotic disorder is related to sepsis and/or trauma, HIV infection, or idiopathic (of unknown etiology) such as ANCA- associated vaculitides (AAV), granulomatosis with polyangiitis (formerly known as Wegener's granulomatosis), Behcet's disease, cardiovascular disease, eosinophilic bronchitis, Reiter's Syndrome, SEA Syndrome (Seronegativity, Enthesopathy, Arthropathy Syndrome), ankylosing spondylitis, dermatomyositis, scleroderma, e.g., systemic scleroderma also called systemic sclerosis, vasculitis (e.g., Giant Cell Arteritis (GCA), also called temporal arteritis, cranial arteritis or Horton disease), myositis, polymyositis, dermatomyositis, polyart
  • the disorder is an inflammatory disorder of the skin.
  • the disorder is atopic dermatitis or onchocercal dermatitis.
  • the disorder is chronic idiopathic urticaria (CIU or CSU).
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, neutrophilic disorder, or eosinophilic disorder is a fibrotic disorder.
  • the fibrotic disorders include lung fibrosis, liver fibrosis (e.g., fibrosis associated with cirrhosis (e.g., alcohol-induced cirrhosis, viral-induced cirrhosis, post-hepatitis C cirrhosis, and primary biliary cirrhosis), schistosomiasis, cholangitis (e.g., sclerosing cholangitis), and autoimmune-induced hepatitis), kidney fibrosis (e.g., tubulointerstitial fibrosis, scleroderma, diabetic nephritis, and glomerular nephritis), dermal fibrosis (e.g., scleroderma, hypertrophic and keloid scarring, nephro
  • cirrhosis
  • the fibrosis can be organ-specific or systemic (e.g., systemic sclerosis and fibrosis associated with GVHD).
  • the fibrotic disorder is pulmonary fibrosis.
  • the pulmonary fibrosis is fibrosing interstitial pneumonia.
  • the pulmonary fibrosis is idiopathic pulmonary fibrosis (IPF), also known as cryptogenic fibrosing alveolitis.
  • the IPF is gender, age and physiology (GAP)-stage I.
  • the IPF is GAP-stage II.
  • the IPF is GAP-stage III.
  • the pulmonary fibrosis is sporadic IPF.
  • the pulmonary fibrosis is familial pulmonary fibrosis.
  • the pulmonary fibrosis is combined pulmonary fibrosis and emphysema.
  • the pulmonary fibrosis is associated with one or more of the following: usual interstitial pneumonia; idiopathic interstitial pneumonia; desquamative interstitial pneumonia; respiratory bronchiolitis-interstitial lung disease; acute interstitial pneumonia; nonspecific interstitial pneumonia; sarcoidosis; cryptogenic organizing pneumonia; eosinophilic pneumonia; infection; exposure to occupational or environmental agents; cigarette smoking; interstitial lung disease induced by drugs or radiation; rheumatic disease- associated interstitial lung disease; lymphoid interstitial pneumonia; pleuropulmonary fibroelastosis; pulmonary Langerhans cell histiocytosis; systemic sclerosis-interstitial lung disease; Hermansky-Pudlak syndrome; and telomeropathy.
  • the pulmonary disorder, autoimmune disorder, inflammatory disorder, fibrotic disorder, neutrophilic disorder, or eosinophilic disorder is chronic obstructive pulmonary disease (COPD).
  • COPD chronic obstructive pulmonary disease
  • the COPD is Global Initiative for Chronic Obstructive Lung Disease (GOLD) category A.
  • the COPD is GOLD category B.
  • the COPD is GOLD category C.
  • the COPD is GOLD category D.
  • the COPD is chronic bronchitis.
  • the COPD is emphysema.
  • the emphysema is proximal acinar, panacinar, or distal acinar emphysema. In some embodiments, the emphysema is cigarette-induced emphysema. In some embodiments, the COPD is associated with exposure to particulate dusts, chemical fumes, and/or air pollution. In some
  • the COPD is associated with impaired lung development. In some embodiments, the COPD is chronic obstructive asthma. In some embodiments, the COPD is associated with alpha-1 antitrypsin deficiency. In some embodiments, the COPD is associated with serine protease inhibitor clade E, member 2 (SERPINE2) disruption. In some embodiments, the COPD is COPD with persistent systemic inflammation. In some embodiments, the COPD is eosinophilic or T-helper type 2 ( ⁇ 2) high COPD. In some embodiments, the COPD is COPD with persistent bacterial colonization. In some embodiments, the COPD is COPD with frequent exacerbations.
  • SERPINE2 serine protease inhibitor clade E, member 2
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, neutrophilic disorder, or eosinophilic disorder is asthma- COPD overlap syndrome (ACOS).
  • ACOS is eosinophil-predominant, neutrophil-predominant, mixed-pattern, or no inflammation (paucigranulocytic) ACOS.
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, a neutrophilic disorder, or an eosinophilic disorder is COPD-obstructive sleep apnea (OSA) overlap syndrome.
  • OSA COPD-obstructive sleep apnea
  • package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
  • compositions or pharmaceutical formulation are administered to a human subject.
  • a "sterile" pharmaceutical formulation is aseptic or free or essentially free from all living microorganisms and their spores.
  • a “stable" pharmaceutical formulation is one in which the protein (e.g., an antibody, such as an anti-tryptase antibody) therein essentially retains its physical stability and/or chemical stability and/or biological activity upon storage.
  • the formulation essentially retains its physical and chemical stability, as well as its biological activity upon storage. The storage period is generally selected based on the intended shelf-life of the formulation.
  • Various analytical techniques for measuring protein stability are available in the art and are reviewed in Peptide and Protein Drug Delivery, 247-301 , Vincent Lee Ed., Marcel Dekker, Inc., New York, N.Y., Pubs. (1991) and Jones, A. Adv. Drug Delivery Rev. 10: 29-90 (1993), for example.
  • Stability can be measured at a selected amount of light exposure and/or temperature for a selected time period. Stability can be evaluated qualitatively and/or quantitatively in a variety of different ways, including evaluation of aggregate formation (for example, using size exclusion chromatography, by measuring turbidity, and/or by visual inspection); evaluation of ROS formation (for example, by using a light stress assay or an AAPH stress assay); oxidation of specific amino acid residues of the protein (for example, a Trp residue and/or a Met residue of a monoclonal antibody); by assessing charge heterogeneity using cation exchange chromatography, image capillary isoelectric focusing (icIEF) or capillary zone electrophoresis; amino-terminal or carboxy-terminal sequence analysis; mass spectrometric analysis; SDS-PAGE analysis to compare reduced and intact antibody; peptide map (for example, tryptic or LYS-C) analysis; evaluating biological activity or target binding function of the protein (e.g., antigen binding function
  • Instability may involve any one or more of: aggregation, deamidation (e.g., Asn deamidation), oxidation (e.g., Met oxidation and/or Trp oxidation), isomerization (e.g., Asp isomerization), clipping/hydrolysis/fragmentation (e.g., hinge region fragmentation), succinimide formation, unpaired cysteine(s), N-terminal extension, C-terminal processing, glycosylation differences, and the like.
  • deamidation e.g., Asn deamidation
  • oxidation e.g., Met oxidation and/or Trp oxidation
  • isomerization e.g., Asp isomerization
  • clipping/hydrolysis/fragmentation e.g., hinge region fragmentation
  • succinimide formation unpaired cysteine(s)
  • N-terminal extension e.g., N-terminal extension, C-terminal processing, glycosy
  • An antibody e.g., an anti-tryptase antibody "retains its physical stability" in a pharmaceutical formulation if it shows no signs or very little of aggregation, precipitation, fragmentation, and/or denaturation upon visual examination of color and/or clarity, or as measured by UV light scattering or by size exclusion chromatography.
  • An antibody e.g., an anti-tryptase antibody "retains its chemical stability" in a pharmaceutical formulation, if the chemical stability at a given time is such that the antibody is considered to still retain its biological activity as defined below.
  • Chemical stability can be assessed by detecting and quantifying chemically altered forms of the antibody.
  • Chemical alteration may involve protein oxidation which can be evaluated using tryptic peptide mapping, reverse-phase high-performance liquid chromatography (HPLC) and liquid chromatography-mass spectrometry (LC/MS), for example.
  • Other types of chemical alteration include charge alteration of the antibody which can be evaluated by ion-exchange chromatography or icIEF, for example.
  • an antibody e.g.. an anti-tryptase antibody "retains its biological activity" in a pharmaceutical formulation, if the biological activity of the antibody at a given time is within about 20% (such as within about 10%) of the biological activity exhibited at the time the pharmaceutical formulation was prepared (within the errors of the assay), as determined for example in an antigen binding assay or an in vitro inhibitory assay for a monoclonal antibody (e.g., an anti-tryptase monoclonal antibody).
  • the biological activity of an antibody at a given time is within about 25%, about 30%, about 35%, about 40%, about 45%, about 50% of the biological activity exhibited at the time the pharmaceutical formulation was prepared.
  • biological activity of an antibody refers to the ability of the antibody to bind its target, for example the ability of a monoclonal antibody to bind to an antigen. It can further include a biological response which can be measured in vitro or in vivo. Such activity may be antagonistic or agonistic.
  • a protein e.g., an antibody, such as an anti-tryptase antibody which is "susceptible to oxidation" is one comprising one or more residue(s) that has been found to be prone to oxidation such as, but not limited to, methionine (Met), cysteine (Cys), histidine (His), tryptophan (Trp), and tyrosine (Tyr).
  • a tryptophan amino acid in the Fab portion of a monoclonal antibody or a methionine amino acid in the Fc portion of a monoclonal antibody may be susceptible to oxidation.
  • percent oxidation refers to the percentage of antibodies in a formulation (e.g., a pharmaceutical composition) that are oxidized at a particular amino acid residue, for example, a Trp residue (e.g., Trp100 in HVR-H3 of hu31A.v1 1) or a Met residue. Percent oxidation can be determined by, e.g., mass spectrometry (MS) analysis of one or more tryptic peptides, in which one or more particular oxidation-prone amino acid residues reside.
  • MS mass spectrometry
  • the percentage oxidation of Trp100 in HVR-H3 of hu31 A.v1 1 is determined by the mass of oxidized tryptic peptide in which Trp 100 resides, over the mass of the overall (oxidized and non-oxidized) tryptic peptide, as determined by MS analysis. Percent oxidation may be determined, for example, within 9 months, 12 months, 18 months, or two years from the initial production of an antibody or pharmaceutical composition thereof.
  • the term "is determined following an AAPH stress test,” as used herein, means that the percent oxidation at a particular amino acid residue (for example, at Trp100 in HVR-H3 of hu31A.v1 1) is determined by mass spectrometry analysis of tryptic peptides following formulating the antibody at 150 mg/ml in 5 mM AAPH for 25 h at 40°C, for example, as described in Example 5.
  • the stressed antibody is digested with trypsin and the digested peptides were subjected to ultra high performance liquid chromatography-high resolution mass spectrometry (UHPLC-HRMS) to determine the percentage of oxidation.
  • UHPLC-HRMS ultra high performance liquid chromatography-high resolution mass spectrometry
  • buffer refers to a buffered solution that resists changes in pH by the action of its acid-base conjugate components.
  • the buffer of this invention preferably has a pH in the range from about 4.5 to about 8.0 (e.g., about 4.5, about 5, about 5.5, about 6, about 6.5, about 7, about 7.5, or about 8), e.g., about pH 5.5.
  • histidine acetate is an example of a buffer that will control the pH in this range.
  • Another suitable buffer is arginine succinate and/or histidine succinate.
  • a "preservative” is a compound which can be optionally included in the formulation to essentially reduce bacterial action therein, thus facilitating the production of a multi-use formulation, for example.
  • potential preservatives include octadecyldimethylbenzyl ammonium chloride,
  • hexamethonium chloride benzalkonium chloride (a mixture of alkylbenzyldimethylammonium chlorides in which the alkyl groups are long-chain compounds), and benzethonium chloride.
  • Other types of preservatives include aromatic alcohols such as phenol, butyl, and benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol, and m-cresol.
  • the preservative herein is benzyl alcohol.
  • a "surfactant” refers to a surface-active agent, preferably a nonionic surfactant.
  • surfactants herein include polysorbate (for example, polysorbate 20 and polysorbate 80); poloxamer (e.g., poloxamer 188); TRITON®; sodium dodecyl sulfate (SDS); sodium laurel sulfate; sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl-sulfobetaine; lauryl-, myristyl-, linoleyl- or stearyl- sarcosine; linoleyl-, myristyl-, or cetyl-betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-betaine (e.g., lauroamidopropyl);
  • the surfactant herein is polysorbate 20.
  • the surfactant herein is poloxamer 188.
  • a “pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject.
  • a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
  • prodrug refers to a precursor or derivative form of a pharmaceutically active substance that is less cytotoxic to tumor cells compared to the parent drug and is capable of being enzymatically activated or converted into the more active parent form. See, e.g., Wilman, "Prodrugs in Cancer Chemotherapy” Biochemical Society Transactions, 14, pp. 375-382, 615th Meeting Harbor (1986) and Stella et al. "Prodrugs: A Chemical Approach to Targeted Drug Delivery,” Directed Drug Delivery, Borchardt et al. (ed.), pp. 247-267, Humana Press (1985).
  • the prodrugs of this invention include, but are not limited to, phosphate-containing prodrugs, thiophosphate-containing prodrugs, sulfate-containing prodrugs, peptide-containing prodrugs, D-amino acid-modified prodrugs, glycosylated prodrugs, ⁇ -lactam-containing prodrugs, optionally substituted phenoxyacetamide-containing prodrugs or optionally substituted phenylacetamide-containing prodrugs, 5-fluorocytosine and other 5- fluorouridine prodrugs which can be converted into the more active cytotoxic free drug.
  • cytotoxic drugs that can be derivatized into a prodrug form for use in this invention include, but are not limited to, those chemotherapeutic agents described above.
  • a "subject” is a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, farm animals (such as cows, and sheep), sport animals, pets (such as cats, dogs and horses), primates (e.g., humans and non-human primates such as monkeys (e.g., cynomolgus monkeys)), and rodents (e.g., mice and rats).
  • farm animals such as cows, and sheep
  • sport animals such as cats, dogs and horses
  • primates e.g., humans and non-human primates such as monkeys (e.g., cynomolgus monkeys)
  • rodents e.g., mice and rats.
  • administering is meant a method of giving a dosage of a compound (e.g., an anti-tryptase antibody of the invention or an additional therapeutic agent) or a composition (e.g., a pharmaceutical composition, e.g., a pharmaceutical composition including an anti-tryptase antibody of the invention, optionally also including an additional therapeutic agent, which may include an excipient such as an antioxidant (e.g., N-acetyltryptophan and/or methionine)) to a subject.
  • a compound e.g., an anti-tryptase antibody of the invention or an additional therapeutic agent
  • a composition e.g., a pharmaceutical composition, e.g., a pharmaceutical composition including an anti-tryptase antibody of the invention, optionally also including an additional therapeutic agent, which may include an excipient such as an antioxidant (e.g., N-acetyltryptophan and/or methionine)) to a subject.
  • compositions utilized in the methods described herein can be administered, for example, intravitreally, intramuscularly, intravenously, intradermal ⁇ , percutaneously, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrapleural ⁇ , intratracheally, intrathecally, intranasally, intravaginally, intrarectally, topically, intratumorally, peritoneally, subcutaneously, subconjunctivally, intravesicularly, mucosally, intrapericardially, intraumbilically, intraocularly, intraorbitally, orally, topically, transdermal ⁇ , periocularly, conjunctivally, subtenonly, intracamerally, subretinally, retrobulbarly, intracanalicularly, by inhalation, by injection, by implantation, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, by catheter, by lavage, in cremes, or in lipid compositions.
  • an “effective amount” or “therapeutically effective amount” of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
  • the therapeutically effective amount of the antibody or antibody fragment (e.g., an anti-tryptase antibody), or composition thereof may ameliorate or treat the disorder or disease, or prevent, reduce, ameliorate, or treat symptoms associated with the disorder or disease.
  • treatment refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
  • antibodies of the invention are used to delay development of a disease or to slow the progression of a disease.
  • a patient may be successfully "treated” for asthma if, for example, after receiving an asthma therapy, the patient shows observable and/or measurable reduction in or absence of one or more of the following: recurrent wheezing, coughing, trouble breathing, chest tightness, symptoms that occur or worsen at night, symptoms that are triggered by cold air, exercise or exposure to allergens.
  • IL-5 interleukin-5
  • mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • the term encompasses "full-length,” unprocessed IL-5, mature IL-5, as well as any form of IL-5 that results from post-translational modifications.
  • the term also encompasses naturally occurring variants of IL-5, such as splice variants or allelic variants.
  • the amino acid sequence of an exemplary IL-5 can be found, for example, under UniProtKB accession number P051 13.
  • IL-5 axis binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of IL-5 with one or more of its binding partners, such as IL-5 receptor, alpha (IL5RA).
  • IL-5 axis binding antagonists that can be used in the methods of the invention include, for example, IL-5 binding antagonists (e.g., anti-IL-5 antibodies (e.g., mepolizumab, benralizumab, and reslizumab) and IL-5 receptor binding antagonists (e.g., anti-IL-5R antibodies)).
  • IL-13 interleukin-13
  • IL-13 refers to any native IL-13 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • IL-13 is a cytokine secreted by many cell types, including T helper type 2 (Th2) cells.
  • Th2 T helper type 2
  • the term encompasses "full-length,” unprocessed IL-13, mature IL-13, as well as any form of IL-13 that results from post-translational modifications.
  • the amino acid sequence of an exemplary human IL-13 can be found, for example, under UniProtKB accession number P35225.
  • IL-13 axis binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of IL-13 with one or more of its binding partners, such as IL-4 receptor alpha (IL4Ra), IL-13 receptor alphal (IL13RA1) and IL-13 receptor alpha2 (IL13RA2).
  • IL-13 axis binding antagonists include IL-13 binding antagonists (e.g., anti-IL- 13 antibodies, for example, lebrikizumab, 228B/C-1 , 228A-4, 227-26, and 227-43 (see, for example, U.S. Pat. Nos.
  • IL-13 receptor binding antagonists e.g., an anti-IL4Ra antibody, an anti-IL13RA1 antibody, or an anti-IL13RA2 antibody.
  • interleukin-17 refers to any native IL-17 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated, and includes family members IL-17A, IL-17B, IL-17C, IL-17D, IL-17E, and IL-17F.
  • the term encompasses "full-length,” unprocessed IL-17, mature IL-17, as well as any form of IL-17 that results from post-translational modifications.
  • the amino acid sequence of an exemplary human IL-17A can be found, for example, under UniProtKB accession number Q16552.
  • the amino acid sequence of an exemplary human IL-17B can be found, for example, under UniProtKB accession number Q9UHF5.
  • the amino acid sequence of an exemplary human IL-17C can be found, for example, under UniProtKB accession number Q9P0M4.
  • the amino acid sequence of an exemplary human IL-17D can be found, for example, under UniProtKB accession number Q8TAD2.
  • the amino acid sequence of an exemplary human IL-17E can be found, for example, under UniProtKB accession number Q9H293.
  • the amino acid sequence of an exemplary human IL-17F can be found, for example, under UniProtKB accession number Q96PD4.
  • IL-17 axis binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of IL-17 with one or more of its binding partners, such as interleukin-17 receptor (IL-17R) family member proteins interleukin 17 receptor A (IL17RA), interleukin 17 receptor B (IL17RB), interleukin 17 receptor C (IL17RC), interleukin 17 receptor D (IL17RD), interleukin 17 receptor E (IL17RE), and interleukin 17 receptor E-like (IL17REL).
  • IL-17R interleukin-17 receptor family member proteins interleukin 17 receptor A (IL17RA), interleukin 17 receptor B (IL17RB), interleukin 17 receptor C (IL17RC), interleukin 17 receptor D (IL17RD), interleukin 17 receptor E (IL17RE), and interleukin 17 receptor E-like (IL17REL).
  • Exemplary IL-17 axis binding antagonists include, for example, IL-17 binding antagonists (e.g., anti-IL-17 antibodies (e.g., secukinumab (AIN417), ixekizumab (LY2439821), bimekizumab, and NI-1401) and IL-17 receptor binding antagonists (e.g., anti-IL-17R antibodies (e.g., brodalumab (AMG-827))).
  • IL-17 binding antagonists e.g., anti-IL-17 antibodies (e.g., secukinumab (AIN417), ixekizumab (LY2439821), bimekizumab, and NI-1401)
  • IL-17 receptor binding antagonists e.g., anti-IL-17R antibodies (e.g., brodalumab (AMG-827)). See, e.g., WO 2006/013107, WO 2007/070750, WO 2012/156219, and U.S.
  • IL-33 refers to any native IL-33 from any vertebrate source, including mammals such as primates (e.g., humans and cynomolgus monkeys) and rodents (e.g., mice and rats), unless otherwise indicated.
  • IL-33 is also referred to in the art as nuclear factor of high endothelial venules (NF-HEV; see, e.g., Baekkevold et al. Am. J. Pathol. 163(1): 69-79, 2003), DVS27, C9orf26, and interleukin-1 family member 1 (IL-1 F1 1).
  • NF-HEV nuclear factor of high endothelial venules
  • Human full-length, unprocessed IL-33 contains 270 amino acids (a. a.) and may also be referred to as IL-33i-27o.
  • Processed forms of human IL-33 include, for example, IL-3395-270, IL-33g9-27o, IL- 33io9-27o, IL-33i i2-27o, IL-33i-i78, and IL-33i 7 9-27o (Lefrancais et al. Proc. Natl. Acad. Sci.
  • processed forms of human IL-33 e.g., IL-3395-270, IL-33g9-27o, IL-33io9-27o, or other forms processed by proteases such as calpain, proteinase 3, neutrophil elastase, and cathepsin G may have increased biological activity compared to full-length IL-33.
  • proteases such as calpain, proteinase 3, neutrophil elastase, and cathepsin G
  • the term also encompasses naturally occurring variants of IL-33, for example, splice variants (e.g., the constitutively active splice variant splL-33 which lacks exon 3, Hong et al. J.
  • IL-33 may be present within a cell (e.g., within the nucleus) or as a secreted cytokine form.
  • Full-length IL-33 protein contains a helix-turn-helix DNA-binding motif including nuclear localization sequence (a.a.1 -75 of human IL-33), which includes a chromatin binding motif (a. a. 40-58 of human IL-33).
  • a.a. 40-58 of human IL-33 Forms of IL-33 that are processed and secreted lack these N-terminal motifs.
  • the amino acid sequence of an exemplary human IL-33 can be found, for example, under UniProtKB accession number 095760.
  • interleukin 1 receptor-like 1 and "ST2,” used interchangeably herein, refer to any native ST2 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • ST2 is also referred to in the art as DER4, T1 , and FIT-1 .
  • the term encompasses "full-length,” unprocessed ST2, mature ST2, as well as any form of ST2 that results from post-translational modifications.
  • ST2 At least four isoforms of ST2 are known in the art, including soluble (sST2, also known as IL1 RL1 -a) and transmembrane (ST2L, also known as IL1 RL1 -b), which arise from differential mRNA expression from a dual promoter system, and ST2V and ST2LV, which arise from alternative splicing, as described below.
  • the domain structure of ST2L includes three extracellular immunoglobulin-like C2 domains, a transmembrane domain, and a cytoplasmic
  • Toll/lnterleukin-1 receptor (TIR) domain Toll/lnterleukin-1 receptor (TIR) domain.
  • sST2 lacks the transmembrane and cytoplasmic domains contained within ST2L and includes a unique 9 amino acid (a. a.) C-terminal sequence (see, e.g., Kakkar et al. Nat. Rev. Drug Disc. 7: 827-840, 2008).
  • sST2 can function as a decoy receptor to inhibit soluble IL- 33.
  • the term also encompasses naturally occurring variants of ST2, e.g., splice variants (e.g., ST2V, which lacks the third immunoglobulin motif and has a unique hydrophobic tail, and ST2LV, which lacks the transmembrane domain of ST2L) or allelic variants (e.g., variants that are protective against asthma risk or that confer asthma risk as described herein).
  • ST2V splice variants
  • ST2LV which lacks the transmembrane domain of ST2L
  • allelic variants e.g., variants that are protective against asthma risk or that confer asthma risk as described herein.
  • the amino acid sequence of an exemplary human ST2 can be found, for example, under UniProtKB accession number Q01638. ST2 is a part of the IL-33 receptor along with the co-receptor protein IL-1 RAcP.
  • IL-1 RAcP co-receptor interleukin-1 receptor accessory protein
  • IL-33 axis is meant a nucleic acid (e.g., a gene or mRNA transcribed from the gene) or polypeptide that is involved in IL-33 signal transduction.
  • the IL-33 axis may include the ligand IL-33, a receptor (e.g., ST2 and/or IL-1 RAcP), adaptor molecules (e.g., MyD88), or proteins that associate with receptor molecules and/or adaptor molecules (e.g., kinases, such as interleukin-1 receptor-associated kinase 1 (IRAKI) and interleukin-1 receptor-associated kinase 4 (IRAK4), or E3 ubiquitin ligases, such as TNF receptor associated factor 6 (TRAF6)).
  • a receptor e.g., ST2 and/or IL-1 RAcP
  • adaptor molecules e.g., MyD88
  • proteins that associate with receptor molecules and/or adaptor molecules e.g., kin
  • an "IL-33 axis binding antagonist” refers to a molecule that inhibits the interaction of an IL-33 axis binding partner with one or more of its binding partners.
  • an IL-33 axis binding antagonist includes IL-33 binding antagonists, ST2 binding antagonists, and ILI RAcP binding antagonists.
  • Exemplary IL-33 axis binding antagonists include anti-IL-33 antibodies and antigen-binding fragments thereof (e.g., anti-IL-33 antibodies such as ANB-020 (AnaptysBio, Inc.) or any of the antibodies described in EP1725261 , US8187596, WO201 1031600, WO2014164959, WO2015099175 or WO2015106080, which are each incorporated herein by reference in their entirety); polypeptides that bind IL-33 and/or its receptor (ST2 and/or IL-1 RAcP) and block ligand-receptor interaction (e.g., ST2-Fc proteins, such as those described in WO 2014/152195, which is herein incorporated by reference in its entirety;
  • anti-IL-33 antibodies such as ANB-020 (AnaptysBio, Inc.) or any of the antibodies described in EP1725261 , US8187596, WO201 1031600, WO2014164959, WO2015
  • anti-IL-33 receptor antibodies e.g., anti-ST2 antibodies, for example, AMG-282 (Amgen) or STLM15 (Janssen) or any of the anti-ST2 antibodies described in WO 2013/173761 and WO 2013/165894, which are each incorporated herein by reference in their entirety; or ST2-Fc proteins, such as those described in WO 2013/173761 ; WO 2013/165894; or WO 2014/152195, which are each incorporated herein by reference in their entirety) ; and IL-33 receptor antagonists, such as small molecule inhibitors, aptamers that bind IL-33, and nucleic acids that hybridize under stringent conditions to IL-33 axis nucleic acid sequences (e.g., short interfering RNAs (siRNA) or clustered regularly interspaced short palindromic repeat RNAs (CRISPR-RNA or crRNA), including single guide
  • anti-IL-33 antibody an “antibody that binds to IL-33,” and “antibody that specifically binds IL-33” refer to an antibody that is capable of binding IL-33 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting IL-33.
  • the extent of binding of an anti- IL-33 antibody to an unrelated, non-IL-33 protein is less than about 10% of the binding of the antibody to IL-33 as measured, e.g., by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an antibody that binds to IL-33 has a dissociation constant (KD) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 8 M or less, e.g., from 10 8 M to 10 3 M, e.g., from 10 9 M to 10 3 M).
  • KD dissociation constant
  • an anti- IL-33 antibody binds to an epitope of IL-33 that is conserved among IL-33 from different species.
  • ST2 binding antagonist refers to a molecule that inhibits the interaction of an ST2 with IL-33, ILI RAcP, and/or a second ST2 molecule.
  • the ST2 binding antagonist may be a protein, such as an "ST2-Fc protein” that includes an IL-33-binding domain (e.g., all or a portion of an ST2 or ILI RAcP protein) and a multimerizing domain (e.g., an Fc portion of an immunoglobulin, e.g., an Fc domain of an IgG selected from the isotypes lgG1 , lgG2, lgG3, and lgG4, as well as any allotype within each isotype group), which are attached to one another either directly or indirectly through a linker (e.g., a serine- glycine (SG) linker, glycine-glycine (GG) linker, or variant thereof (e.g., a SGG, a GGS
  • a ST2 binding antagonist may be an anti-ST2 antibody, for example, AMG-282 (Amgen) or STLM15 (Janssen) or any of the anti-ST2 antibodies described in WO 2013/173761 and WO 2013/165894.
  • isolated nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment.
  • An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
  • control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
  • the control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
  • Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers.
  • the terms "host cell,” “host cell line,” and “host cell culture” are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
  • Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
  • Nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence.
  • DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
  • a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or
  • a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • "operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
  • Percent (%) amino acid sequence identity with respect to the polypeptide sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared.
  • % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
  • the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
  • the ALIGN-2 program is publicly available through Genentech, Inc., South San Francisco, California.
  • the ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
  • % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
  • amino acid sequences described herein are contiguous amino acid sequences unless otherwise specified.
  • vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
  • vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked.
  • recombinant expression vectors Such vectors are referred to herein as “recombinant expression vectors” (or simply, “recombinant vectors” or “expression vectors”).
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • plasmid and “vector” may be used interchangeably.
  • the invention is based, in part, on novel antibodies that bind to tryptase.
  • the invention is based, in part, on the discovery that particular residues (e.g., HVR residues, such as HVR-H3 W100, which refers to W100 of the VH domain of the anti-tryptase antibody hu31A.v1 1 ) of anti-tryptase antibodies may be susceptible to oxidation.
  • the invention provides pharmaceutical compositions that include antioxidants (e.g., N-acetyltryptophan and/or methionine) to reduce or prevent oxidation of antibodies described herein (e.g., anti-tryptase antibodies).
  • antioxidant excipients include, without limitation, free tryptophan, cyclodextrins, Trolox (6-hydroxy-2, 5,7,8- tetramethylchroman-2-carboxylic acid), pyridoxine, polyols (e.g., mannitol), and metal chelators (e.g., EDTA). See, e.g., Ji et al., Biotechnology 98:4485-4500, 2009.
  • Antibodies and pharmaceutical compositions of the invention are useful, e.g., for the diagnosis and/or treatment of disorders (e.g., a pulmonary disorder, an autoimmune disorder, an inflammatory disorder, a fibrotic disorder, a granulocytic (neutrophilic or eosinophilic) disorder, a monocytic disorder, a lymphocytic disorder, a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia, or a tryptase-associated disorder or a tryptase-mediated disorder.
  • the invention provides lyophilized pharmaceutical compositions to reduce or eliminate oxidation of antibodies described herein (e.g., anti-tryptase antibodies).
  • an anti- tryptase antibody of the invention binds to tryptase with a KD of about 100 nM or lower (e.g., 100 nM or lower, 10 nM or lower, 1 nM or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • the antibody binds tryptase with a KD of 10 nM or lower (e.g., 10 nM or lower, 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • the antibody binds tryptase with a KD of 1 nM or lower (e.g., 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower). In some embodiments, the antibody binds tryptase with a KD of 0.5 nM or lower (e.g., 0.5 nm or lower, 400 pM or lower, 300 pM or lower, 200 pM or lower, 100 pM or lower, 50 pM or lower, 25 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • a KD of 1 nM or lower e.g., 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower.
  • the antibody binds tryptase with a KD between about 0.1 nM to about 0.5 nM (e.g., about 0.1 nM, about 0.2 nM, about 0.3 nM, about 0.4 nM, or about 0.5 nM).
  • the antibody binds tryptase with a KD between about 1 pM to about 500 pM, about 1 pM to about 400 pM, about 1 pM to about 300 pM, about 1 pM to about 200 pM, about 1 pM to about 100 pM, about 1 pM to about 50 pM, about 25 pM to about 500 pM, about 25 pM to about 400 pM, about 25 pM to about 300 pM, about 25 pM to about 100 pM, about 50 pM to about 500 pM, about 50 pM to about 450 pM, about 50 pM to about 425 pM, about 50 pM to about 400 pM, about 50 pM to about 375 pM, about 50 pM to about 350 pM, about 50 pM to about 325 pM, about 50 pM to about 300 pM, about 50 pM to about 275 pM,
  • the antibody binds tryptase with a KD of about 0.4 nM. In some embodiments, the antibody binds tryptase with a KD of about 0.2 nM. In some embodiments, the antibody binds tryptase with a KD of about 0.18 nM. In some embodiments, the tryptase is human tryptase, for example, human tryptase beta (e.g., human tryptase beta 1 , human tryptase beta 2, and/or human tryptase beta 3). In some embodiments, the KD is determined in a BIACORE® SPR assay. In certain embodiments, the tryptase is human tryptase alpha. In certain embodiments, the antibody is a human or humanized antibody.
  • an anti-tryptase antibody of the invention is capable of inhibiting an activity of tryptase.
  • an anti-tryptase antibody of the invention is capable of inhibiting a proteolytic activity of tryptase, for example, as determined in an in vitro tryptase enzymatic assay.
  • an artificial substrate for example, the synthetic peptide S-2288 can be used as a substrate in an in vitro tryptase enzymatic assay.
  • an anti-tryptase antibody of the invention is capable of inhibiting the activity of human tryptase with a half-maximal inhibitory concentration (IC50) of about 100 nM or lower (e.g., 100 nM or lower, 10 nM or lower, 5 nM or lower, 2.5 nM or lower, 1 nM or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower) as determined by an in vitro tryptase enzymatic assay, for example, using S-2288 as a substrate.
  • IC50 half-maximal inhibitory concentration
  • the antibody is capable of inhibiting the activity of human tryptase with an IC50 of about 10 nM or lower (e.g., 10 nM or lower, 5 nM or lower, 2.5 nM or lower, 1 nM or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower) as determined by an in vitro tryptase enzymatic assay, for example, using S-2288 as a substrate.
  • an IC50 of about 10 nM or lower (e.g., 10 nM or lower, 5 nM or lower, 2.5 nM or lower, 1 nM or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower) as determined by an in vitro tryptase enzymatic assay, for example, using S-2288 as a substrate.
  • the antibody is capable of inhibiting the activity of human tryptase with an IC50 of about 2.5 nM or lower (e.g., 2.5 nM or lower, 1 nM or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower) as determined by an in vitro tryptase enzymatic assay, for example, using S-2288 as a substrate.
  • an IC50 of about 2.5 nM or lower (e.g., 2.5 nM or lower, 1 nM or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower) as determined by an in vitro tryptase enzymatic assay, for example, using S-2288 as a substrate.
  • the antibody is capable of inhibiting the activity of human tryptase with an IC50 of about 0.1 nM to about 2 nM (e.g., about 0.1 nM, about 0.2 nM, about 0.3 nM, about 0.4 nM, about 0.5 nM, about 0.6 nM, about 0.7 nM, about 0.8 nM, about 0.9 nM, about 1 .0 nM, about 1 .1 nM, about 1 .2 nM, about 1 .3 nM, about 1 .4 nM, about 1 .5 nM, about 1 .6 nM, about 1 .7 nM, about 1 .8 nM, about 1 .9 nM, or about 2.0 nM).
  • an IC50 of about 0.1 nM to about 2 nM (e.g., about 0.1 nM, about 0.2 nM, about 0.3 nM, about 0.4 nM,
  • the antibody is capable of inhibiting the activity of human tryptase with an IC50 of about 0.5 nM to about 2.5 nM (e.g., about 0.5 nM, about 0.6 nM, about 0.7 nM, about 0.8 nM, about 0.9 nM, about 1 .0 nM, about 1 .1 nM, about 1.2 nM, about 1 .3 nM, about 1 .4 nM, about 1 .5 nM, about 1 .6 nM, about 1 .7 nM, about 1 .8 nM, about 1.9 nM, about 2.0 nM, about 2.1 nM, about 2.2 nM, about 2.3 nM, about 2.4 nM, or about 2.5 nM).
  • an IC50 of about 0.5 nM to about 2.5 nM (e.g., about 0.5 nM, about 0.6 nM, about 0.7 nM, about 0.8 n
  • the antibody is capable of inhibiting the activity of human tryptase with an IC50 of about 1 pM to about 2.5 nM, about 25 pM to about 2.5 nM, about 50 pM to about 2.5 nM, about 75 pM to about 2.5 nM, about 100 pM to about 2.5 nM, about 125 pM to about 2.5 nM, about 150 pM to about 2.5 nM, about 175 pM to about 2.5 nM, about 200 pM to about 2.5 nM, about 225 pM to about 2.5 nM, about 250 pM to about 2.5 nM, about 300 pM to about 2.5 nM, about 325 pM to about 2.5 nM, about 325 pM to about 2.5 nM, about 350 pM to about 2.5 nM, about 375 pM to about 2.5 nM, about 400 pM to about 2.5 nM, about 425 pM to about 2.5 nM, about 450
  • the antibody is capable of inhibiting the activity of human tryptase with an IC50 of about 1.8 nM. In other embodiments, the antibody is capable of inhibiting the activity of human tryptase with an IC50 of about 0.5 nM to about 1 nM (e.g., about 0.5 nM , about 0.6 nM, about 0.7 nM, about 0.8 nM, about 0.9 nM, or about 1 .0 nM).
  • the antibody is capable of inhibiting the activity of human tryptase with an IC50 of about 1 pM to about 1 nM, about 25 pM to about 1 nM, about 50 pM to about 1 nM, about 75 pM to about 1 nM, about 100 pM to about 1 nM, about 125 pM to about 1 nM, about 150 pM to about 1 nM, about 175 pM to about 1 nM, about 200 pM to about 1 nM, about 225 pM to about 1 nM, about 250 pM to about 1 nM, about 300 pM to about 1 nM, about 325 pM to about 1 nM, about 350 pM to about 1 nM, about 375 pM to about 1 nM, about 400 pM to about 1 nM, about 425 pM to about 1 nM, about 450 pM to about 1 nM, about 500 pM to about 1
  • the antibody is capable of inhibiting the activity of human tryptase with an IC50 of about 0.6 nM.
  • the tryptase is human tryptase, for example, human tryptase beta (e.g., human tryptase beta 1 , human tryptase beta 2, and/or human tryptase beta 3).
  • the inhibitory activity of the antibody is determined described herein, for example, in the Examples (e.g., Example 1 , particularly Section (A)(viii)(a)), or by other approaches known in the art.
  • the antibody is a human or a humanized antibody.
  • the antibody is capable of inhibiting the activity of human tryptase as a monovalent antibody or antigen-binding antibody fragment thereof (e.g., an Fab).
  • the antibody is capable of inhibiting the activity of human tryptase as a bivalent antibody (e.g., an IgG antibody (e.g., an lgG1 or lgG4 antibody) or an F(ab')2).
  • any of the anti-tryptase antibodies described herein can inhibit tryptase- stimulated contraction of human primary airway smooth muscle cells.
  • any of the anti- tryptase antibodies described herein can inhibit tryptase-stimulated contraction of human primary airway smooth muscle cells. In yet other instances, any of the anti-tryptase antibodies described herein can inhibit tryptase or IgE-stimulated mast cell degranulation and/or histamine release. In further instances, any of the anti-tryptase antibodies described herein can reduce the amount of active tryptase (e.g., in a sample such as bronchoalveolar lavage fluid or a nasosorption sample), for example, upon administration to a subject.
  • a sample such as bronchoalveolar lavage fluid or a nasosorption sample
  • any of the anti-tryptase antibodies described herein can reduce the amount of active tryptase by about 1 %, about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 75%, about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or more.
  • the reduction may be relative to a reference amount of active tryptase, for example, the amount of active tryptase in a sample prior to administration of the anti-tryptase antibody.
  • the antibody may include at least one, two, three, four, five, or six hypervariable regions (HVRs) selected from: (a) an HVR-H1 comprising the amino acid sequence of X1X2GMX3 (SEQ ID NO: 1), wherein Xi is Asp or Ser, X2 is Tyr or Phe, and X3 is Val or His; (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RX1X2X3DWYFDV (SEQ ID NO: 3), wherein Xi is Asn or Asp, X2 is Tyr or Asn, and X3 is Asp or Tyr; (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e)
  • the antibody may include at least one, two, three, four, five, or six hypervariable regions (HVRs) selected from: (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RNYDDWYFDV (SEQ ID NO: 8); (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6), or a combination of one or more of the above HVRs and one or more
  • HVRs hypervariable regions
  • the antibody may include (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR- H3 comprising the amino acid sequence of RNYDDWYFDV (SEQ ID NO: 8); (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6).
  • the antibody e.g., the anti-tryptase antibody
  • the antibody includes (a) a heavy chain variable (VH) domain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of SEQ ID NO: 9; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90% identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of SEQ ID NO: 10; or (c) a VH domain as in (a) and a VL domain as in (b).
  • VH heavy chain variable
  • VL light chain variable domain comprising an amino acid sequence having at least 90% identity to (e.g., at least 91 %, 92%
  • the antibody e.g., the anti-tryptase antibody
  • the antibody includes one, two, three, or four of the following heavy chain framework regions (FRs): (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 1 1); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 12); (c) an FR-H3 comprising the amino acid sequence of RFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 13); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 14).
  • FRs heavy chain framework regions
  • the antibody includes one, two, three, or four of the following light chain FRs: (a) an FR-L1 comprising the amino acid sequence of DIQIvlTQSPSSLSASVGDRVTlTC (SEQ ID NO: 15); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKPWIY (SEQ ID NO: 16); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 17); and (d) an FR-L4 comprising the amino acid sequence of FGQGTKVEIK (SEQ ID NO: 18).
  • FR-L1 comprising the amino acid sequence of DIQIvlTQSPSSLSASVGDRVTlTC
  • FR-L2 comprising the amino acid sequence of WYQQKPGKSPKPWIY
  • FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQP
  • the antibody e.g., the anti-tryptase antibody
  • the antibody includes a VH domain comprising the amino acid sequence of SEQ ID NO: 9 and a VL domain comprising the amino acid sequence of SEQ ID NO: 10, such as the antibody hu31A.v1 1 .
  • the antibody may include (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RDNYDWYFDV (SEQ ID NO: 29); (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6).
  • the antibody e.g., the anti-tryptase antibody
  • the antibody includes (a) a heavy chain variable (VH) domain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of SEQ ID NO: 19; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90% identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of SEQ ID NO: 20; or (c) a VH domain as in (a) and a VL domain as in (b).
  • VH heavy chain variable
  • VL light chain variable domain comprising an amino acid sequence having at least 90% identity to (e.g., at least 91 %, 92%
  • the antibody e.g., the anti-tryptase antibody
  • the antibody includes one, two, three, or four of the following heavy chain framework regions (FRs): (a) an FR-H1 comprising the amino acid sequence of EVKLVESGGGSVQPGGSRKLSCAASGFTFS (SEQ ID NO: 21); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 22); (c) an FR-H3 comprising the amino acid sequence of RFTISRDNPKNTLFLQMSSLRSEDTAMYYCAR (SEQ ID NO: 23); and (d) an FR-H4 comprising the amino acid sequence of WGTGTTVTVSS (SEQ ID NO: 24).
  • FRs heavy chain framework regions
  • the antibody e.g., the anti-tryptase antibody
  • the antibody includes one, two, three, or four of the following light chain FRs: (a) an FR-L1 comprising the amino acid sequence of QIVLTQSPAIMSASPGEKVTISC (SEQ ID NO: 25) ; (b) an FR-L2 comprising the amino acid sequence of WYQQKPGSSPKPWIY (SEQ ID NO: 26); (c) an FR-L3 comprising the amino acid sequence of GVPARFSGSGSGTSYSLTISSMEAEDAATYYC (SEQ ID NO: 27); and (d) an FR-L4 comprising the amino acid sequence of FGAGTKLELK (SEQ ID NO: 28).
  • the antibody (e.g., the anti-tryptase antibody) includes a VH domain comprising the amino acid sequence of SEQ ID NO: 19 and a VL domain comprising the amino acid sequence of SEQ ID NO: 20, such as the antibody 31 a.
  • the antibody e.g., the anti-tryptase antibody
  • the antibody includes (a) a heavy chain variable (VH) domain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of any one of SEQ ID NOs: 9, 101 , 102, 103, and 104; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90% identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of any one of SEQ ID NOs: 10, 105, and 106; or (c) a VH domain as in (a) and a VL domain as in (b).
  • VH heavy chain variable
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 98 and a VL domain comprising the amino acid sequence of SEQ ID NO: 102.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 98 and a VL domain comprising the amino acid sequence of SEQ ID NO: 10.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 98 and a VL domain comprising the amino acid sequence of SEQ ID NO: 103.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 99 and a VL domain comprising the amino acid sequence of SEQ ID NO: 102.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 99 and a VL domain comprising the amino acid sequence of SEQ ID NO: 10. In other instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 99 and a VL domain comprising the amino acid sequence of SEQ ID NO: 103. In other instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 100 and a VL domain comprising the amino acid sequence of SEQ ID NO: 102. In other instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 100 and a VL domain comprising the amino acid sequence of SEQ ID NO: 10.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 100 and a VL domain comprising the amino acid sequence of SEQ ID NO: 103. In other instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 9 and a VL domain comprising the amino acid sequence of SEQ ID NO: 102. In other instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 9 and a VL domain comprising the amino acid sequence of SEQ ID NO: 10. In other instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 9 and a VL domain comprising the amino acid sequence of SEQ ID NO: 103.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 101 and a VL domain comprising the amino acid sequence of SEQ ID NO: 102. In other instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 101 and a VL domain comprising the amino acid sequence of SEQ ID NO: 10. In other instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 101 and a VL domain comprising the amino acid sequence of SEQ ID NO: 103.
  • any of the preceding antibodies binds to an epitope on human tryptase beta 1 comprising at least one, at least two, at least three, or all four residues selected from the group consisting of His51 , Val80, Lys81 , and Asp82 of SEQ ID NO: 71 .
  • the antibody binds to an epitope on human tryptase beta 1 comprising at least one, at least two, at least three, or all four residues selected from the group consisting of His51 , Val80, Lys81 , and Asp82 of SEQ ID NO: 71 .
  • the antibody binds to an epitope on human tryptase beta 1 comprising His51 and at least one, at least two, or all three residues selected from the group consisting of Val 80, Lys81 , and Asp82 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 further comprises one or more amino acid residues selected from the group consisting of Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or all twelve amino acid residues selected from the group consisting of Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 comprises His51 , Gln67, Val80, Lys81 , Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO:71 .
  • the epitope is relative to a human tryptase beta 1 monomer or tetramer.
  • the epitope is determined by an X-ray crystallography model.
  • the antibody is capable of dissociating both the small interface of tetrameric human tryptase beta 1 and the large interface of tetrameric human tryptase beta 1 .
  • any of the preceding anti-tryptase antibodies includes a paratope that binds tryptase (e.g., human tryptase beta 1) that includes one or more amino acid residues (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, or 19 amino acid residues) selected from the group consisting of light chain variable region amino acid residues Val30; Thr31 ; Tyr32; Tyr34; Arg50; Tyr90; His92; Ser93; and Tyr94 and the heavy chain variable region amino acid residues Phe50; Ser52; Gly53; Ser54; Ser55; Thr56; Tyr58; Arg95; Tyr97; and Asp98.
  • tryptase e.g., human tryptase beta 1
  • amino acid residues e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, or 19 amino acid residues
  • the anti-tryptase antibody includes a paratope that binds tryptase (e.g., human tryptase beta 1) that includes light chain variable region amino acid residues Val30, Thr31 , Tyr32, Tyr34, Arg50, Tyr90, His92, Ser93, and Tyr94 or the heavy chain variable region amino acid residues Phe50, Ser52, Gly53, Ser54, Ser55, Thr56, Tyr58, Arg95, Tyr97, and Asp98.
  • tryptase e.g., human tryptase beta 1
  • the anti-tryptase antibody includes a paratope that binds tryptase (e.g., human tryptase beta 1) that includes light chain variable region amino acid residues Val30, Thr31 , Tyr32, Tyr34, Arg50, Tyr90, His92, Ser93, and Tyr94 and the heavy chain variable region amino acid residues Phe50, Ser52, Gly53, Ser54, Ser55, Thr56, Tyr58, Arg95, Tyr97, and Asp98.
  • tryptase e.g., human tryptase beta 1
  • the antibody may include at least one, two, three, four, five, or six hypervariable regions (HVRs) selected from: (a) an HVR-H1 comprising the amino acid sequence of GYAIT (SEQ ID NO: 30); (b) an HVR-H2 comprising the amino acid sequence of GISSAATTFYSSWAKS (SEQ ID NO: 31); (c) an HVR-H3 comprising the amino acid sequence of DPRGYGAALDRLDL (SEQ ID NO: 32); (d) an HVR-L1 comprising the amino acid sequence of
  • QSIKSVYNNRLG (SEQ ID NO: 33); (e) an HVR-L2 comprising the amino acid sequence of ETSILTS (SEQ ID NO: 34); and (f) an HVR-L3 comprising the amino acid sequence of AGGFDRSGDTT (SEQ ID NO: 35), or a combination of one or more of the above HVRs and one or more variants thereof having at least about 80% sequence identity (e.g., 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 30-35.
  • 80% sequence identity e.g., 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • the antibody e.g., the anti-tryptase antibody
  • the antibody includes (a) a heavy chain variable (VH) domain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of any one of SEQ ID NOs: 36, 47, 48, 49, 50, 51 , and 52; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90% identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of any one of SEQ ID NO: 37, 53, 58, or 59; or (c) a VH domain as in (a) and a VL domain as in (b).
  • VH heavy chain variable
  • any of the preceding antibodies may include one, two, three, or four of the following heavy chain framework regions (FRs): (a) an FR-H1 comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of
  • EVQLVESGPGLVKPSETLSLTCTVSRFSLI (SEQ ID NO: 38); (b) an FR-H2 comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of WXiRQPPGKGLEWIG (SEQ ID NO: 39), wherein Xi is lie or Val; (c) an FR-H3 comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of
  • RX1TISX2DTSKNQX3SLKLSSVTAADTAVYX4CAR (SEQ ID NO: 40), wherein Xi is Val or Ser, X 2 is Arg or Val, X3 is Val or Phe, and X4 is Tyr or Phe; and (d) an FR-H4 comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 41).
  • any of the preceding antibodies may include one, two, three, or four of the following heavy chain FRs: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGPGLVKPSETLSLTCTVSRFSLI (SEQ ID NO: 38); (b) an FR-H2 comprising the amino acid sequence of WIRQPPGKGLEWIG (SEQ ID NO: 42); (c) an FR-H3 comprising the amino acid sequence of RVTISRDTSKNQVSLKLSSVTAADTAVYYCAR (SEQ ID NO: 43); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 41).
  • any of the preceding antibodies may include one, two, three, or four of the following heavy chain FRs: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAVSRFSLI (SEQ ID NO: 44); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIG (SEQ ID NO: 45); (c) an FR- H3 comprising the amino acid sequence of RSTISRDTSKNTVYLQMNSLRAEDTAVYFCAR (SEQ ID NO: 46); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 41).
  • any of the preceding antibodies may include one, two, three, or four of the following heavy chain FRs: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAVSRFSLI (SEQ ID NO: 44); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIG (SEQ ID NO: 45); (c) an FR- H3 comprising the amino acid sequence of RSTISRDTSKNTVYLQMNSLRAEDTAVYFCAR (SEQ ID NO: 46); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 41).
  • any of the preceding antibodies may include one, two, three, or four of the following light chain FRs: (a) an FR-L1 comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of
  • DX1QX2TQSPSSLSASVGDRVTITC (SEQ ID NO: 60), wherein Xi is lie or Ala, and X 2 is Met or Leu; (b) an FR-L2 comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of WYQQKPGKX1PKLLIY (SEQ ID NO: 61), wherein Xi is Ala or Pro; (c) an FR-L3 comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of
  • VPSRFSGSGSX1TDFTLTISSLQPEDFATYX2C (SEQ ID NO: 62), wherein Xi is Gly or Glu, and X 2 is Tyr or Phe; and (d) an FR-L4 comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of FGQGTKVEIK (SEQ ID NO: 63).
  • any of the preceding antibodies may include one, two, three, or four of the following light chain FRs: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 64); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKLLIY (SEQ ID NO: 65); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 66); and (d) an FR-L4 comprising the amino acid sequence of FGQGTKVEIK (SEQ ID NO: 63).
  • any of the preceding antibodies may include one, two, three, or four of the following light chain FRs: (a) an FR-L1 comprising the amino acid sequence of AAVLTQTPASVSAAVGGTVSISC (SEQ ID NO: 67); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGQPPKLLIY (SEQ ID NO: 68); (c) an FR-L3 comprising the amino acid sequence of GVPSRFKGSGSETQFTLTISDVQX1 DDAATYFC (SEQ ID NO: 69), wherein Xi is Cys or Ala; and (d) an FR-L4 comprising the amino acid sequence of FGQGTKVEIK FGGGTEVVVK (SEQ ID NO: 70).
  • the antibody e.g., the anti-tryptase antibody
  • the antibody includes (a) a heavy chain variable (VH) domain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of any one of SEQ ID NOs: 36, 47, 48, 49, 50, 51 , and 52; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90% identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of any one of SEQ ID NO: 37, 53, 58, and 59; or (c) a VH domain as in (a) and a VL domain as in (b).
  • VH heavy chain variable
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 36 and a VL domain comprising the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 47 and a VL domain comprising the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 48 and a VL domain comprising the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 49 and a VL domain comprising the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 50 and a VL domain comprising the amino acid sequence of SEQ ID NO: 37. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 50 and a VL domain comprising the amino acid sequence of SEQ ID NO: 37. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 51 and a VL domain comprising the amino acid sequence of SEQ ID NO: 37. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 52 and a VL domain comprising the amino acid sequence of SEQ ID NO: 37.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 36 and a VL domain comprising the amino acid sequence of SEQ ID NO: 53. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 47 and a VL domain comprising the amino acid sequence of SEQ ID NO: 53. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 48 and a VL domain comprising the amino acid sequence of SEQ ID NO: 53. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 49 and a VL domain comprising the amino acid sequence of SEQ ID NO: 53.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 50 and a VL domain comprising the amino acid sequence of SEQ ID NO: 53. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 51 and a VL domain comprising the amino acid sequence of SEQ ID NO: 53. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 52 and a VL domain comprising the amino acid sequence of SEQ ID NO: 53. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 36 and a VL domain comprising the amino acid sequence of SEQ ID NO: 58.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 47 and a VL domain comprising the amino acid sequence of SEQ ID NO: 58. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 48 and a VL domain comprising the amino acid sequence of SEQ ID NO: 58. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 49 and a VL domain comprising the amino acid sequence of SEQ ID NO: 58. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 50 and a VL domain comprising the amino acid sequence of SEQ ID NO: 58.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 51 and a VL domain comprising the amino acid sequence of SEQ ID NO: 58. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 36 and a VL domain comprising the amino acid sequence of SEQ ID NO: 59. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 47 and a VL domain comprising the amino acid sequence of SEQ ID NO: 59. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 48 and a VL domain comprising the amino acid sequence of SEQ ID NO: 59.
  • the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 49 and a VL domain comprising the amino acid sequence of SEQ ID NO: 59. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 50 and a VL domain comprising the amino acid sequence of SEQ ID NO: 59. In some instances, the antibody comprises a VH domain comprising the amino acid sequence of SEQ ID NO: 51 and a VL domain comprising the amino acid sequence of SEQ ID NO: 59.
  • the anti-tryptase antibody may include (a) an HVR-H1 comprising the amino acid sequence of GYAIT (SEQ ID NO: 30); (b) an HVR-H2 comprising the amino acid sequence of GISSAATTFYSSWAKS (SEQ ID NO: 31); (c) an HVR-H3 comprising the amino acid sequence of DPRGYGAALDRLDL (SEQ ID NO: 32); (d) an HVR-L1 comprising the amino acid sequence of QSIKSVYNNRLG (SEQ ID NO: 33); (e) an HVR-L2 comprising the amino acid sequence of ETSILTS (SEQ ID NO: 34); and (f) an HVR-L3 comprising the amino acid sequence of AGGFDRSGDTT (SEQ ID NO: 35).
  • the anti-tryptase antibody includes (a) a heavy chain variable (VH) domain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of SEQ ID NO: 36; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90% identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of SEQ ID NO: 37; or (c) a VH domain as in (a) and a VL domain as in (b).
  • VH heavy chain variable
  • VL light chain variable domain comprising an amino acid sequence having at least 90% identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%
  • the anti- tryptase antibody includes one, two, three, or four of the following heavy chain framework regions (FRs): (a) an FR-H1 comprising the amino acid sequence of EVQLVESGPGLVKPSETLSLTCTVSRFSLI (SEQ ID NO: 38); (b) an FR-H2 comprising the amino acid sequence of WIRQPPGKGLEWIG (SEQ ID NO: 42); (c) an FR-H3 comprising the amino acid sequence of RVTISRDTSKNQVSLKLSSVTAADTAVYYCAR (SEQ ID NO: 43); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 41).
  • the anti-tryptase antibody includes one, two, three, or four of the following light chain FRs: (a) an FR-L1 comprising the amino acid sequence of
  • DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 64); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKLLIY (SEQ ID NO: 65); (c) an FR-L3 comprising the amino acid sequence of
  • the anti-tryptase antibody includes a VH domain comprising the amino acid sequence of SEQ ID NO: 36 and a VL domain comprising the amino acid sequence of SEQ ID NO: 37, such as the anti-tryptase antibody huE104.v2.
  • the antibody may include (a) an HVR-H1 comprising the amino acid sequence of GYAIT (SEQ ID NO: 30); (b) an HVR-H2 comprising the amino acid sequence of GISSAATTFYSSWAKS (SEQ ID NO: 31); (c) an HVR-H3 comprising the amino acid sequence of DPRGYGAALDRLDL (SEQ ID NO: 32); (d) an HVR-L1 comprising the amino acid sequence of QSIKSVYNNRLG (SEQ ID NO: 33); (e) an HVR-L2 comprising the amino acid sequence of ETSILTS (SEQ ID NO: 34); and (f) an HVR-L3 comprising the amino acid sequence of AGGFDRSGDTT (SEQ ID NO: 35).
  • the antibody e.g., the anti- tryptase antibody
  • the antibody includes (a) a heavy chain variable (VH) domain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of SEQ ID NO: 52; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90% identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of SEQ ID NO: 53; or (c) a VH domain as in (a) and a VL domain as in (b).
  • VH heavy chain variable
  • VL light chain variable domain comprising an amino acid sequence having at least 90% identity to (e.g., at least 91 %, 92%
  • the antibody includes one, two, three, or four of the following heavy chain framework regions (FRs): (a) an FR-H1 comprising the amino acid sequence of QXSLEESGGGLFKPTDTLTLTCTVSRFSLI (SEQ ID NO: 54); (b) an FR-H2 comprising the amino acid sequence of WVRQSPENGLEWIG (SEQ ID NO: 55); (c) an FR-H3 comprising the amino acid sequence of RSTITRNTNENTVTLKMTSLTAADTATYFCAR (SEQ ID NO: 56); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 57).
  • FRs heavy chain framework regions
  • the antibody includes one, two, three, or four of the following light chain FRs: (a) an FR-L1 comprising the amino acid sequence of AAVLTQTPASVSAAVGGTVSISC (SEQ ID NO: 67); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGQPPKLLIY (SEQ ID NO: 68); (c) an FR-L3 comprising the amino acid sequence of GVPSRFKGSGSETQFTLTISDVQXiDDAATYFC (SEQ ID NO: 69), wherein Xi is Cys or Ala; and (d) an FR-L4 comprising the amino acid sequence of
  • the antibody (e.g., the anti- tryptase antibody) includes a VH domain comprising the amino acid sequence of SEQ ID NO: 52 and a VL domain comprising the amino acid sequence of SEQ ID NO: 53, such as the antibody E104.
  • the antibody (e.g., the anti-tryptase antibody) includes a VH domain comprising the amino acid sequence of SEQ ID NO: 52 and a VL domain comprising the amino acid sequence of SEQ ID NO: 59.
  • the invention provides an antibody comprising (a) a heavy chain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of the amino acid sequence of SEQ ID NO: 76 and/or (b) a light chain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of the amino acid sequence of SEQ ID NO: 77.
  • the antibody comprises a heavy chain comprising the amino acids sequence of SEQ ID NO: 76 and a light chain comprising the amino acid sequence of SEQ ID NO: 77.
  • the heavy chain further comprises a lysine (K) residue at the C-terminus.
  • the invention provides an antibody comprising (a) a heavy chain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of the amino acid sequence of SEQ ID NO: 78 and/or (b) a light chain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of the amino acid sequence of SEQ ID NO: 79.
  • the antibody comprises a heavy chain comprising the amino acids sequence of SEQ ID NO: 78 and a light chain comprising the amino acid sequence of SEQ ID NO: 79.
  • the heavy chain further comprises a lysine (K) residue at the C-terminus.
  • the invention provides an antibody comprising (a) a heavy chain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of the amino acid sequence of SEQ ID NO: 80 and/or (b) a light chain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of the amino acid sequence of SEQ ID NO: 81 .
  • the antibody comprises a heavy chain comprising the amino acids sequence of SEQ ID NO: 80 and a light chain comprising the amino acid sequence of SEQ ID NO: 81 .
  • the heavy chain further comprises a lysine (K) residue at the C-terminus.
  • the invention provides an antibody comprising (a) a heavy chain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of the amino acid sequence of SEQ ID NO: 82 and/or (b) a light chain comprising an amino sequence having at least 90% sequence identity to (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity), or the sequence of, the amino acid sequence of the amino acid sequence of SEQ ID NO: 83.
  • the antibody comprises a heavy chain comprising the amino acids sequence of SEQ ID NO: 82 and a light chain comprising the amino acid sequence of SEQ ID NO: 83.
  • the heavy chain further comprises a lysine (K) residue at the C-terminus.
  • any of the preceding antibodies binds to an epitope on human tryptase beta 1 comprising at least one, at least two, or all three residues selected from the group consisting of Gln100, Leu101 , and Leu102 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 further comprises one or more amino acid residues selected from the group consisting of Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, and Glu129 of SEQ ID NO: 71 .
  • the epitope on human tryptase beta 1 comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, at least thirteen, or all fourteen amino acid residues selected from the group consisting of Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, and Glu129 of SEQ ID NO: 71 .
  • the epitope comprises Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101 , Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129, and Arg216 of SEQ ID NO: 71 .
  • the epitope is relative to a human tryptase beta 1 monomer or tetramer.
  • the epitope is relative to a human tryptase beta 1 tetramer, and the epitope on human tryptase beta 1 further comprises one or both of Gln35 and Arg216 of SEQ ID NO: 71 .
  • the epitope is determined by an X- ray crystallography model.
  • the antibody is capable of dissociating the small interface and/or the large interface of human tryptase beta 1 .
  • any of the preceding anti-tryptase antibodies includes a paratope that binds tryptase (e.g., human tryptase beta 1) that includes one or more amino acid residues (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, or 16 19 amino acid residues) selected from the group consisting of light chain variable region amino acid residues Tyr29; Asn30; Arg32; and Arg94 and the heavy chain variable region amino acid residues Gly31 ; Tyr32; Ser52; Ser53; Ala54; Thr56; Phe58; Pro96; Arg97; Gly98; Tyr99; and Argl OOe.
  • tryptase e.g., human tryptase beta 1
  • amino acid residues e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, or 16 19 amino acid residues
  • the anti-tryptase antibody includes a paratope that binds tryptase (e.g., human tryptase beta 1) that includes light chain variable region amino acid residues Tyr29; Asn30; Arg32; and Arg94 or the heavy chain variable region amino acid residues Gly31 ; Tyr32; Ser52; Ser53; Ala54; Thr56; Phe58; Pro96; Arg97; Gly98; Tyr99; and Argl OOe.
  • tryptase e.g., human tryptase beta 1
  • the anti- tryptase antibody includes a paratope that binds tryptase (e.g., human tryptase beta 1 ) that includes light chain variable region amino acid residues Tyr29; Asn30; Arg32; and Arg94 and the heavy chain variable region amino acid residues Gly31 ; Tyr32; Ser52; Ser53; Ala54; Thr56; Phe58; Pro96; Arg97; Gly98; Tyr99; and Argl OOe.
  • tryptase e.g., human tryptase beta 1
  • any of the preceding anti-tryptase antibodies binds human tryptase. In some instances, any of the preceding antibodies binds cynomolgus monkey (cyno) tryptase. In some instances, the antibody binds human tryptase alpha or human tryptase beta. In some instances, the antibody binds human tryptase beta 1 , human tryptase beta 2, or human tryptase beta 3.
  • the invention provides anti-tryptase antibodies that bind to an epitope on tryptase (e.g., human tryptase beta 1) that includes one or more amino acid residues (e.g., 1 , 2, 3, 4, 5, 6, or 7 amino acid residues) selected from the group consisting of His51 , Val80, Lys81 , Asp82, Leu83, Ala84, and Ala85, which may be in reference to the amino acid sequence of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • amino acid residues e.g., 1 , 2, 3, 4, 5, 6, or 7 amino acid residues
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) comprising at least one, at least two, at least three, or all four residues selected from the group consisting of His51 , Val80, Lys81 , and Asp82 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • residues selected from the group consisting of His51 , Val80, Lys81 , and Asp82 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) comprising His51 and at least one, at least two, or all three residues selected from the group consisting of Val 80, Lys81 , and Asp82 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the epitope on tryptase (e.g., human tryptase beta 1) further comprises one or more amino acid residues selected from the group consisting of Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the epitope on tryptase comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or all twelve amino acid residues selected from the group consisting of Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the epitope on tryptase comprises His51 , Gln67, Val80, Lys81 , Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO:71 or a corresponding amino acid of any tryptase protein.
  • the epitope is relative to a tryptase (e.g., human tryptase beta 1 ) monomer or tetramer.
  • the epitope is determined by an X-ray crystallography model.
  • the antibody is capable of dissociating both the small interface of tetrameric tryptase and the large interface of tetrameric tryptase tryptase (e.g., human tryptase beta 1).
  • the invention provides anti-tryptase antibodies that binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes one or more amino acid residues (e.g., 1 , 2, 3, 4, 5, 6, or 7 amino acid residues) elected from the group consisting of Gln100, Leu101 , Leu102, Pro103, Val104, Ser105, and Arg106, which may be in reference to the amino acid sequence of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • amino acid residues e.g., 1 , 2, 3, 4, 5, 6, or 7 amino acid residues
  • the epitope on tryptase (e.g., human tryptase beta 1) further comprises one or more amino acid residues selected from the group consisting of Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126,
  • the epitope on tryptase comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, at least thirteen, or all fourteen amino acid residues selected from the group consisting of Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, and Glu129 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the epitope comprises Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101 , Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129, and Arg216 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the epitope is relative to a tryptase (e.g., human tryptase beta 1) monomer or tetramer.
  • the epitope is relative to a tetramer, and the epitope on tryptase (e.g., human tryptase beta 1) further comprises one or both of Gln35 and Arg216 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the epitope is determined by an X-ray crystallography model.
  • the antibody is capable of dissociating the small interface and/or the large interface of tryptase (e.g., human tryptase beta 1).
  • any of the preceding antibodies binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes one or more amino acid residues (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or 1 1 amino acid residues) selected from the group consisting of Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, and Glu129, which may be in reference to the amino acid sequence of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • amino acid residues e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or 1 1 amino acid residues
  • any of the preceding antibodies binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes Gln67 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes Asp82 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes Leu83 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein. In some instances, the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes Ala84 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein. In some instances, the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes Arg87 of SEQ ID NO: 71 or a
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes Pro103 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein. In some instances, the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) comprising Val104 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes Ser105 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein. In some instances, the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes Arg106 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes Glu128 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein. In some instances, the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes Glu129 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • any of the preceding antibodies binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, ten or more, or all eleven amino acid residues selected from the group consisting of Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, and Glu129, which may be in reference to the amino acid sequence of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human trypt
  • any of the preceding antibodies binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes one or more additional amino acid residues (e.g., 1 , 2, 3, 4, or 5 additional amino acid residues) selected from the group consisting of His51 , Val80, Lys81 , Ala85, and Pro130, which may be in reference to the amino acid sequence of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • additional amino acid residues e.g., 1 , 2, 3, 4, or 5 additional amino acid residues
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes His51 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Val80 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the anti-tryptase antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Lys81 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Ala85 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Pro130 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes two or more, three or more, four or more, or five or more additional amino acid residues selected from the group consisting of His51 , Val80, Lys81 , Ala85, and Pro130, which may be in reference to the amino acid sequence of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • additional amino acid residues selected from the group consisting of His51 , Val80, Lys81 , Ala85, and Pro130, which may be in reference to the amino acid sequence of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the anti-tryptase antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes His51 , Gln67, Val80, Lys81 , Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 , which may be in reference to the amino acid sequence of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g.,
  • the anti-tryptase antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that consists of His51 , Gln67, Val80, Lys81 , Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129, and Pro130 of SEQ ID NO: 71 .
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • any of the preceding anti-tryptase antibodies binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes one or more (e.g., 1 , 2, 3, 4, 5, 6, 7, or 8) additional amino acid residues selected from the group consisting of Gln35, Trp55, Gln100, Leu101 , Leu102, Glu126, Leu127, and Arg216, which may be in reference to the amino acid sequence of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • additional amino acid residues selected from the group consisting of Gln35, Trp55, Gln100, Leu101 , Leu102, Glu126, Leu127, and Arg216, which may be in reference to the amino acid sequence of SEQ ID NO: 71 or a corresponding amino acid of any trypt
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Gln35 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Trp55 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Gln100 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein. In some instances, the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Leu101 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Leu102 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein. In some instances, the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Glu126 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Leu127 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein. In some instances, the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes Arg216 of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • the antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that further includes two or more, three or more, four or more, five or more, six or more, seven or more, or eight or more additional amino acid residues selected from the group consisting of Gln35, Trp55, Gln100, Leu101 , Leu102, Glu126, Leu127, and Arg216, which may be in reference to the amino acid sequence of SEQ ID NO: 71 or a corresponding amino acid of any tryptase protein.
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human try
  • the anti-tryptase antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that includes Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101 ,
  • tryptase e.g., human tryptase beta 1
  • the anti-tryptase antibody binds to an epitope on tryptase (e.g., human tryptase beta 1) that consists of Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101 , Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129, and Arg216 of SEQ ID NO: 71 .
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • tryptase e.g., human tryptase beta 1
  • the invention provides an antibody that competes for binding to tryptase (e.g., human tryptase beta 1) with any of the preceding antibodies.
  • tryptase e.g., human tryptase beta 1
  • the invention provides an antibody that binds to the same epitope or an overlapping epitope as any of the preceding antibodies.
  • any of the preceding antibodies may have the ability to disrupt tryptase having a tetrameric structure (such as mature tryptase present in, or released from, mast cell secretory granules) to form smaller molecular weight species, e.g., monomers, dimers, and/or trimers.
  • an antibody according to any of the above embodiments may incorporate any of the features, singly or in combination, as described in Sections 1 -7 below:
  • an antibody provided herein has a dissociation constant (KD) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, ⁇ 1 pM, or ⁇ 0.1 pM (e.g., 10 "6 M or less, e.g., from 10 6 M to 10 9 M or less, e.g., from 10 9 M to 10 3 M or less).
  • KD dissociation constant
  • an anti-tryptase antibody of the invention binds to tryptase (e.g., human tryptase, e.g., human tryptase beta) with a KD of about 100 nM or lower (e.g., 100 nM or lower, 10 nM or lower, 1 nM or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • tryptase e.g., human tryptase, e.g., human tryptase beta
  • KD a KD of about 100 nM or lower (e.g., 100 nM or lower, 10 nM or lower, 1 nM or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • the antibody binds tryptase (e.g., human tryptase, e.g., human tryptase beta) with a KD of 10 nM or lower (e.g., 10 nM or lower, 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • tryptase e.g., human tryptase, e.g., human tryptase beta
  • a KD e.g., 10 nM or lower, 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower.
  • the antibody binds tryptase (e.g., human tryptase, e.g., human tryptase beta) with a KD of 1 nM or lower (e.g., 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • tryptase e.g., human tryptase, e.g., human tryptase beta
  • KD e.g., 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower.
  • any of the anti-tryptase antibodies described above or herein binds to tryptase (e.g., human tryptase, e.g., human tryptase beta) with a KD of about 0.5 nM or lower (e.g., 0.5 nm or lower, 400 pM or lower, 300 pM or lower, 200 pM or lower, 100 pM or lower, 50 pM or lower, 25 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • tryptase e.g., human tryptase, e.g., human tryptase beta
  • KD a KD of about 0.5 nM or lower (e.g., 0.5 nm or lower, 400 pM or lower, 300 pM or lower, 200 pM or lower, 100 pM or lower, 50 pM or lower, 25 p
  • the antibody binds tryptase (e.g., human tryptase, e.g., human tryptase beta) with a KD between about 0.1 nM to about 0.5 nM (e.g., about 0.1 nM, about 0.2 nM, about 0.3 nM, about 0.4 nM, or about 0.5 nM).
  • the antibody binds tryptase (e.g., human tryptase, e.g., human tryptase beta) with a KD of about 0.4 nM.
  • the antibody binds tryptase (e.g., human tryptase, e.g., human tryptase beta) with a KD of about 0.18 nM.
  • KD is measured by a radiolabeled antigen binding assay (RIA).
  • RIA radiolabeled antigen binding assay
  • an RIA is performed with the Fab version of an antibody of interest and its antigen.
  • solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of ( 25 l)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al. J. Mol. Biol.
  • MICROTITER® multi-well plates (Thermo Scientific) are coated overnight with 5 ⁇ g/ml of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C).
  • a non-adsorbent plate (Nunc #269620) 100 pM or 26 pM [ 25 l]-antigen are mixed with serial dilutions of a Fab of interest (e.g., consistent with assessment of the anti-VEGF antibody, Fab-12, in Presta et al. Cancer Res. 57:4593-4599, 1997).
  • the Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g., for one hour).
  • KD is measured using a BIACORE® surface plasmon resonance assay.
  • a BIACORE®-2000 or a BIACORE ®-3000 (BIAcore, Inc., Piscataway, NJ) is performed at 25°C with immobilized antigen CM5 chips at ⁇ 10 response units (RU).
  • carboxymethylated dextran biosensor chips (CM5, BIACORE, Inc.) are activated with A/-ethyl-/V- (3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N- hydroxysuccinimide (NHS) according to the supplier's instructions.
  • Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 ⁇ g/ml ( ⁇ 0.2 ⁇ ) before injection at a flow rate of 5 ⁇ /minute to achieve
  • spectrophotometer (ThermoSpectronic) with a stirred cuvette.
  • KD is measured using a BIACORE® SPR assay, for example, as described in Example 1 , Section (A)(vii).
  • the SPR assay can use a BIAcore® T200 or an equivalent device.
  • BIAcore® Series S CM5 sensor chips (or equivalent sensor chips) are immobilized with monoclonal mouse anti-human IgG (Fc) antibody and anti- tryptase antibodies are subsequently captured on the flow cell.
  • Serial 3-fold dilutions of the His-tagged human tryptase beta 1 monomer SEQ ID NO: 128) are injected at a flow rate of 30 ⁇ /min. Each sample is analyzed with 3 min association and 10 min dissociation.
  • the assay is performed at 25°C. After each injection, the chip is regenerated using 3 M MgC . Binding response is corrected by subtracting the response units (RU) from a flow cell capturing an irrelevant IgG at similar density.
  • RU response units
  • an antibody provided herein is an antibody fragment.
  • Antibody fragments include, but are not limited to, Fab, Fab', Fab'-SH, F(ab')2, Fv, and scFv fragments, and other fragments described below.
  • Fab fragment antigen
  • Fab' fragment antigen binding domain
  • Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01 161 ; Hudson et al. Nat. Med. 9:129-134, 2003; and Hollinger et al. Proc. Natl. Acad. Sci. USA 90: 6444-6448, 1993. Triabodies and tetrabodies are also described in Hudson et al. Nat. Med. 9:129-134, 2003.
  • Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
  • a single-domain antibody is a human single-domain antibody (see, e.g., U.S. Patent No. 6,248,516 B1).
  • Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g., E. coli or phage), as described herein.
  • recombinant host cells e.g., E. coli or phage
  • an antibody provided herein is a chimeric antibody.
  • Certain chimeric antibodies are described, e.g., in U.S. Patent No. 4,816,567; and Morrison et al. Proc. Natl. Acad. Sci. USA, 81 :6851 -6855, 1984).
  • a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region.
  • a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
  • a chimeric antibody is a humanized antibody.
  • a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
  • a humanized antibody comprises one or more variable domains in which HVRs (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences.
  • a humanized antibody optionally will also comprise at least a portion of a human constant region.
  • some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), for example, to restore or improve antibody specificity or affinity.
  • Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best-fit" method (see, e.g., Sims et al. J. Immunol. 151 :2296, 1993); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285, 1992; and Presta et al. J. Immunol. , 151 :2623, 1993); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro et al. Front. Biosci.
  • an antibody provided herein is a human antibody.
  • Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk et al. Curr. Opin. Pharmacol. 5:368-74, 2001 and Lonberg, Curr. Opin. Immunol. 20:450-459, 2008.
  • Human antibodies may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human
  • Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor J Immunol. 133:3001 , 1984; Brodeur et al. Monoclonal Antibody
  • Human antibodies generated via human B-cell hybridoma technology are also described in Li et al. Proc. Natl. Acad. Sci. USA, 103:3557-3562, 2006. Additional methods include those described, for example, in U.S. Patent No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4):265-268, 2006 (describing human-human hybridomas).
  • Human hybridoma technology (Trioma technology) is also described in Vollmers et al. Histology and Histo pathology 20(3):927-937, 2005 and Vollmers et al.
  • Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
  • Antibodies of the invention may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1 -37 (O'Brien et al., ed., Human Press, Totowa, NJ, 2001) and further described, e.g., in the McCafferty et al. Nature 348:552-554, 1990; Clackson et al. Nature 352: 624-628, 1991 ; Marks et al. J. Mol. Biol.
  • repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al. Ann. Rev. Immunol. , 12: 433-455, 1994.
  • Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
  • naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al. EMBO J. 12: 725-734, 1993.
  • naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable HVR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom et al. J. Mol. Biol. , 227: 381 -388, 1992.
  • Patent publications describing human antibody phage libraries include, for example: U.S. Patent No.
  • Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
  • an antibody provided herein is a multispecific antibody, for example, a bispecific antibody.
  • Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different sites.
  • bispecific antibodies may bind to two different epitopes of tryptase.
  • one of the binding specificities is for tryptase and the other is for any other antigen (e.g., a second biological molecule).
  • bispecific antibodies may bind to two different epitopes of tryptase.
  • one of the binding specificities is for tryptase (e.g., human tryptase, e.g., human tryptase beta) and the other is for any other antigen (e.g., a second biological molecule, e.g., IL-13, IL-4, IL-5, IL-17, IL-33, IgE, M1 prime, CRTH2, or TRPA).
  • tryptase e.g., human tryptase, e.g., human tryptase beta
  • any other antigen e.g., a second biological molecule, e.g., IL-13, IL-4, IL-5, IL-17, IL-33, IgE, M1 prime, CRTH2, or TRPA.
  • the bispecific antibody may have binding specificity for tryptase and IL-13; tryptase and IL-4; tryptase and IL-5; tryptase and IL-17, or tryptase ant IL-33.
  • the bispecific antibody may have binding specificity for tryptase and IL-13 or tryptase and IL-33.
  • Bispecific antibodies can be prepared as full length antibodies or antibody fragments.
  • a bispecific antibody includes a first binding domain that binds tryptase and a second binding domain that binds IL-13.
  • the first binding domain that binds tryptase may include, for example, at least one, two, three, four, five, or six hypervariable regions (HVRs) selected from: (a) an HVR-H1 comprising the amino acid sequence of X1X2GMX3 (SEQ ID NO: 1), wherein Xi is Asp or Ser, X2 is Tyr or Phe, and X3 is Val or His; (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RX1X2X3DWYFDV (SEQ ID NO: 3), wherein Xi is Asn or Asp, X 2 is Tyr or Asn, and X 3 is Asp or Tyr; (HVRs) selected from: (a
  • the second binding domain that binds to IL-13 may, for example, include at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of AYSVN (SEQ ID NO: 84); (b) HVR-H2 comprising the amino acid sequence of MIWGDGKIVYNSALKS (SEQ ID NO: 85); (c) HVR-H3 comprising the amino acid sequence of DGYYPYAMDN (SEQ ID NO: 86); (d) HVR-L1 comprising the amino acid sequence of RASKSVDSYGNSFMH (SEQ ID NO: 87); (e) HVR-L2 comprising the amino acid sequence of LASNLES (SEQ ID NO: 88); and (f) HVR-L3 comprising the amino acid sequence of QQNNEDPRT (SEQ ID NO: 89), or a combination of one or more of the above HVRs and one or more variants thereof having at least about 80% sequence identity (e) HVR
  • the first binding domain that binds tryptase comprises at least one, two, three, four, five, or six hypervariable regions (HVRs) selected from: (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RNYDDWYFDV (SEQ ID NO: 8); (d) an HVR-L1 comprising the amino acid sequence of
  • SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6), such as hu31 a.vl 1 .
  • the second binding domain that binds IL-13 may, for example, comprise at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of AYSVN (SEQ ID NO: 84); (b) HVR-H2 comprising the amino acid sequence of MIWGDGKIVYNSALKS (SEQ ID NO: 85); (c) HVR-H3 comprising the amino acid sequence of
  • DGYYPYAMDN (SEQ ID NO: 86); (d) HVR-L1 comprising the amino acid sequence of
  • the second binding domain comprises one, two, three, four, five, or six HVRs of the anti-IL-13 antibody lebrikizumab.
  • the first binding domain comprises the amino acid sequence of the VH and/or VL of hu31 a.v1 1 and the second binding domain comprises the amino acid sequence of the VH and/or VL of the anti-IL-13 antibody lebrikizumab.
  • any of the preceding bispecific anti-tryptase/anti-IL-13 antibodies may include a first binding domain that binds tryptase comprising (a) a VH domain comprising an amino acid sequence having at least 80% sequence identity (e.g., 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 9; (b) a VL domain comprising an amino acid sequence having at least 80% sequence identity (e.g., 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 10;
  • any of the preceding bispecific anti-tryptase/anti-IL-13 antibodies may include a second binding domain that binds to IL-13 comprising (a) a VH domain comprising an amino acid sequence having at least 80% sequence identity (e.g., 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 90 or SEQ ID NO: 1 14; (b) a VL domain comprising an amino acid sequence having at least 80% sequence identity (e.g., 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, S
  • a bispecific antibody in another example, includes a first binding domain that binds tryptase and a second binding domain that binds IL-33.
  • the second binding domain that binds IL- 33 may include any of the anti-IL-33 antibodies described, for example, in U.S. Patent Publication No. 2016/0168242, which is incorporated herein by reference in its entirety.
  • the first binding domain that binds tryptase may include, for example, at least one, two, three, four, five, or six hypervariable regions (HVRs) selected from: (a) an HVR-H1 comprising the amino acid sequence of
  • X1X2GMX3 (SEQ ID NO: 1), wherein Xi is Asp or Ser, X 2 is Tyr or Phe, and X 3 is Val or His; (b) an HVR- H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RX1X2X3DWYFDV (SEQ ID NO: 3), wherein Xi is Asn or Asp, X2 is Tyr or Asn, and X3 is Asp or Tyr; (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6), or a combination of one or more of the above HVRs and one or more variants
  • the second binding domain that binds to IL-33 may, for example, include at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SFSMS (SEQ ID NO: 120); (b) HVR- H2 comprising the amino acid sequence of TISGGKTFTDYVDSVKG (SEQ ID NO: 121); (c) HVR-H3 comprising the amino acid sequence of ANYGNWFFEV (SEQ ID NO: 122); (d) HVR-L1 comprising the amino acid sequence of RASESVAKYGLSLLN (SEQ ID NO: 123); (e) HVR-L2 comprising the amino acid sequence of AASNRGS (SEQ ID NO: 124); and (f) HVR-L3 comprising the amino acid sequence of QQSKEVPFT (SEQ ID NO: 125), or a combination of one or more of the above HVRs and one or more variants thereof having at least about 80% sequence identity (e.
  • the first binding domain that binds tryptase comprises at least one, two, three, four, five, or six hypervariable regions (HVRs) selected from: (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of RNYDDWYFDV (SEQ ID NO: 8); (d) an HVR-L1 comprising the amino acid sequence of
  • SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6), such as hu31 a.vl 1 .
  • the second binding domain that binds IL-33 may, for example, comprise at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SFSMS (SEQ ID NO: 120); (b) HVR-H2 comprising the amino acid sequence of TISGGKTFTDYVDSVKG (SEQ ID NO: 121); (c) HVR-H3 comprising the amino acid sequence of ANYGNWFFEV (SEQ ID NO: 122); (d) HVR-L1 comprising the amino acid sequence of
  • the second binding domain comprises one, two, three, four, five, or six HVRs of the anti-IL-33 antibody 10C12.38.H6.87Y.58I.
  • the first binding domain comprises the amino acid sequence of the VH and/or VL of hu31 a.vl 1 and the second binding domain comprises the amino acid sequence of the VH and/or VL of the anti-IL-33 antibody 10C12.38.H6.87Y.58I.
  • any of the preceding bispecific anti-tryptase/anti-IL-33 antibodies may include a first binding domain that binds tryptase comprising (a) a VH domain comprising an amino acid sequence having at least 80% sequence identity (e.g., 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 9; (b) a VL domain comprising an amino acid sequence having at least 80% sequence identity (e.g., 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 10
  • any of the preceding bispecific anti-tryptase/anti-IL-33 antibodies may include a second binding domain that binds to IL-33 comprising (a) a VH domain comprising an amino acid sequence having at least 80% sequence identity (e.g., 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 126; (b) a VL domain comprising an amino acid sequence having at least 80% sequence identity (e.g., 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO:
  • Multispecific antibodies include, but are not limited to, recombinant co- expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein et al. Nature 305: 537, 1983; WO 93/08829; and Traunecker et al. EMBO J. 10: 3655, 1991), and "knob- in-hole” engineering (see, e.g., U.S. Patent No. 5,731 ,168). Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules
  • the antibody or fragment herein also includes a "Dual Acting Fab” or “DAF” comprising an antigen binding site that binds to tryptase as well as another, different antigen (see, US 2008/0069820, for example).
  • knobs-into-holes as a method of producing multispecific antibodies is described, e.g., in U.S. Pat. No. 5,731 ,168, WO2009/089004, US2009/0182127, US201 1/0287009, Marvin and Zhu, Acta Pharmacol. Sin. (2005) 26(6):649-658, and Kontermann (2005) Acta Pharmacol. Sin. 26:1 -9.
  • a brief nonlimiting discussion is provided below.
  • a “protuberance” refers to at least one amino acid side chain which projects from the interface of a first polypeptide and is therefore positionable in a compensatory cavity in the adjacent interface (i.e., the interface of a second polypeptide) so as to stabilize the heteromultimer, and thereby favor heteromultimer formation over homomultimer formation, for example.
  • the protuberance may exist in the original interface or may be introduced synthetically (e.g., by altering nucleic acid encoding the interface). In some embodiments, a nucleic acid encoding the interface of the first polypeptide is altered to encode the protuberance.
  • nucleic acid encoding at least one "original” amino acid residue in the interface of the first polypeptide is replaced with nucleic acid encoding at least one "import” amino acid residue which has a larger side chain volume than the original amino acid residue. It will be appreciated that there can be more than one original and corresponding import residue.
  • the side chain volumes of the various amino residues are shown, for example, in Table 1 of US 201 1/0287009 or Table 1 of U.S. Patent No. 7,642,228.
  • import residues for the formation of a protuberance are naturally occurring amino acid residues selected from arginine (R), phenylalanine (F), tyrosine (Y) and tryptophan (W).
  • an import residue is tryptophan or tyrosine.
  • the original residue for the formation of the protuberance has a small side chain volume, such as alanine, asparagine, aspartic acid, glycine, serine, threonine, or valine. See, for example, U.S. Patent No. 7,642,228.
  • a “cavity” refers to at least one amino acid side chain which is recessed from the interface of a second polypeptide and therefore accommodates a corresponding protuberance on the adjacent interface of a first polypeptide.
  • the cavity may exist in the original interface or may be introduced synthetically (e.g., by altering nucleic acid encoding the interface).
  • nucleic acid encoding the interface of the second polypeptide is altered to encode the cavity. To achieve this, the nucleic acid encoding at least one "original” amino acid residue in the interface of the second polypeptide is replaced with DNA encoding at least one "import” amino acid residue which has a smaller side chain volume than the original amino acid residue.
  • import residues for the formation of a cavity are naturally occurring amino acid residues selected from alanine (A), serine (S), threonine (T), and valine (V).
  • an import residue is serine, alanine, or threonine.
  • the original residue for the formation of the cavity has a large side chain volume, such as tyrosine, arginine, phenylalanine, or tryptophan.
  • the protuberance is "positionable" in the cavity which means that the spatial location of the protuberance and cavity on the interface of a first polypeptide and second polypeptide respectively and the sizes of the protuberance and cavity are such that the protuberance can be located in the cavity without significantly perturbing the normal association of the first and second polypeptides at the interface.
  • protuberances such as Tyr, Phe, and Trp do not typically extend perpendicularly from the axis of the interface and have preferred conformations
  • the alignment of a protuberance with a corresponding cavity may, in some instances, rely on modeling the protuberance/cavity pair based upon a three-dimensional structure such as that obtained by X-ray crystallography or nuclear magnetic resonance (NMR). This can be achieved using widely-accepted techniques in the art.
  • a knob mutation in an lgG1 constant region is T366W.
  • a hole mutation in an lgG1 constant region comprises one or more mutations selected from T366S, L368A, and Y407V.
  • a hole mutation in an lgG1 constant region comprises T366S, L368A, and Y407V.
  • a knob mutation in an lgG4 constant region is T366W.
  • a hole mutation in an lgG4 constant region comprises one or more mutations selected from T366S, L368A, and Y407V.
  • a hole mutation in an lgG4 constant region comprises T366S, L368A, and Y407V. 7. Antibody Variants
  • amino acid sequence variants of the antibodies provided herein are contemplated.
  • Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, for example, antigen-binding. a) Substitution, Insertion, and Deletion Variants
  • antibody variants having one or more amino acid substitutions are provided.
  • Sites of interest for substitutional mutagenesis include the HVRs and FRs.
  • Conservative substitutions are shown in Table 1 under the heading of "preferred substitutions.” More substantial changes are provided in Table 1 under the heading of "exemplary substitutions,” and as further described below in reference to amino acid side chain classes.
  • Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
  • Amino acids may be grouped according to common side-chain properties:
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g., a humanized or human antibody).
  • a parent antibody e.g., a humanized or human antibody
  • the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody.
  • An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, for example, using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g., binding affinity).
  • Alterations may be made in HVRs, e.g., to improve antibody affinity. Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol.
  • Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1 -37 (O'Brien et al. ed., Human Press, Totowa, NJ, 2001 ).
  • affinity maturation diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis).
  • a secondary library is then created.
  • the library is then screened to identify any antibody variants with the desired affinity.
  • Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. HVR-H3 and HVR-L3 in particular are often targeted.
  • substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen.
  • conservative alterations e.g., conservative substitutions as provided herein
  • Such alterations may, for example, be outside of antigen contacting residues in the HVRs.
  • each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
  • a useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham et al. Science 244:1081 -1085, 1989.
  • a residue or group of target residues e.g., charged residues such as Arg, Asp, His, Lys, and Glu
  • a neutral or negatively charged amino acid e.g., Ala or polyalanine
  • Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions.
  • a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution.
  • Variants may be screened to determine whether they contain the desired properties.
  • Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antibody with an N-terminal methionyl residue.
  • Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
  • ADEPT enzyme
  • an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated.
  • Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
  • the carbohydrate attached thereto may be altered.
  • Native antibodies produced by mammalian cells typically comprise a branched, biantennary
  • oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, for example, Wright et al. TIBTECH 15:26-32, 1997.
  • the oligosaccharide may include various carbohydrates, for example, mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the "stem" of the biantennary oligosaccharide structure.
  • modifications of the oligosaccharide in an antibody of the invention may be made in order to create antibody variants with certain improved properties.
  • antibody variants having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region.
  • the amount of fucose in such antibody may be from 1 % to 80%, from 1 % to 65%, from 5% to 65% or from 20% to 40%.
  • the amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example.
  • Asn297 refers to the asparagine residue located at about position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located about ⁇ 3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. 2003/0157108 and 2004/0093621 .
  • Examples of cell lines capable of producing defucosylated antibodies include Led 3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys.
  • knockout cell lines such as alpha-1 ,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614, 2004; Kanda et al. Biotechnol. Bioeng. 94(4):680-688, 2006; and WO 2003/085107).
  • Antibodies variants are further provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/01 1878; US Patent No. 6,602,684; and US
  • Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087; WO 1998/58964; and WO 1999/22764.
  • one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant.
  • the Fc region variant may comprise a human Fc region sequence (e.g., a human lgG1 , lgG2, lgG3, or lgG4 Fc region) comprising an amino acid modification (e.g., a substitution) at one or more amino acid positions.
  • the invention contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious.
  • In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
  • Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
  • NK cells express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII.
  • FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch et al. Annu. Rev. Immunol. 9:457-492, 1991 .
  • Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Patent No. 5,500,362 (see, e.g., Hellstrom et al. Proc. Natl. Acad. Sci. USA 83:7059-7063, 1986 and Hellstrom et al. Proc. Natl. Acad. Sci.
  • non-radioactive assays methods may be employed (see, for example, ACTITM non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, CA; and CytoTox 96® non-radioactive cytotoxicity assay (Promega, Madison, Wl).
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest may be assessed in vivo, for example, in an animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. USA 95:652-656, 1998.
  • C1 q binding assays may also be carried out to confirm that the antibody is unable to bind C1 q and hence lacks CDC activity. See, e.g., C1 q and C3c binding ELISA in
  • a CDC assay may be performed (see, e.g., Gazzano-Santoro et al. J. Immunol. Methods 202:163, 1996; Cragg et al. Blood 101 :1045-1052, 2003; and Cragg et al. Blood 103:2738-2743, 2004).
  • FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art (see, e.g., Petkova et al. Intl. Immunol. 18(12):1759-1769, 2006).
  • Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No. 6,737,056).
  • Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (U .S. Patent No. 7,332,581).
  • an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
  • alterations are made in the Fc region that result in altered (i.e., either improved or diminished) C1 q binding and/or Complement Dependent Cytotoxicity (CDC), for example, as described in US Patent No. 6,194,551 , WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178-4184, 2000.
  • CDC Complement Dependent Cytotoxicity
  • Antibodies with increased half lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus are described in US2005/0014934.
  • Those antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn.
  • Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 31 1 , 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (US Patent No. 7,371 ,826).
  • cysteine engineered antibodies for example, "thioMAbs," in which one or more residues of an antibody are substituted with cysteine residues.
  • the substituted residues occur at accessible sites of the antibody.
  • reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
  • any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; A1 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region.
  • Cysteine engineered antibodies may be generated as described, e.g., in U.S. Patent No. 7,521 ,541 . e) Antibody Derivatives
  • an antibody provided herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
  • the moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers.
  • water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1 ,3-dioxolane, poly-1 ,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl)
  • PEG polyethylene glycol
  • copolymers of ethylene glycol/propylene glycol carboxymethylcellulose
  • dextran polyvinyl alcohol
  • polyvinyl pyrrolidone poly-1 ,3-dio
  • pyrrolidone polyethylene glycol
  • propropylene glycol homopolymers prolypropylene oxide/ethylene oxide co-polymers
  • polyoxyethylated polyols e.g., glycerol
  • polyvinyl alcohol polyvinyl alcohol
  • Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
  • the polymer may be of any molecular weight, and may be branched or unbranched.
  • the number of polymers attached to the antibody may vary, and if more than one polymer is attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, and the like.
  • conjugates of an antibody and nonproteinaceous moiety that may be selectively heated by exposure to radiation are provided.
  • the nonproteinaceous moiety is a carbon nanotube (Kam et al. Proc. Natl. Acad. Sci. USA 102: 1 1600-1 1605, 2005).
  • the radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature at which cells proximal to the antibody-nonproteinaceous moiety are killed.
  • Antibodies may be produced using recombinant methods and compositions, for example, as described in U.S. Patent No. 4,816,567.
  • isolated nucleic acid encoding an anti- tryptase antibody described herein is provided.
  • Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody).
  • one or more vectors e.g., expression vectors
  • a host cell comprising such nucleic acid is provided.
  • a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
  • the host cell is eukaryotic, for example, a Chinese Hamster Ovary (CHO) cell, 293 cell, or lymphoid cell (e.g., Y0, NSO, Sp20 cell).
  • a method of making an anti-tryptase antibody comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
  • nucleic acid encoding an antibody for example, as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
  • nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
  • Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
  • antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
  • U.S. Patent Nos. 5,648,237, 5,789,199, and 5,840,523. See also Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ, 2003), pp. 245-254, describing expression of antibody fragments in E. coli.
  • the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
  • eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been "humanized,” resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross Nat. Biotech. 22:1409-1414, 2004 and Li et al. Nat. Biotech. 24:210-215, 2006.
  • Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
  • Plant cell cultures can also be utilized as hosts. See, for example, US Patent Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIESTM technology for producing antibodies in transgenic plants).
  • Vertebrate cells may also be used as hosts.
  • mammalian cell lines that are adapted to grow in suspension may be useful.
  • Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al. J. Gen Virol. 36:59, 1977); baby hamster kidney cells (BHK); mouse Sertoli cells (TM4 cells as described, e.g., in Mather Biol. Reprod.
  • monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N. Y. Acad. Sci. 383:44-68, 1982; MRC 5 cells; and FS4 cells.
  • Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells (Uriaub et al. Proc. Natl. Acad. Sci.
  • myeloma cell lines such as Y0, NSO and Sp2/0.
  • myeloma cell lines suitable for antibody production see, e.g., Yazaki et al. Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ), pp. 255-268, 2003.
  • Anti-tryptase antibodies provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
  • an anti-tryptase antibody of the invention is tested for its antigen-binding activity, for example, by known methods such as ELISA, Western blot, surface plasmon resonance (SPR), and the like.
  • competition assays may be used to identify an antibody that competes with an anti-tryptase antibody of the invention for binding to tryptase.
  • a competing antibody binds to the same epitope (e.g., a linear or a conformational epitope) that is bound by an anti- tryptase antibody of the invention.
  • such a competing antibody binds to an overlapping epitope (e.g., a linear or a conformational epitope) that is bound by an anti-tryptase antibody of the invention.
  • Detailed exemplary methods for mapping an epitope to which an antibody binds are provided in Morris "Epitope Mapping Protocols," in Methods in Molecular Biology Mo ⁇ . 66 (Humana Press, Totowa, NJ), 1996.
  • immobilized tryptase is incubated in a solution comprising a first labeled antibody that binds to tryptase and a second unlabeled antibody that is being tested for its ability to compete with the first antibody for binding to tryptase.
  • the second antibody may be present in a hybridoma supernatant.
  • immobilized tryptase is incubated in a solution comprising the first labeled antibody but not the second unlabeled antibody. After incubation under conditions permissive for binding of the first antibody to tryptase, excess unbound antibody is removed, and the amount of label associated with immobilized tryptase is measured. If the amount of label associated with immobilized tryptase is substantially reduced in the test sample relative to the control sample, then that indicates that the second antibody is competing with the first antibody for binding to tryptase. See Harlow et al.
  • the competition of two antibodies for binding to the same epitope is determined by epitope binning.
  • labeled antigen is immobilized on a solid surface, and reacted with a saturating amount of a first antibody.
  • a second competing antibody is then added. Any additional binding by the second antibody as detected by, e.g., OCTET® (ForteBio) or other bio-layer interferometry (BLI) techniques, indicates that the two antibodies bind to distinct, non-overlapping epitopes. No additional binding indicates that the two antibodies bind to the same or overlapping epitope.
  • assays are provided for identifying anti-tryptase antibodies thereof having biological activity.
  • Biological activity may include, for example, binding to tryptase (e.g., tryptase in the bloodstream or in the airway), or a peptide fragment thereof, either in vivo, in vitro, or ex vivo.
  • biological activity may include blocking or neutralizing tryptase.
  • biological activity may include blocking or neutralizing tryptase proteolytic activity.
  • Antibodies having such biological activity in vivo and/or in vitro are also provided.
  • an antibody of the invention is tested for such biological activity.
  • an antibody of the invention is tested for inhibition of tryptase activity in a tryptase enzymatic assay, for example, using a peptide substrate (e.g., synthetic peptide S-2288), for example, as described in the Examples (e.g., Example 1 , particularly Section (A)(viii)(a)), or using methods known in the art (see, e.g., Fukuoka et al. J. Immunol. 176:3165-3172, 2006).
  • a peptide substrate e.g., synthetic peptide S-2288
  • inhibition of tryptase activity in a tryptase enzymatic assay is performed at or around neutral pH (e.g., around pH 7, e.g., about pH 7, about pH. 7.4, or about pH 8). In other embodiments, inhibition of tryptase activity in a tryptase enzymatic assay is performed at an acidic pH (e.g., about pH 6.0, e.g., about pH 4.0, about pH 5.0, about pH 6.0, or about pH 6.5).
  • neutral pH e.g., around pH 7, e.g., about pH 7, about pH. 7.4, or about pH 8
  • inhibition of tryptase activity in a tryptase enzymatic assay is performed at an acidic pH (e.g., about pH 6.0, e.g., about pH 4.0, about pH 5.0, about pH 6.0, or about pH 6.5).
  • an antibody of the invention is tested for the ability to disrupt tryptase having a tetrameric structure (such as mature tryptase present in, or released from, mast cell secretory granules) to form monomers, which may be determined using any suitable method known in the art, including gel filtration chromatography (e.g., SUPEROSE® 12 gel filtration chromatography). See, e.g., in Fukuoka et al. J. Immunol. 176:3165-3172, 2006.
  • an antibody of the invention is tested for the ability to inhibit tryptase- stimulated proliferation and/or contraction of human primary airway smooth muscle cells, as described, for example, in Example 1 .
  • an antibody of the invention is tested for the ability to inhibit mast cell degranulation and/or histamine release, for example, stimulated by tryptase and/or IgE.
  • assays are described, for example, in Example 1 .
  • an antibody of the invention is tested for the ability to inhibit active tryptase, for example, in an active tryptase assay (see, e.g., Fig. 15 and Example 6), for example, in a sample (e.g., bronchoalveolar lavage fluid) obtained from a subject following administration of the antibody to the subject (e.g., by intravenous or subcutaneous injection).
  • an active tryptase assay see, e.g., Fig. 15 and Example 6
  • a sample e.g., bronchoalveolar lavage fluid
  • an antibody of the invention is tested for the ability to modulate (e.g., increase or decrease) total tryptase levels, for example, in a total tryptase assay (see, e.g., Fig. 15 and Example 6), for example, in a sample (e.g., bronchoalveolar lavage fluid) obtained from a subject following administration of the antibody to the subject (e.g., by intravenous or subcutaneous injection).
  • a sample e.g., bronchoalveolar lavage fluid
  • an immunoconjugate comprising an anti-tryptase antibody herein conjugated to one or more cytotoxic agents, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
  • cytotoxic agents such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
  • ADC antibody-drug conjugate
  • an antibody is conjugated to one or more drugs, including but not limited to a maytansinoid (see U.S. Patent Nos. 5,208,020, 5,416,064 and European Patent EP 0 425 235 B1); an auristatin such as
  • MMAE and MMAF monomethylauristatin drug moieties DE and DF (MMAE and MMAF) (see U.S. Patent Nos. 5,635,483 and 5,780,588, and 7,498,298); a dolastatin; a calicheamicin or derivative thereof (see U.S. Patent Nos.
  • an immunoconjugate comprises an antibody as described herein conjugated to an enzymatically active toxin or fragment thereof, including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • an enzymatically active toxin or fragment thereof including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (
  • an immunoconjugate comprises an antibody as described herein conjugated to a radioactive atom to form a radioconjugate.
  • a radioactive atom to form a radioconjugate.
  • radioactive isotopes are available for the production of radioconjugates. Examples include At 211 , I 131 , I 125 , Y 90 , Re 186 , Re 188 , Sm 53 , Bi 2 2 , P 32 , Pb 2 2 and radioactive isotopes of Lu.
  • the radioconjugate When used for detection, it may comprise a radioactive atom for scintigraphic studies, for example technetium-99m (tc99m) or I 123 , or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, mri), such as iodine-123 again, iodine-131 , indium-1 1 1 , fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron.
  • a radioactive atom for scintigraphic studies for example technetium-99m (tc99m) or I 123
  • NMR nuclear magnetic resonance
  • mri nuclear magnetic resonance
  • Conjugates of an antibody and cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N- maleimidomethyl) cyclohexane-1 -carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCI), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as
  • a ricin immunotoxin can be prepared as described in Vitetta et al. Science 238:1098, 1987.
  • Carbon-14-labeled 1 -isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO 94/1 1026.
  • the linker may be a "cleavable linker" facilitating release of a cytotoxic drug in the cell.
  • an acid- labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker see, e.g., Chari et al. Cancer Res. 52:127-131 , 1992; U.S. Patent No. 5,208,020) may be used.
  • the immunuoconjugates or ADCs herein expressly contemplate, but are not limited to such conjugates prepared with cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo- KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4- vinylsulfone)benzoate) which are commercially available (e.g., from Pierce Biotechnology, Inc., Rockford, IL, U.S.A).
  • SVSB succinimidyl-(4- vinylsulfone
  • any of the anti-tryptase antibodies provided herein is useful for detecting the presence of tryptase in a biological sample.
  • the term "detecting" as used herein encompasses quantitative or qualitative detection.
  • a biological sample comprises a cell or tissue, including but not limited to mast cells, basophils, epithelial cells, or lung tissue (e.g., bronchial smooth muscle).
  • a biological sample comprises blood (e.g., whole blood, serum, or plasma), sputum, bronchoalveolar lavage, or a nasosorption sample.
  • an anti-tryptase antibody for use in a method of diagnosis or detection is provided.
  • a method of detecting the presence of tryptase in a biological sample comprises contacting the biological sample with an anti- tryptase antibody as described herein under conditions permissive for binding of the anti-tryptase antibody to tryptase, and detecting whether a complex is formed between the anti-tryptase antibody and tryptase.
  • an anti-tryptase antibody is used to select subjects eligible for therapy with an anti-tryptase antibody, for example, where tryptase is a biomarker for selection of patients.
  • the antibodies of the invention may be used to diagnose or detect anaphylaxis (e.g., acute systemic anaphylaxis) or mastocytosis (e.g., nonacute systemic mastocytosis), for example, as described in Schwartz et al. Immunol. Allergy Clin. N. Am. 26:451 -463, 2006).
  • the antibodies of the invention may be used, for example, in an ELISA to detect the levels of total tryptase, pro-tryptase, and/or mature tryptase.
  • an antibody of the invention may be used as a capture antibody in an ELISA.
  • an antibody of the invention may be used as a detection antibody in an ELISA.
  • a normal reference level of total tryptase in serum or plasma may be about 1 -15 ng/mL (e.g., about 1 ng/mL, about 2 ng/mL, about 3 ng/mL, about 4 ng/mL, about 5 ng/mL, about 6 ng/mL, about 7 ng/mL, about 8 ng/mL, about 9 ng/mL, about 10 ng/mL, about 1 1 ng/mL, about 12 ng/mL, about 13 ng/mL, about 14 ng/mL, or about 15 ng/mL).
  • an increase relative to a normal reference level of total tryptase is used as a diagnostic indicator of a tryptase-associated disorder.
  • a normal reference level of mature tryptase in serum or plasma may be ⁇ 1 ng/mL.
  • an increase relative to a normal reference level of mature tryptase may be used as a diagnostic indicator of a tryptase associated disorder.
  • labeled anti-tryptase antibodies include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron- dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction.
  • Exemplary labels include, but are not limited to, the radioisotopes 32 P, 4 C, 25 l, 3 H, and 3 l, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luciferases, e.g., firefly luciferase and bacterial luciferase (U.S. Patent No.
  • luciferin 2,3- dihydrophthalazinediones
  • horseradish peroxidase HRP
  • alkaline phosphatase alkaline phosphatase
  • ⁇ -galactosidase glucoamylase
  • lysozyme saccharide oxidases
  • glucose oxidase galactose oxidase
  • glucose-6- phosphate dehydrogenase e.g., glucose-6- phosphate dehydrogenase
  • heterocyclic oxidases such as uricase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase, biotin/avidin, spin labels, bacteriophage labels, stable free radicals, and the like.
  • compositions of an anti-tryptase antibody of the invention are prepared by mixing such antibody having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (see, e.g., Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed., 1980), in the form of lyophilized formulations or aqueous solutions.
  • Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arg
  • Exemplary pharmaceutically acceptable carriers herein further include insterstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20 (HYLENEX®, Baxter International, Inc.).
  • sHASEGP soluble neutral-active hyaluronidase glycoproteins
  • rHuPH20 HYLENEX®, Baxter International, Inc.
  • Certain exemplary sHASEGPs and methods of use, including rHuPH20 are described in US Patent Publication Nos. 2005/0260186 and 2006/0104968.
  • a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.
  • Exemplary lyophilized antibody formulations are described in US Patent No. 6,267,958.
  • Aqueous antibody formulations include those described in US Patent No. 6,171 ,586 and WO 2006/044908, the latter formulations including a histidine-acetate buffer.
  • the formulation herein may also contain more than one active ingredient as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • the IL-13 axis binding antagonist is an anti-IL-13 antibody, for example, lebrikizumab.
  • the IL-5 axis binding antagonist is an IL-5 binding antagonist or an IL-5 receptor binding antagonist.
  • an IL-33 axis binding antagonist is an IL-33 binding antagonist or an ST2 binding antagonist.
  • the IL-33 binding antagonist is an anti-IL-33 antibody.
  • the M1 prime antagonist is quiiizumab.
  • the IgE antagonist is omalizumab (XOLAIR®).
  • Such active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
  • Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules.
  • the formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, for example, by filtration through sterile filtration membranes.
  • the invention provides pharmaceutical compositions that include antioxidants.
  • compositions may be used to reduce oxidation of an antibody described herein (e.g., an anti-tryptase antibody, such as hu31 A.v1 1).
  • an antioxidant is included to reduce oxidation of a tryptophan residue, for example, a tryptophan residue in a HVR region or a FR region of a variable region.
  • an antioxidant is included to reduce oxidation of an HVR-H3 residue of an anti-tryptase antibody, for example, W100 in hu31A.v1 1 .
  • an antioxidant is included in the composition to reduce oxidation of a methionine residue, for example a methionine residue in the Fc region of an antibody (e.g., an anti-tryptase antibody), such as Fc residues M251 , M357, and/or M427 (for example, of hu31 A.v1 1).
  • the pharmaceutical composition includes any of the antibodies described herein and an antioxidant.
  • the antibody is susceptible to oxidation (e.g., at one or more (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10) tryptophan or methionine residues). Any suitable antioxidant may be used.
  • the composition includes one or more antioxidants (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, or 9 antioxidants) selected from the group consisting of N-acetyltryptophan (e.g., N- acetyl DL-tryptophan or N-acetyl D-tryptophan), tryptophan, methionine (e.g., L-methionine), cysteine, glutathione, thiosorbitol, ascorbic acid, monothioglycerol, cyclodextrins, Trolox, pyridoxine, polyols (e.g., mannitol), sucrose, a metal chelator (e.g., EDTA), and combinations thereof (e.g., a combination of N- acetyltryptophan and methionine).
  • N-acetyltryptophan e.g., N- acetyl DL-tryptophan or N-acetyl
  • the antioxidant is N-acetyltryptophan (e.g., N- acetyl DL-tryptophan or N-acetyl D-tryptophan).
  • the antioxidant is methionine (e.g., L- methionine or D-methionine).
  • the composition includes N-acetyltryptophan (e.g., N-acetyl DL-tryptophan or N-acetyl D-tryptophan) and methionine (e.g., L-methionine or D-methionine).
  • the N-acetyltryptophan reduces or prevents oxidation of tryptophan in the antibody.
  • the methionine reduces or prevents oxidation of methionine in the antibody.
  • the pharmaceutical composition may include any suitable concentration of the antioxidant in order to reduce or eliminate oxidation.
  • concentration of polyols (e.g., mannitol) or sucrose may be about 1 % (w/v) to about 25% (w/v), e.g., about 1 %, about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10%, about 1 1 %, about 12%, about 13%, about 15%, about 16%, about 17%, about 18%, about 19%, about 20%, or about 25% (w/v).
  • concentration of polyols (e.g., mannitol) or sucrose may be about 15% (w/v).
  • the concentration of metal chelators may be about 0.01 % (w/v) to about 1 % (w/v), e.g., about 0.01 %, about 0.02%, about 0.03%, about 0.04%, about 0.05%, about 0.06%, about 0.07%, about 0.08%, about 0.09%, about 0.1 %, about 0.15%, about 0.2%, about 0.25%, about 0.3%, about 0.4%, about 0.45%, about 0.5%, about 0.6%, about 0.7%, about 0.8%, about 0.9%, or about 1 % (w/v).
  • the concentration of a metal chelator e.g., EDTA
  • the concentration of a metal chelator may be about 0.4% (w/v).
  • the concentration of methionine and/or tryptophan may be about 0.1 mg/ml to about 10 mg/ml, e.g., about 0.1 mg/ml, about 0.5 mg/ml, about 1 mg/ml, about 2 mg/ml, about 3 mg/ml, about 4 mg/ml, about 5 mg/ml, about 6 mg/ml, about 7 mg/ml, about 8 mg/ml, about 9 mg/ml, or about 10 mg/ml. In some instances, the concentration of methionine and/or tryptophan is about 2 mg/ml.
  • the invention provides a pharmaceutical composition that includes:
  • HVRs hypervariable regions: (a) an HVR-H1 comprising the amino acid sequence of DYGMV (SEQ ID NO: 7); (b) an HVR-H2 comprising the amino acid sequence of FISSGSSTVYYADTMKG (SEQ ID NO: 2); (c) an HVR-H3 comprising the amino acid sequence of
  • RNYDDWYFDV (SEQ ID NO: 8); (d) an HVR-L1 comprising the amino acid sequence of SASSSVTYMY (SEQ ID NO: 4); (e) an HVR-L2 comprising the amino acid sequence of RTSDLAS (SEQ ID NO: 5); and (f) an HVR-L3 comprising the amino acid sequence of QHYHSYPLT (SEQ ID NO: 6); (ii) N- acetyltryptophan (e.g., N-acetyl DL-tryptophan or N-acetyl D-tryptophan); and (iii) methionine (e.g., L- methionine or D-methionine).
  • N- acetyltryptophan e.g., N-acetyl DL-tryptophan or N-acetyl D-tryptophan
  • methionine e.g., L- methionine or D-methionine
  • any suitable concentration of N-acetyltryptophan may be used in any of the compositions described herein.
  • the concentration of N-acetyltryptophan is about 0.05 mM to about 20 mM (e.g., about 0.05 mM to about 20 mM, about 0.05 mM to about 19 mM, about 0.05 mM to about 18 mM, about 0.05 mM to about 17 mM, about 0.05 mM to about 16 mM, about 0.05 mM to about 15 mM, about 0.05 mM to about 14 mM, about 0.05 mM to about 13 mM, about 0.05 mM to about 13 mM, about 0.05 mM to about 12
  • the N-acetyltryptophan is at a concentration of about 0.1 mM to about 1 mM (e.g., about 0.1 mM, about 0.2 mM, about 0.3 mM, about 0.4 mM, about 0.5 mM, about 0.6 mM, about 0.7 mM, about 0.8 mM, about 0.9 mM, or about 1 mM).
  • the concentration of N-acetyltryptophan e.g., N-acetyl DL-tryptophan or N-acetyl D- tryptophan
  • the concentration of N-acetyltryptophan is about 0.3 mM.
  • N-acetyltryptophan is or N-acetyl DL-tryptophan.
  • Any suitable concentration of methionine e.g., L-methionine or D-methionine
  • methionine e.g., L-methionine or D-methionine
  • the concentration of methionine is about 0.1 mM to about 30 mM (e.g., about 0.1 mM to about 30 mM, about 0.1 mM to about 25 mM, about 0.1 mM to about 20 mM, about 0.1 mM to about 19 mM, about 0.1 mM to about 18 mM, about 0.1 mM to about 17 mM, about 0.1 mM to about 16 mM, about 0.1 mM to about 15 mM, about 0.1 mM to about 14 mM, about 0.1 mM to about 13 mM, about 0.1 mM to about 13 mM, about 0.1 mM to about 12 mM, about 0.1 mM to about 1 1 mM, about 0.1 mM to about 10 mM, about 0.1 mM to about 9 mM, about 0.1 mM
  • the methionine (e.g., L-methionine or D-methionine) is at a concentration of about 1 mM to about 10 mM (e.g., about 1 mM, about 2 mM, about 3 mM, about 4 mM, about 5 mM, about 6 mM, about 7 mM, about 8 mM, about 9 mM, or about 10 mM).
  • the concentration of methionine e.g., L-methionine or D-methionine
  • the concentration of methionine is about 10 mM.
  • the methionine is L-methionine.
  • the presence of the antioxidant reduces the percent oxidation of the anti-tryptase antibody at a particular residue (e.g., a tryptophan residue or a methionine residue, for example, in an HVR-H3 residue (e.g., W100 of the VH domain of hu31A.v1 1) or in an Fc residue (e.g., Fc residues M251 , M357, and/or M427 (for example, of hu31A.v1 1)) by about 1 %, about 2%, about 5%, about 6%, about 10%, about 15%, about 20%, about 25%, about 28%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%
  • the VH domain W100 residue in HVR-H3 has a percent oxidation of less than about 35% (e.g., less than 35%, less than 34%, less than 33%, less than 32%, less than 31 %, less than 30%, less than 29%, less than 28%, less than 27%, less than 26%, less than 25%, less than 24%, less than 23%, less than 22%, less than 21 %, less than 20%, less than 19%, less than 18%, less than 17%, less than 16%, less than 15%, less than 14%, less than 13%, less than 12%, less than 1 1 %, less than 10%, less than 9%, less than 8%, less than 7%, less than 6%, less than 5%, less than 4%, less than 3%, less than 2%, less than 1 %, or
  • the W100 residue in HVR-H3 has a percent oxidation of less than about 35%. In other instances, the W100 residue in HVR-H3 has a percent oxidation of less than about 25%. In yet other instances, the W100 residue in HVR-H3 has a percent oxidation of less than about 15%. In still other instances, the W100 residue in HVR-H3 has a percent oxidation of less than about 10%. In other instances, the W100 residue in HVR-H3 has a percent oxidation of less than about 5%. In other instances, the W100 residue in HVR-H3 has a percent oxidation of less than about 4%, about 3%, about 2%, or about 1 %.
  • the VH domain W100 residue in HVR-H3 has a percent oxidation of between about 1 % to about 50%, between about 1 % to about 45%, between about 1 % to about 40%, between about 1 % to about 35%, between about 1 % to about 30%, between about 1 % to about 25%, between about 1 % to about 20%, between about 1 % to about 15%, between about 1 % to about 10%, between about 1 % to about 5%, between about 1 % to about 4%, between about 1 % to about 3%, between about 1 % to about 2%, between about 5% to about 50%, between about 5% to about 45%, between about 5% to about 50%, between about 5% to about 35%, between about 5% to about 30%, between about 5% to about 25%, between about 5% to about 20%, between about 5% to about 15%, between about 5% to about 10%,
  • Percent oxidation may be determined, for example, within about 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months 9 months, 10 months, 11 months, 12 months, 18 months, two years, or more from the initial production of an antibody or a pharmaceutical composition thereof. In some instances, percent oxidation is determined about 9 months, about 12 months, about 18 months, or two years from the initial production of an antibody or a pharmaceutical composition thereof.
  • the concentration of an antibody in a composition of the invention may range, for example, from about 1 mg/mL to about 350 mg/mL (e.g., about 1 mg/mL to about 350 mg/mL, about 1 mg/mL to about 325 mg/mL, about 1 mg/mL to about 300 mg/mL, about 1 mg/mL to about 275 mg/mL, about 1 mg/mL to about 250 mg/mL, about 1 mg/mL to about 225 mg/mL, about 1 mg/mL to about 200 mg/mL, about 1 mg/mL to about 175 mg/mL, about 1 mg/mL to about 150 mg/mL, about 1 mg/mL to about 125 mg/mL, about 1 mg/mL to about 100 mg/mL, about 1 mg/mL to about 75 mg/mL, about 1 mg/mL to about 50 mg/mL, about 1 mg/mL to about 25 mg/mL, about 25 mg/mL to about 350 mg/mL, about
  • 175 mg/mL about 50 mg/mL to about 150 mg/mL, about 50 mg/mL to about 125 mg/mL, about 50 mg/mL to about 100 mg/mL, about 50 mg/mL to about 75 mg/mL, about 75 mg/mL to about 350 mg/mL, about 75 mg/mL to about 325 mg/mL, about 75 mg/mL to about 300 mg/mL, about 75 mg/mL to about 275 mg/mL, about 75 mg/mL to about 250 mg/mL, about 75 mg/mL to about 225 mg/mL, about 75 mg/mL to about 200 mg/mL, about 75 mg/mL to about 175 mg/mL, about 75 mg/mL to about 150 mg/mL, about 75 mg/mL to about 125 mg/mL, about 75 mg/mL to about 100 mg/mL, about 100 mg/mL to about 350 mg/mL, about 100 mg/mL to about 325 mg/mL, about 100 mg
  • the antibody is at a concentration of about 50 mg/mL to about 200 mg/mL (e.g., about 50 mg/mL, about 60 mg/mL, about 70 mg/mL, about 80 mg/mL, about 90 mg/mL, about 100 mg/mL, about 1 10 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about 180 mg/mL, about 190 mg/mL, or about 200 mg/mL.
  • the antibody concentration is about 150 mg/mL.
  • compositions described herein may include one or more additional excipients selected from the group consisting of a stabilizer, a buffer, a surfactant, and a tonicity agent.
  • the buffer comprises arginine succinate and/or histidine succinate.
  • the buffer includes arginine succinate and histidine succinate.
  • the concentration of arginine succinate is about 10 mM to about 500 mM (e.g., about 10 mM, about 20 mM, about 30 mM, about 40 mM, about 50 mM, about 75 mM, about 100 mM, about 125 mM, about 150 mM, about 175 mM, about 200 mM, about 225 mM, about 250 mM, about 275 mM, about 300 mM, about 325 mM, about 350 mM, about 375 mM, about 400 mM, about 425 mM, about 450 mM, about 475 mM, or about 500 mM).
  • concentration of arginine succinate is about 10 mM to about 500 mM (e.g., about 10 mM, about 20 mM, about 30 mM, about 40 mM, about 50 mM, about 75 mM, about 100 mM, about 125 mM, about 150
  • the concentration of arginine succinate is about 100 mM to about 300 mM, about 125 mM to about 300 mM, about 150 mM to about 300 mM, about 175 mM to about 300 mM, about 200 mM to about 300 mM, about 225 mM to about 300 mM, about 250 mM to about 300 mM, about 275 mM to about 300 mM, about 100 mM to about 250 mM, about 125 mM to about 250 mM, about 150 mM to about 250 mM, about 175 mM to about 250 mM, about 200 mM to about 250 mM, about 100 mM to about 225 mM, about 125 mM to about 225 mM, about 150 mM to about 225 mM, about 175 mM to about 225 mM, about 200 mM to about 225 mM, about 100 mM to about 225 mM, about
  • the concentration of histidine succinate is about 1 mM to about 100 mM (e.g., about 1 mM, about 5 mM, about 10 mM, about 15 mM, about 20 mM, about 25 mM, about 30 mM, about 35 mM, about 40 mM, about 45 mM, about 50 mM, about 55 mM, about 60 mM, about 65 mM, about 70 mM, about 75 mM, about 80 mM, about 85 mM, about 90 mM, about 95 mM, or about 100 mM).
  • the concentration of histidine succinate is about 20 mM.
  • compositions described herein may have a pH of about 4.0 to about 7.0 (e.g., about
  • the pH is from about 4.5 to about 7.0 (e.g., about 4.5, about 5.0, about 5.5, about 6.0, about 6.5, or about 7.0) .
  • the pH is from about 4.5 to about 6.5 (e.g., about 4.5, about 4.6, about 4.7, about 4.8, about 4.9, about 5, about 5.1 , about 5.2, about 5.3, about 5.4, about 5.5 about 5.6, about 5.7, about 5.8, about 5.9, about 6, about 6.1 , about 6.2, about 6.3, about 6.4, or about 6.5).
  • the pH is from about 5.0 to about 6.0 (e.g., about 5.0, about 5.1 , about 5.2, about 5.3, about 5.4, about 5.5, about 5.6, about 5.7, about 5.8, about 5.9, or about 6.0). In some instances, the pH is about 5.5.
  • any suitable surfactant may be used in the compositions described herein.
  • the surfactant is poloxamer 188 or polysorbate 20.
  • Any suitable concentration of poloxamer 188 may be used.
  • the concentration of poloxamer 188 may be about 0.005% to about 0.5%, about
  • the concentration of poloxamer 188 is about 0.01 %, about 0.02%, about 0.03%, about 0.04%, about 0.05%, about 0.06%, about 0.07%, about 0.08%, about 0.09%, or about 0.1 %. In particular embodiments, the concentration of poloxamer 188 is about 0.02%. Any suitable concentration of polysorbate 20 may be used. For example, the concentration of polysorbate 20 may be about 0.005% to about 0.5%, about 0.005% to about 0.05%, or about 0.02%.
  • the concentration of polysorbate 20 is about 0.01 %, about 0.02%, about 0.03%, about 0.04%, about 0.05%, about 0.06%, about 0.07%, about 0.08%, about 0.09%, or about 0.1 %.
  • the composition includes about 150 mg/mL of an anti-tryptase antibody described herein (e.g., hu31A.v1 1), about 200 mM arginine succinate, about 20 mM histidine succinate, about 0.3 mM N-acetyl DL-tryptophan), about 5 mM L-methionine, about 0.02% poloxamer 188, and has a pH of about 5.8.
  • an anti-tryptase antibody described herein e.g., hu31A.v1 1
  • an anti-tryptase antibody described herein e.g., hu31A.v1 1
  • 200 mM arginine succinate about 20 mM histidine succinate, about 0.3 mM N-acetyl DL-tryptophan
  • about 5 mM L-methionine about 0.02% poloxamer 188
  • compositions described herein may be formulated for administration by any suitable route.
  • the composition is formulated for subcutaneous administration or intravenous administration.
  • the composition is formulated for subcutaneous administration.
  • any of the anti-tryptase antibodies or pharmaceutical compositions of the invention may be used in therapeutic methods.
  • an anti-tryptase antibody, or a pharmaceutical composition thereof, for use as a medicament is provided.
  • an anti-tryptase antibody, or a pharmaceutical composition thereof, for use in treating a disorder is provided.
  • an anti-tryptase antibody, or a pharmaceutical composition thereof, for use in a method of treatment is provided.
  • the invention provides an anti-tryptase antibody, or a pharmaceutical composition thereof, for use in a method of treating a subject having a disorder that involves administering to the subject an effective amount of the anti-tryptase antibody.
  • the method further includes administering to the subject an effective amount of at least one additional therapeutic agent, for example, as described below.
  • a "subject" according to any of the above embodiments is preferably a human.
  • the invention provides for the use of an anti-tryptase antibody, or a pharmaceutical composition thereof, in the manufacture or preparation of a medicament.
  • the medicament is for treatment of a disorder.
  • the medicament is for use in a method of treating a disorder comprising administering to a subject having the disorder an effective amount of the medicament. In one such embodiment, the method further comprises
  • a "subject" according to any of the above embodiments may be a human.
  • the invention provides a method for treating a disorder, including, for example, a pulmonary disorder (e.g., asthma (e.g., Th2-high asthma or Th2-low asthma), airway
  • a pulmonary disorder e.g., asthma (e.g., Th2-high asthma or Th2-low asthma)
  • airway e.g., a pulmonary disorder (e.g., asthma (e.g., Th2-high asthma or Th2-low asthma), airway
  • an autoimmune disorder e.g., rheumatoid arthritis, psoriasis, eosinophilic esophagitis, IBD, or Crohn's disease
  • an inflammatory disorder e.g., chronic idiopathic urticaria (CIU or CSU), anaphylaxis, atopic dermatitis, or allergic rhinitis
  • a fibrotic disorder e.g., IPF
  • a granulocytic (neutrophilic or eosinophilic) disorder a monocytic disorder, a lymphocytic disorder, a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia, and a tryptase-associated disorder or tryptase-mediated disorder.
  • the method comprises administering to a subject having a disorder an effective amount of an anti-tryptase antibody, or a pharmaceutical composition thereof. In one such embodiment, the method further comprises administering to the subject an effective amount of at least one additional therapeutic agent, as described below.
  • a "subject" according to any of the above embodiments may be a human.
  • the invention provides pharmaceutical formulations comprising any of the anti- tryptase antibodies provided herein, e.g., for use in any of the above therapeutic methods.
  • a pharmaceutical formulation comprises any of the anti-tryptase antibodies provided herein and a pharmaceutically acceptable carrier.
  • a pharmaceutical formulation comprises any of the anti-tryptase antibodies provided herein and at least one additional therapeutic agent, for example, as described below.
  • Any of the pharmaceutical formulations described in Section F e.g., those that include an antioxidant such as N-acetyltryptophan and/or methionine
  • any of the pharmaceutical formulations described in Section F e.g., those that include an antioxidant such as N-acetyltryptophan and/or methionine
  • the disorder is an autoimmune disorder, an inflammatory disorder, a fibrotic disorder, a granulocytic (neutrophilic or eosinophilic) disorder, a monocytic disorder, a lymphocytic disorder, or a disorder associated with increased numbers or distribution of normal or aberrant tissue resident cells (such as mast cells, macrophages, or lymphocytes) or stromal cells (such as fibroblasts, myofibroblasts, smooth muscle cells, epithelia, or endothelia).
  • the disorder is a pulmonary disorder.
  • the pulmonary disorder is associated with granulocytic (eosinophilic and/or neutrophilic) pulmonary inflammation, infection-induced pulmonary conditions (including those associated with viral (e.g., influenza, parainfluenza, rhinovirus, human metapneumovirus, and respiratory syncytial virus), bacterial, or fungal (e.g., Aspergillus) triggers.
  • granulocytic eosinophilic and/or neutrophilic
  • infection-induced pulmonary conditions including those associated with viral (e.g., influenza, parainfluenza, rhinovirus, human metapneumovirus, and respiratory syncytial virus), bacterial, or fungal (e.g., Aspergillus) triggers.
  • the disorder is an allergen-induced pulmonary condition, a toxic environmental pollutant-induced pulmonary condition (e.g., asbestosis, silicosis, or berylliosis), a gastric aspiration-induced pulmonary condition, or associated with immune dysregu!ation or an inflammatory condition with genetic predisposition such as cystic fibrosis.
  • a physical trauma-induced pulmonary condition e.g., ventilator injury
  • emphysema cigarette-induced emphysema
  • bronchitis sarcoidosis
  • histiocytosis histiocytosis
  • the pulmonary disorder is COPD.
  • the pulmonary disorder is asthma.
  • the asthma is persistent chronic severe asthma with acute events of worsening symptoms (exacerbations or flares) that can be life threatening.
  • the asthma is atopic (also known as allergic) asthma, non-allergic asthma (e.g., often triggered by infection with a respiratory virus (e.g., influenza, parainfluenza, rhinovirus, human metapneumovirus, and respiratory syncytial virus) or inhaled irritant (air pollutants, smog, diesel particles, volatile chemicals and gases indoors or outdoors, or even by cold dry air).
  • a respiratory virus e.g., influenza, parainfluenza, rhinovirus, human metapneumovirus, and respiratory syncytial virus
  • inhaled irritant air pollutants, smog, diesel particles, volatile chemicals and gases indoors or outdoors, or even by cold dry air.
  • the asthma is intermittent or exercise-induced, asthma due to acute or chronic primary or second-hand exposure to "smoke” (typically cigarettes, cigars, pipes), inhaling or “vaping” (tobacco, marijuana or other such substances), or asthma triggered by recent ingestion of aspirin or related NSAIDS.
  • the asthma is mild, or corticosteroid naive asthma, newly diagnosed and untreated asthma, or not previously requiring chronic use of inhaled topical or systemic steroids to control the symptoms (cough, wheeze, shortness of breath/breathlessness, or chest pain).
  • the asthma is chronic, corticosteroid resistant asthma, corticosteroid refractory asthma, asthma uncontrolled on corticosteroids or other chronic asthma controller medications.
  • the asthma is moderate to severe asthma. In certain embodiments, the asthma is Th2-high asthma. In some embodiments, the asthma is severe asthma. In some embodiments, the asthma is atopic asthma, allergic asthma, non-allergic asthma (e.g., due to infection and/or respiratory syncytial virus (RSV)), exercise-induced asthma, aspirin
  • RSV respiratory syncytial virus
  • the asthma is T helper lymphocyte type 2 (Th2) or type 2 (Th2) high, or Type 2 (T2)-driven asthma.
  • the asthma is eosinophilic asthma.
  • the asthma is allergic asthma.
  • the individual has been determined to be Eosinophilic
  • the asthma is periostin-high asthma (e.g., having periostin level at least about any of 20 ng/mL, 25 ng/mL, or 50 ng/mL serum).
  • the asthma is eosinophil-high asthma (e.g., at least about any of 150, 200, 250, 300, 350, 400 eosinophil counts/ml blood).
  • the asthma is Th2-low asthma or nonTh2- driven asthma.
  • the individual has been determined to be Eosinophilic
  • the asthma is periostin-low asthma (e.g., having periostin level less than about 20 ng/mL serum).
  • the asthma is eosinophil-low asthma (e.g., less than about 150 eosinophil counts/ ⁇ blood or less than about 100 eosinophil counts/ ⁇ blood).
  • the individual exhibits elevated level of FeNO (fractional exhaled nitric acid) and/or elevated level of IgE.
  • the individual exhibits a FeNO level above about 250 parts per billion (ppb), above about 275 ppb, above about 300 ppb, above about 325 ppb, above about 325 ppb, or above about 350 ppb.
  • the individual has an IgE level that is above 50 lU/ml.
  • the individual has a forced expiratory volume in 1 second (FEV1) of 40% to 80% of predicted.
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, neutrophilic disorder, or eosinophilic disorder is pulmonary fibrosis.
  • the pulmonary fibrosis is idiopathic pulmonary fibrosis (IPF).
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, granulocytic (neutrophilic or eosinophilic) disorder, monocytic disorder, or lymphocytic disorder is esophagitis (e.g., eosinophilic esophagitis), allergic rhinitis, non-allergic rhinitis, rhinosinusitis with polyps, nasal polyposis, bronchitis, chronic pneumonia, allergic bronchopulmonary aspergillosis, airway inflammation, allergic rhinitis, bronchiectasis, and/or chronic bronchitis.
  • the autoimmune disorder is arthritis.
  • the arthritis is rheumatoid arthritis.
  • the arthritis is osteoarthritis, rheumatoid arthritis, juvenile arthritis, juvenile rheumatoid arthritis, early arthritis, polyarticular rheumatoid arthritis, systemic-onset rheumatoid arthritis, enteropathic arthritis, reactive arthritis, psoriatic arthritis, and/or arthritis as a result of injury.
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, granulocytic (neutrophilic or eosinophilic) disorder, monocytic disorder, or lymphocytic disorder is a gastrointestinal inflammatory condition.
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, granulocytic (neutrophilic or eosinophilic) disorder, monocytic disorder, or lymphocytic disorder is a gastrointestinal inflammatory condition.
  • gastrointestinal inflammatory condition is IBD (inflammatory bowel disease), ulcerative colitis (UC), Crohn's disease (CD), colitis (e.g., colitis caused by environmental insults (e.g., caused by or associated with a therapeutic regimen, such as chemotherapy, radiation therapy, etc.)), infectious colitis, ischemic colitis, collagenous or lymphocytic colitis, necrotizing enterocolitis, colitis in conditions such as chronic granulomatous disease or celiac disease, food allergies, gastritis, gastroenteritis, infectious gastritis or enterocolitis (e.g., Helicobacter pylori-infected chronic active gastritis), esophagitis, and other forms of gastrointestinal inflammation caused by an infectious agent, or indeterminate colitis.
  • IBD inflammatory bowel disease
  • UC ulcerative colitis
  • CD Crohn's disease
  • colitis e.g., colitis caused by environmental insults (e.g., caused by or associated with a therapeutic regimen, such
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, granulocytic (neutrophilic or eosinophilic) disorder, monocytic disorder, or lymphocytic disorder is a gastrointestinal inflammatory condition.
  • the gastrointestinal inflammatory condition is IBD (inflammatory bowel disease).
  • the inflammatory bowel disease is ulcerative colitis (UC) or Crohn's disease (CD).
  • the UC ulcerative colitis
  • CD Crohn's disease
  • colitis e.g., colitis caused by environmental insults (e.g., caused by or associated with a therapeutic regimen, such as chemotherapy, radiation therapy, etc.), infectious colitis, ischemic colitis, collagenous or lymphocytic colitis, necrotizing enterocolitis, colitis in conditions such as chronic granulomatous disease or celiac disease, food allergies, gastritis, gastroenteritis, infectious gastritis or enterocolitis (e.g., Helicobacter pylori-infected chronic active gastritis), and other forms of gastrointestinal inflammation caused by an infectious agent, or indeterminate colitis.
  • colitis e.g., colitis caused by environmental insults (e.g., caused by or associated with a therapeutic regimen, such as chemotherapy, radiation therapy, etc.)
  • infectious colitis ischemic colitis, collagenous or lymphocytic colitis, necrotizing enterocolitis, colitis in conditions such as chronic granulomatous disease or celiac disease, food allergies,
  • the gastrointestinal inflammatory condition is ulcerative colitis (UC) or Crohn's disease (CD).
  • the gastrointestinal inflammatory condition is ulcerative colitis (UC).
  • the ulcerative colitis is mild to moderate distal colitis.
  • the ulcerative colitis is mild to moderate extensive colitis.
  • the ulcerative colitis is severe colitis.
  • the gastrointestinal inflammatory condition is Crohn's disease (CD), in some embodiments, the Crohn's disease is in acute disease stage, in some embodiments, the Crohn's disease is in induced clinical remission stage. In some embodiments, the Crohn's disease is in maintain response/remission stage.
  • the Crohn's disease is mild to moderate disease, in some embodiments, the Crohn's disease is moderate to severe disease. In some embodiments, the Crohn's disease is severe/fuliminant disease. In some embodiments, the Crohn's disease is ileal, ileocolonic, or colonic disease.
  • tissue resident cells such as mast cells, macrophages
  • the autoimmune disorder, inflammatory disorder, or fibrotic disorder is related to sepsis and/or trauma, HIV infection, or idiopathic (of unknown etiology) such as ANCA-associated vaculitides (AAV), granulomatosis with polyangiitis (formerly known as Wegener's granulomatosis), Behcet's disease, cardiovascular disease, eosinophilic bronchitis, Reiter's Syndrome, SEA Syndrome (Seronegativity, Enthesopathy, Arthropathy Syndrome), ankylosing spondylitis, dermatomyositis, scleroderma, e.g., systemic scleroderma also called systemic sclerosis, vasculitis (e.g., Giant Cell Arteritis (GCA), also called temporal arteritis, cranial arteritis or Horton disease), myositis, polymyositis, dermatomyos
  • GCA Giant Cell Arte
  • the disorder is an inflammatory disorder of the skin.
  • the disorder is atopic dermatitis or onchocercal dermatitis.
  • the disorder is chronic idiopathic urticaria (ClU or CSU).
  • the method further comprises administering an IL-13 antagonist, an IL-33 antagonist, an IgE antagonist, a calcium inhibitor, a leukotrieine inhibitor, or an antihistamine.
  • the IL-13 antagonist is lebrikizumab.
  • the IgE antagonist is omalizumab or ligelizumab.
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, neutrophilic disorder, or eosinophilic disorder is a fibrotic disorder.
  • the fibrotic disorders include lung fibrosis, liver fibrosis (e.g., fibrosis associated with cirrhosis (e.g., alcohol-induced cirrhosis, viral-induced cirrhosis, post-hepatitis C cirrhosis, and primary biliary cirrhosis), schistosomiasis, cholangitis (e.g., sclerosing cholangitis), and autoimmune-induced hepatitis), kidney fibrosis (e.g., tubulointerstitial fibrosis, scleroderma, diabetic nephritis, and glomerular nephritis), dermal fibrosis (e.g., scleroderma, hypertrophic and keloid scarring, nephrogenic fibrosing dermatopathy, and burns), myelofibrosis, neurofibromatosis, fibroma, intestinal fibrosis, and fibrotic
  • vitreoretinopathy, and retro-orbital fibrosis e.g., idiopathic myelofibrosis and drug-induced myelofibrosis
  • the fibrosis can be organ-specific or systemic (e.g., systemic sclerosis and fibrosis associated with GVHD).
  • the fibrotic disorder is pulmonary fibrosis.
  • the pulmonary fibrosis is fibrosing interstitial pneumonia.
  • the pulmonary fibrosis is idiopathic pulmonary fibrosis (IPF), also known as cryptogenic fibrosing alveolitis.
  • IPF idiopathic pulmonary fibrosis
  • the IPF is gender, age and physiology (GAP)-stage I. In some embodiments, the IPF is GAP-stage II. In some embodiments, the IPF is GAP-stage III. In some embodiments, the pulmonary fibrosis is sporadic IPF. In some embodiments, the pulmonary fibrosis is familial pulmonary fibrosis. In some embodiments, the pulmonary fibrosis is combined pulmonary fibrosis and emphysema.
  • the pulmonary fibrosis is associated with one or more of the following: usual interstitial pneumonia; idiopathic interstitial pneumonia; desquamative interstitial pneumonia; respiratory bronchiolitis-interstitial lung disease; acute interstitial pneumonia; nonspecific interstitial pneumonia; sarcoidosis; cryptogenic organizing pneumonia; eosinophilic pneumonia; infection; exposure to occupational or environmental agents; cigarette smoking; interstitial lung disease induced by drugs or radiation; rheumatic disease-associated interstitial lung disease; lymphoid interstitial pneumonia;
  • pleuropulmonary fibroelastosis pleuropulmonary fibroelastosis; pulmonary Langerhans cell histiocytosis; systemic sclerosis-interstitial lung disease; Hermansky-Pudlak syndrome; and telomeropathy.
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, neutrophilic disorder, or eosinophilic disorder is chronic obstructive pulmonary disease (COPD).
  • COPD chronic obstructive pulmonary disease
  • the COPD is Global Initiative for Chronic Obstructive Lung Disease (GOLD) category A.
  • the COPD is GOLD category B.
  • the COPD is GOLD category C.
  • the COPD is GOLD category D.
  • the COPD is chronic bronchitis.
  • the COPD is emphysema.
  • the emphysema is proximal acinar, panacinar, or distal acinar emphysema. In some embodiments, the emphysema is cigarette-induced emphysema. In some embodiments, the COPD is associated with exposure to particulate dusts, chemical fumes, and/or air pollution. In some
  • the COPD is associated with impaired lung development. In some embodiments, the COPD is chronic obstructive asthma. In some embodiments, the COPD is associated with alpha-1 antitrypsin deficiency. In some embodiments, the COPD is associated with serine protease inhibitor clade E, member 2 (SERPINE2) disruption. In some embodiments, the COPD is COPD with persistent systemic inflammation. In some embodiments, the COPD is eosinophilic or T-helper type 2 ( ⁇ 2) high COPD. In some embodiments, the COPD is COPD with persistent bacterial colonization. In some embodiments, the COPD is COPD with frequent exacerbations.
  • SERPINE2 serine protease inhibitor clade E, member 2
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, neutrophilic disorder, or eosinophilic disorder is asthma- COPD overlap syndrome (ACOS).
  • ACOS is eosinophil-predominant, neutrophil-predominant, mixed-pattern, or no inflammation (paucigranulocytic) ACOS.
  • the autoimmune disorder, inflammatory disorder, fibrotic disorder, a neutrophilic disorder, or an eosinophilic disorder is COPD-obstructive sleep apnea (OSA) overlap syndrome.
  • OSA COPD-obstructive sleep apnea
  • Antibodies of the invention, or pharmaceutical compositions thereof, can be used either alone or in combination with other agents in a therapy.
  • an antibody of the invention, or a pharmaceutical compositions thereof may be co-administered with at least one additional therapeutic agent.
  • an additional therapeutic agent is an interleukin-13 (IL-13) binding antagonist, an interleukin-17 (IL-17) axis binding antagonist, an interleukin-5 (IL-5) axis binding antagonist, or an IL-33 axis binding antagonist.
  • the IL-13 axis binding antagonist is an anti-IL-13 antibody, for example, lebrikizumab.
  • the IL-5 axis binding antagonist is an IL-5 binding antagonist or an IL-5 receptor binding antagonist.
  • an IL-33 axis binding antagonist is an IL-33 binding antagonist or an ST2 binding antagonist.
  • the IL-33 binding antagonist is an anti-IL-33 antibody.
  • an additional therapeutic agent is an asthma therapy, as described below.
  • Moderate asthma is currently treated with a daily inhaled anti-inflammatory-corticosteroid or mast cell inhibitor such as cromolyn sodium or nedocromil plus an inhaled beta2-agonist as needed (3-4 times per day) to relieve breakthrough symptoms or allergen- or exercise-induced asthma.
  • exemplary inhaled corticosteroids include QVAR®, PULMICORT®, SYMBICORT®, AEROBID®, FLOVENT®, FLONASE®, ADVAIR®, and AZMACORT®.
  • Additional asthma therapies include long acting bronchial dilators (LABD).
  • the LABD is a long-acting beta-2 agonist (LABA), leukotriene receptor antagonist (LTRA), long-acting muscarinic antagonist (LAMA), theophylline, or oral corticosteroids (OCS).
  • LAA long-acting beta-2 agonist
  • LTRA leukotriene receptor antagonist
  • LAMA long-acting muscarinic antagonist
  • OCS oral corticosteroids
  • Exemplary LABDs include SYMBICORT®, ADVAIR®, BROVANA®, FORADIL®, PERFOROMISTTM, and SEREVENT®.
  • the method further comprises administering a bronchodilator or asthma symptom controller medication.
  • the bronchodilator or asthma controller medication is a p2-adrenergic agonist, such as a short-acting p2-agonist (SABA) (such as albuterol), or a long-acting p2-adrenergic agonist (LABA).
  • SABA short-acting p2-agonist
  • LABA long-acting p2-adrenergic agonist
  • the LABA is salmeterol, abediterol, indacaterol, vilanterol, and/or formoterol (formoterol fumarate dehydrate).
  • the asthma controller medication is a Leukotriene Receptor Antagonist (LTRA).
  • the LTRA is montelukast, zafirlukast, and/or zileuton.
  • the bronchodilator or asthma controller medication is a muscarinic antagonist, such as a long-acting muscarinic acetylcholine receptor (cholinergic) antagonist (LAMA).
  • LAMA muscarinic acetylcholine receptor
  • the LAMA is glycopyrronium.
  • the bronchodilator or asthma controller medication is an agonist of an ion channel such as a bitter taste receptor (such as TAS2R).
  • the method further comprises administering a bronchodilator.
  • the bronchodilator is an inhaled bronchodilator.
  • the inhaled bronchodilator is a p2-adrenergic agonist.
  • the p2- adrenergic agonist is a short-acting p2-adrenergic agonist (SABA).
  • SABA is bitolterol, fenoterol, isoproterenol, levalbuterol, metaproterenol, pirbuterol, procaterol, ritodrine, albuterol, and/or terbutaline.
  • the p2-adrenergic agonist is a long-acting p2-adrenergic agonist (LABA).
  • LABA is arformoterol, bambuterol, clenbuterol, formoterol, salmeterol, abediterol, carmoterol, indacaterol, olodaterol, and/or vilanterol.
  • the inhaled bronchodilator is a muscarinic receptor antagonist.
  • the muscarinic receptor antagonist is a short-acting muscarinic receptor antagonist (SAMA).
  • SAMA short-acting muscarinic receptor antagonist
  • the SAMA is ipratropium bromide.
  • the muscarinic receptor antagonist is a long-acting muscarinic receptor antagonist (LAMA).
  • LAMA is tiotropium bromide, glycopyrronium bromide, umeclidinium bromide, aclidinium bromide, and/or revefenacin.
  • the inhaled bronchodilator is a SABA/SAMA combination.
  • SABA/SAMA combination is albuterol/ipratropium.
  • the inhaled bronchodilator is a LABA/LAMA combination.
  • the LABA/LAMA combination is formoterol/aclidinium, formoterol/glycopyrronium, formoterol/tiotropium, indacaterol/glycopyrronium, indacaterol/tiotropium, olodaterol/tiotropium, salmeterol/tiotropium, and/or vilanterol/umeclidinium.
  • the inhaled bronchodilator is a bifunctional bronchodilator.
  • the bifunctional bronchodilator is a muscarinic antagonist/p2-agonist (MABA).
  • the MABA is batefenterol, THRX 200495, AZD 21 15, LAS 190792, TEI3252, PF-3429281 and/or PF-4348235.
  • the inhaled bronchodilator is an agonist of TAS2R.
  • the bronchodilator is a nebulized SABA.
  • the nebulized SABA is albuterol and/or levalbuterol.
  • the bronchodilator is a nebulized LABA.
  • the nebulized LABA is arformoterol and/or formoterol.
  • the bronchodilator is a nebulized SAMA. In some embodiments, the nebulized SAMA is ipratropium. In some embodiments, the bronchodilator is a nebulized LAMA. In some embodiments, the nebulized LAMA is glycopyrronium and/or revefenacin. In some embodiments, the bronchodilator is a nebulized SABA/SAMA combination. In some embodiments, the nebulized SABA/SAMA combination is albuterol/ipratropium. In some embodiments, the bronchodilator is a leukotriene receptor antagonist (LTRA).
  • LTRA leukotriene receptor antagonist
  • the LTRA is montelukast, zafirlukast, and/or zileuton.
  • the bronchodilator is a methylxanthine.
  • the methylxanthine is theophylline.
  • the method further comprises administering an immunomodulator.
  • the immunomodulator is an antibody to immunoglobulin type E (IgE) or anti-lgE (an IgE inhibitor).
  • the anti-lgE is omalizumab and/or ligelizumab.
  • the method further comprises cromolyn.
  • the method further comprises methylxanthine.
  • the methylxanthine is theophylline or caffeine.
  • the method further comprises administering one or more corticosteroids, such as an inhaled corticosteroid (ICS) or an oral corticosteroid.
  • corticosteroids include inhaled corticosteroids, such as beclomethasone dipropionate, budesonide, ciclesonide, flunisolide, fluticasone propionate, fluticasone furoate, mometasone, and/or triamcinolone acetonide and oral corticosteroids, such as methylprednisolone, prednisolone, and prednisone.
  • the corticosteroid is an ICS.
  • the ICS is beclomethasone, budesonide, flunisolide, fluticasone furoate, fluticasone propionate, mometasone, ciclesonide, and/or triamcinolone.
  • the method further comprises administering an ICS/LABA and/or LAMA combination.
  • the ICS/LABA and/or LAMA combination is fluticasone propionate/salmeterol, budesonide/formoterol,
  • beclomethasone/formoterol fluticasone furoate/umeclidinium, fluticasone furoate/vilanterol/umeclidinium, fluticasone/salmeterol/tiotropium, beclomethasone/formoterol/glycopyrronium,
  • the method further comprises administering a nebulized corticosteroid.
  • the nebulized corticosteroid is budesonide.
  • the method further comprises administering an oral or intravenous corticosteroid.
  • the oral or intravenous corticosteroid is prednisone, prednisolone, methylprednisolone, and/or hydrocortisone
  • the method further comprises administering a TH2 or T2 pathway inhibitor that inhibits one or more targets selected from ITK, BTK, JAK (JAK1 , JAK2 and/or JAK3), IL-9, IL-6, IL-5, IL-13, IL-4, IL-17 (e.g., IL-17A and IL-17F), OX40L, TSLP, IL-25, IL-33, IgE, IL-9 receptor, IL-5 receptor, IL-4 receptor a, IL-13 receptor (e.g., IL-13 receptor a1 and/or a2), OX40, TSLP-R, IL-7 receptor (e.g., IL7Ra), IL-17 receptor (e.g., IL-17Rp), ST2 (IL-33 receptor), CCR3, CCR4, CRTH2, FceRI, FceRII/CD23, Flap, Syk kinase; CCR4, TLR9, CCR3,
  • the method further comprises administering an IL-5 antagonist.
  • the IL-5 antagonist is benralizumab, mepolizumab, and/or reslizumab.
  • the method further comprises administering an IL-13 antagonist.
  • the IL-13 antagonist is lebrikizumab, dectrekumab, or tralokinumab.
  • the method further comprises administering an IL-4 antagonist (including an IL-4/IL-13 antagonist).
  • the IL-4 antagonist is dupilumab or QBX-258 (Novartis).
  • the method further comprises administering a TSLP antagonist.
  • the TSLP antagonist is AMG-157 (MEDI-9929). In some embodiments, the method further comprises administering an ST2 antagonist. In some embodiments, the method further comprises administering an IL-17 antagonist. In some embodiments, the IL-17 antagonist is secukinumab, ixekizumab or bimekizumab. In some embodiments of any of the methods, the method further comprises administering fevipiprant. In some embodiments of any of the methods, the method further comprises administering masitinib. In some embodiments of any of the methods, the method further comprises administering a phosphodiesterase (PDE) inhibitor or antagonist, such as a PDE3 and/or PDE4 antagonist. In some embodiments, the PDE antagonist is Theo-24, daliresp, or roflumilast.
  • PDE phosphodiesterase
  • the method further comprises administering one or more active ingredients selected from an aminosalicylate; a steroid; a biological; a thiopurine;
  • the method comprises administering the further active ingredient in an oral or topical formulation.
  • aminosalicylates include 4-aminosalicylic acid, sulfasalazine, balsalazide, olsalazine and mesalazine, in forms like Eudragit-S-coated, pH-dependent mesalamine, ethylcellulose-coated mesalamine, and multimatrix-release mesalamine.
  • a steroid include corticosteroids or glucocorticosteroids. Examples of a corticosteroid include prednisone and
  • bioiogicals include etanercept; an antibody to tumor necrosis factor alpha, e.g. infliximab, adaiimumab or certoiizumab; an antibody to IL-12 and IL-23, e.g. ustekinumab; vedoiizumab; etrolizumab, and nataiizumab.
  • thiopurines examples include azathioprine, 6-mercaptopurine and thioguanine.
  • antibiotics include vancomycin, rifaximin, metronidazole, trimethoprim, sulfamethoxazole, diaminodiphenyi suifone and ciprofloxacin; and antiviral agents like ganciclovir
  • the method further comprises administering an antifibrotic agent.
  • the antifibrotic agent inhibits transforming growth factor beta (TGF-p)-stimulated collagen synthesis, decreases the extracellular matrix, and/or blocks fibroblast proliferation.
  • TGF-p transforming growth factor beta
  • the antifibrotic agent is pirfenidone.
  • the antifibrotic agent is PBI-4050.
  • the antifibrotic agent is tipelukast.
  • the method further comprises administering a tyrosine kinase inhibitor.
  • the tyrosine kinase inhibitor inhibits a tyrosine kinase that mediates elaboration of one or more fibrogenic growth factors.
  • the fibrogenic growth factor is platelet-derived growth factor, vascular endothelial growth factor, and/or fibroblast growth factor.
  • the tyrosine kinase inhibitor is imatinib and/or nintedanib.
  • the tyrosine kinase inhibitor is nintedanib.
  • the method further comprises administering an antidiarrheal agent.
  • the antidiarrheal agent is loperamide.
  • the method further comprises administering an antibody.
  • the antibody is an anti-interleukin (IL)-13 antibody.
  • the anti-IL-13 antibody is tralokinumab.
  • the antibody is an anti-IL- 4/anti-IL-13 antibody.
  • the anti-IL-4/anti-IL-13 antibody is SAR 156597.
  • the antibody is an anti-connective tissue growth factor (CTGF) antibody.
  • CTGF connective tissue growth factor
  • the anti-CTGF antibody is FG-3019.
  • the antibody is an anti-lysyl oxidase-like 2 (LOXL2) antibody.
  • the anti-LOXL2 antibody is secretuzumab.
  • the antibody is an anti-avp6 integrin receptor antibody.
  • the anti-avp6 integrin receptor antibody is STX-100.
  • the antibody is a monoclonal antibody.
  • the method further comprises administering a lysophosphatidic acid-1 (LPA1) receptor antagonist.
  • LPA1 receptor antagonist is BMS-986020.
  • the method further comprises administering a galectin 3 inhibitor.
  • the galectin 3 inhibitor is TD-139.
  • the method further comprises administering a palliative therapy.
  • the palliative therapy comprises one or more of an antibiotic, an anxiolytic, a corticosteroid, and an opioid.
  • the antibiotic is a broad-spectrum antibiotic.
  • the antibiotic is penicillin, a ⁇ -lactamase inhibitor, and/or a
  • the antibiotic is piperacillin/tazobactam, cefixime, ceftriaxone and/or cefdinir.
  • the anxiolytic is alprazolam, buspirone, chlorpromazine, diazepam, midazolam, lorazepam, and/or promethazine.
  • the corticosteroid is a glucocorticosteroid.
  • the glucocorticosteroid is prednisone, prednisolone, methylprednisolone, and/or hydrocortisone.
  • the opioid is morphine, codeine, dihydrocodeine, and/or diamorphine.
  • the method further comprises administering an antibiotic.
  • the antibiotic is a macrolide.
  • the macrolide is azithromycin, and/or clarithromycin.
  • the antibiotic is doxycycline.
  • the antibiotic is trimethoprim/sulfamethoxazole.
  • the antibiotic is a cephalosporin.
  • the cephalosporin is cefepime, cefixime, cefpodoxime, cefprozil, ceftazidime, and/or cefuroxime.
  • the antibiotic is penicillin.
  • the antibiotic is amoxicillin, ampicillin, and/or pivampicillin. In some embodiments, the antibiotic is a penicillin/p-lactamase inhibitor combination. In some embodiments, the penicillin/p-lactamase inhibitor combination is amoxicillin/clavulanate and/or piperacillin/tazobactam. In some embodiments, the antibiotic is a fluoroquinolone. In some embodiments, the fluoroquinolone is ciprofloxacin, gemifloxacin, levofloxacin, moxifloxacin, and/or ofloxacin. In some embodiments of any of the methods, the method further comprises administering a phosphodiesterase inhibitor. In some embodiments, the phosphodiesterase inhibitor is a
  • the phosphodiesterase inhibitor is avanafil, benzamidenafil, dasantafil, icariin, lodenafil, mirodenafil, sildenafil, tadalafil, udenafil, and/or vardenafil.
  • the PDE inhibitor is a PDE-4 inhibitor.
  • the PDE-4 inhibitor is roflumilast, cilomilast, tetomilast, and/or CHF6001 .
  • the PDE inhibitor is a PDE- 3/PDE-4 inhibitor.
  • the PDE-3/PDE-4 inhibitor is RPL-554.
  • the method further comprises administering a cytotoxic and/or immunosuppressive agent.
  • a cytotoxic and/or immunosuppressive agent in some embodiments, the cytotoxic and/or
  • the immunosuppressive agent is azathioprine, colchicine, cyclophosphamide, cyclosporine, methotrexate, penicillamine, and/or thalidomide.
  • the method further comprises administering an agent that restores depleted glutathione levels in the lung.
  • the agent that restores depleted glutathione levels in the lung is /V-acetylcysteine.
  • the method further comprises administering an anticoagulant.
  • the anticoagulant is warfarin, heparin, activated protein C, and/or tissue factor pathway inhibitor.
  • the method further comprises administering an endothelin receptor antagonist.
  • the method endothelin receptor antagonist is bosentan, macitentan, and/or ambrisentan.
  • the method further comprises administering a TNF-a antagonist.
  • the TNF-a antagonist comprises one or more of etanercept, adalimumab, infliximab, certolizumab, and golimumab.
  • the method further comprises administering interferon gamma-1 b.
  • the method further comprises administering an interleukin (IL) inhibitor.
  • IL interleukin
  • the IL inhibitor is an IL-5 inhibitor.
  • the IL-5 inhibitor is mepolizumab and/or benralizumab.
  • the IL inhibitor is an IL- 17A inhibitor.
  • the IL-17A inhibitor is CNTO-6785.
  • the method further comprises administering a p38 mitogen-activated protein kinase (MAPK) inhibitor.
  • the p38 MAPK inhibitor is losmapimod and/or AZD-7624.
  • the method further comprises administering a CXCR2 antagonist.
  • the CXCR2 antagonist is danirixin.
  • the method further comprises vaccination.
  • the vaccination is vaccination against pneumococci and/or influenza.
  • the vaccination is vaccination against Streptococcus pneumoniae and/or influenza.
  • the method further comprises administering an antiviral therapy.
  • the antiviral therapy is oseltamivir, peramivir, and/or zanamivir.
  • the method further comprises prevention of gastroesophageal reflux and/or recurrent microaspiration.
  • the method further comprises ventilatory support.
  • the ventilatory support is mechanical ventilation.
  • the ventilatory support is noninvasive ventilation.
  • the ventilatory support is supplemental oxygen.
  • the method further comprises pulmonary rehabilitation.
  • the method further comprises lung transplantation.
  • the lung transplantation is single lung transplantation. In some embodiments, the lung transplantation is bilateral lung transplantation.
  • the method further comprises a non- pharmacological intervention.
  • the non-pharmacological intervention is smoking cessation, a healthy diet, and/or regular exercise.
  • the method further comprises administering a pharmacological aid for smoking cessation.
  • the pharmacological aid for smoking cessation is nicotine replacement therapy, bupropion, and/or varenicline.
  • the non-pharmacological intervention is lung therapy.
  • the lung therapy is pulmonary rehabilitation and/or supplemental oxygen.
  • the non-pharmacological intervention is lung surgery.
  • the lung surgery is lung volume reduction surgery, single lung transplantation, bilateral lung transplantation, or bullectomy.
  • the non-pharmacological intervention is the use of a device.
  • the device is a lung volume reduction coil, an exhale airway stent, and/or a nasal ventilatory support system.
  • combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of an anti-tryptase antibody, or a pharmaceutical composition thereof, can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent(s).
  • administration of an anti-tryptase antibody, or a pharmaceutical composition thereof, and administration of an additional therapeutic agent occur within about one month; or within about one, two, or three weeks; or within about one, two, three, four, five, or six days; or within about 1 , 2, 3, 4, 5, 6, 7, 8, or 9 hours; or within about 1 , 5, 10, 20, 30, 40, or 50 minutes, of each other.
  • the anti-tryptase antibody may be administered prior to or after administration of the additional therapeutic agent(s).
  • An anti-tryptase antibody of the invention can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal administration.
  • Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
  • an anti-tryptase antibody of the invention may be administered intravitreally, intramuscularly, intravenously, intradermal ⁇ , percutaneously, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly,
  • the antibody, or a pharmaceutical composition thereof can be administered by subcutaneous administration.
  • the compositions utilized in the methods described herein can also be administered systemically or locally. Dosing can be by any suitable route, for example, by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
  • Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus
  • Antibodies of the invention, or pharmaceutical compositions thereof, would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
  • the antibody, or pharmaceutical composition thereof need not be, but is optionally formulated with one or more agents currently used to prevent or treat the disorder in question. The effective amount of such other agents depends on the amount of antibody present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
  • an antibody of the invention when used alone or in combination with one or more other additional therapeutic agents, will depend on the type of disease to be treated, the type of antibody, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician.
  • the antibody is suitably administered to the patient at one time or over a series of treatments.
  • about 1 ⁇ g/kg to 15 mg/kg (e.g., 0.1 mg/kg to 10 mg/kg) of antibody can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
  • One typical daily dosage might range from about 1 ⁇ g/kg to 200 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment would generally be sustained until a desired suppression of disease symptoms occurs.
  • One exemplary dosage of the antibody would be in the range from about 0.05 mg/kg to about 10 mg/kg.
  • one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the patient.
  • Such doses may be administered intermittently, e.g., every week, every two weeks, every three weeks, or every four weeks (e.g., such that the patient receives from about two to about twenty, or e.g. , about six doses of the antibody). For example, a dose may be administered once per month, (e.g., by
  • a dose of about 50 mg/mL to about 200 mg/mL (e.g., about 50 mg/mL, about 60 mg/mL, about 70 mg/mL, about 80 mg/mL, about 90 mg/mL, about 100 mg/mL, about 1 10 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about 180 mg/mL, about 190 mg/mL, or about 200 mg/mL of an antibody may be administered, e.g., by subcutaneous injection. In some instances, about 150 mg/mL of an antibody may be administered by subcutaneous injection.
  • an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above (e.g., tryptase-associated disorders) is provided.
  • the article of manufacture comprises a container and a label or package insert on or associated with the container.
  • Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • At least one active agent in the composition is an antibody of the invention, or a pharmaceutical composition thereof.
  • the label or package insert indicates that the composition is used for treating the condition of choice.
  • the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises an antibody of the invention; and (b) a second container with a composition contained therein, wherein the composition comprises an additional therapeutic agent.
  • the article of manufacture in this embodiment of the invention may further comprise a package insert indicating that the compositions can be used to treat a particular condition.
  • the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
  • BWFI bacteriostatic water for injection
  • Ringer's solution such as phosphate
  • any of the above articles of manufacture may include an immunoconjugate of the invention in place of or in addition to an anti-tryptase antibody. 111. Examples
  • Residue numbers are according to Kabat et al. Sequences of proteins of immunological interest, 5 th Ed., Public Health Service, National Institutes of Health, Bethesda, MD, 1991 . (i) Recombinant expression and purification of tryptase in insect cells and mammalian cells The sequence encoding mature wild-type human tryptase beta 1 (Ile16 - Pro246
  • tryptase refers to human tryptase beta 1 (also referred to as human tryptase b1).
  • the construct contains an N-terminal His6 tag, an enterokinase cleavage site and, for some constructs, a C-terminal FLAG tag.
  • Site-directed mutagenesis was performed using standard QuikChangeTM protocols (Stratagene) to generate tryptase mutants. All constructs were confirmed by DNA sequencing.
  • Recombinant baculoviruses were generated using the BaculoGoldTM system (BD Biosciences) in Sf9 cells following standard protocols. Trichoplusia ni cells were infected for large-scale protein production and harvested 48 h post-infection. The harvested media was supplemented with 1 mM NiC , 5 mM CaCh and 20 mM Tris pH 8, shaken for 30 min, and then centrifuged for 20 min at 8500 x g to remove the cells and precipitate from media. The supernatant media was filtered through a 0.22 ⁇ polyethersulfone (PES) filter prior to loading onto a nickel-nitrilotriacetic acid (Ni-NTA) affinity column. Human tryptase beta 1 was also expressed by transient transfection in the CHO DP12 mammalian cell line. Cell culture media was subjected to the same purification starting with Ni-NTA affinity purification as described below.
  • PES polyethersulfone
  • Insect cell media or CHO cell media containing secreted His6-tagged recombinant tryptase (wild- type or mutant) was loaded onto a 10 ml_ Ni-NTA Superflow column (Qiagen) at a volumetric flow rate of 170 cm/h.
  • the column was washed with 10 CV (column volumes) of wash buffer (20 mM Tris pH 8, 10 mM imidazole, 300 mM NaCI) and eluted with 8 CV elution buffer (20 mM Tris pH 8, 300 mM imidazole, 300 mM NaCI).
  • Recombinant tryptase was then cleaved overnight at room temperature at a concentration of 2 mg/ml in buffer (10 mM MOPS pH 6.8, 0.2 M NaCI) containing 0.5 mg/ml heparin (Sigma Aldrich) and 0.1 mg/ml enterokinase (New England Biolabs, Inc). This step removes the N-terminal His6-tag and results in tetramerization and proteolytically active tryptase, which has IVGG as the newly formed N-terminal sequence starting at residue 16 (chymotrypsinogen numbering). Tetrameric tryptase was then subjected to size exclusion
  • Two rabbits were immunized with CHO-derived human tryptase beta 1 (tetramer) with Freund's Complete Adjuvant (CFA). The rabbits were boosted with the same protein, with Freund's Incomplete Adjuvant (IFA), once every 2 weeks. Following 4 injections, purified serum samples were evaluated for binding by enzyme-linked immunosorbent assay (ELISA) and inhibition of human tryptase activity using an enzymatic activity assay. B cells from spleen harvested from one of the rabbits, which demonstrated inhibition of human tryptase activity, were then fused with a rabbit fusion partner. After 10-14 days, the supernatants were harvested and screened for protein binding by ELISA.
  • ELISA enzyme-linked immunosorbent assay
  • the ELISA protocol was as follows. 96-well NUNC MAXISORB® ELISA plates were coated overnight with NeutrAvidin® Biotin Binding Protein (Thermo Scientific Catalog No. 31000, stock 10 mg/ml) at 5 g/ml, 100 ⁇ /well. The wells were washed three times with Wash Buffer (PBS with 0.05% TWEEN®- 20) and blotted dry. The wells were then blocked with 200 ⁇ /well of Blocking Buffer (PBS with 0.5% bovine serum albumin (BSA) and 0.05% TWEEN®-20) and incubated for greater than or equal to 30 min at room temperature.
  • Wash Buffer PBS with 0.05% TWEEN®- 20
  • BSA bovine serum albumin
  • Biotinylated human tryptase beta 1 protein (diluted in Assay Buffer; PBS with 0.5% BSA, 0.05% TWEEN®-20, and 0.1 mg/ml heparin) was added to the wells at 1 ⁇ g/ml and incubated at room temperature for 1 h ⁇ 10 min. Heparin was included to ensure that tryptase remained as a tetramer. The wells were washed three times with wash buffer (200 ⁇ /well) and blotted dry.
  • Hybridoma supernatants (samples) or controls (e.g., the positive controls rabbit purified polyclonal antibody YZ4209 (stock 0.25 mg/ml) were added to the wells (diluted in Assay Buffer, 100 ⁇ /well) and incubated at room temperature for 1 h. Next, the wells were washed three times with wash buffer (200 ⁇ /well) and blotted dry. Horseradish peroxidase (HRP) conjugate (goat anti-rabbit IgG (H+L) HRP; Thermo Scientific Catalog No. 31460) was added (diluted 1 :10,000 in Assay Buffer, 100 ⁇ /well) and incubated at room temperature for 30 min.
  • HRP horseradish peroxidase
  • the wells were again washed three times with wash buffer (200 ⁇ /well) and blotted dry.
  • the substrate (BioFX TMB Substrate, Product No.: TMBW-1000-01) was added (100 ⁇ /well) and incubated for 5 min at room temperature. The reaction was stopped by addition of 100 ⁇ /well of BioFX stop solution (Product No.: BSTP-0100-01), and the plates were read at A65o.
  • ELISA-positive clones were purified by affinity chromatography using standard methods (MabSelect SuReTM; GE Healthcare) and then screened for inhibition of human tryptase activity in a recombinant tryptase activity assay. Briefly, antibodies were diluted from 0.007 to 100,000 ng/mL (0.046 pM to 667 nM) in PBS, pH 7.4.
  • Recombinant human tryptase beta 1 was diluted to 3 nM in TNH Buffer (200 mM Tris, 150 mM NaCI, 0.1 mg/mL heparin, 0.01 % TRITONTM X-100, pH 8.0) and combined 1 :1 with anti-tryptase antibodies in black 384-well plates (ViewPlate-384 F, Black, Clear-Bottom, Perkin Elmer, Catalog No. 6007470). Plates were incubated for 1 h at ambient temperature with gentle agitation. Colorimetic substrate S-2288 (Chromogenix, Part No. 82-0852-39) was diluted to 900 ⁇ in TNH Buffer and was added to the plate.
  • Final in-well concentrations were 300 ⁇ S-2288, 1 nM recombinant human tryptase beta 1 , and 0.015 pM to 222 nM anti-tryptase antibodies. Plates were incubated for 40 min at ambient temperature with gentle agitation and then were read at A405. The half-maximal inhibitory concentration (IC50) of the anti-tryptase antibodies were determined from a four-parameter fit of their respective curves. Clones demonstrating the desired inhibition were then subcloned by limiting dilution (single cell/well), retested as described above and further characterized. Mouse hybridomas were generated and screened and positive clones were analyzed in a similar manner.
  • mice Three A/J mice (Harlan, Indianapolis, Ind.) were immunized with purified tryptase protein as the antigen (EPC, Inc. #TR913). Enzymatically active tryptase as administed at 20 ⁇ g/mouse per immunization subcutaneously and intraperitoneally after mixing and emulsifying 1 :1 with Complete Freund's Adjuvant (first immunization) or Incomplete Freund's Adjuvant (second, third, and fourth immunization). The boost (fifth immunization) had no adjuvant.
  • Heavy chain (HC) forward primer :
  • the LC and HC reverse primers were designed to anneal to a region in the constant light (CL) and constant heavy domain 1 (CH1).
  • VL and VH (SEQ ID NO: 52) domains from the rabbit anti-tryptase monoclonal antibody E104 were aligned with the human VL kappa I (VLKI) and human VH subgroup IV (VHiv) consensus sequences (SEQ ID NOs: 92 and 93, respectively). See, e.g., Dennis, Ch. 2 CDR Repair: A Novel Approach to Antibody Humanization in Current Trends in Monoclonal Antibody
  • HVR hypervariable regions
  • VLKI human VL kappa I
  • VHm human VH subgroup III
  • a DNA sequence encoding the VH domain of huE104.v2 is shown in SEQ ID NO: 109.
  • a DNA sequence encoding the VL domain of huE104. v2 is shown in SEQ ID NO: 1 10.
  • a DNA sequence encoding the heavy chain (lgG1) is shown in SEQ ID NO: 11 1 .
  • a DNA sequence encoding the heavy chain (lgG4.S228P) is shown in SEQ ID NO: 1 13.
  • a DNA sequence encoding the light chain (lgG1 and lgG4) is shown in SEQ ID NO: 1 12.
  • the amino acid sequence of the heavy chain (HC) of huE104. v2 lgG1 is shown in SEQ ID NO: 80.
  • the amino acid sequence of the light chain (LC) of huE104.v2 (lgG1 or lgG4) is shown in SEQ ID NO: 81 .
  • the amino acid sequence of the HC of huE104.v2 lgG4 S228P is shown in SEQ ID NO: 82.
  • VL and VH (SEQ ID NO: 19) domains from the mouse anti-tryptase monoclonal antibody 31 A (“mu.31A") were aligned with the human VL kappa I (VLKI) and human VH subgroup III (VHm) consensus sequences (SEQ ID NOs: 92 and 93, respectively).
  • the hypervariable regions (HVR) were engineered into the consensus human VLKI and VHm acceptor frameworks to generate CDR-graft variants. From the mu.31 A VL domain, positions 24-34 (L1), 50-56 (L2), and 89-97 (L3) were grafted into VLKI.
  • positions 26-35 (H1), 50-65 (H2), and 93-102 (H3) were grafted into VHm.
  • selected vernier positions were mutated back to the mouse sequences.
  • the vernier positions that were mutated back to the mouse sequences included positions 4, 43, 46, 47, and 71 in VL and position 49 in VH.
  • three humanized LC and five humanized HC were synthesized and subsequently subcloned into pRK mammalian expression vectors. By combining the different versions of the LC and HC, a total of fifteen different humanized variants (v1 to v15) of 31 A (“hu31A”) were generated (Table 4).
  • a DNA sequence encoding the VH domain of hu31A.v1 1 is shown in SEQ ID NO: 104.
  • a DNA sequence encoding the VL domain of hu31 A.v1 1 is shown in SEQ ID NO: 105.
  • a DNA sequence encoding the heavy chain (lgG1) is shown in SEQ ID NO: 106.
  • a DNA sequence encoding the heavy chain (lgG4.S228P) is shown in SEQ ID NO: 108.
  • a DNA sequence encoding the light chain (lgG1 and lgG4) is shown in SEQ ID NO: 107.
  • the amino acid sequence of the HC of hu31A.v1 1 lgG1 is shown in SEQ ID NO: 76.
  • the amino acid sequence of the LC of hu31 A.v1 1 lgG1 is shown in SEQ ID NO: 77.
  • the amino acid sequence of the HC of hu31 A.v1 1 lgG4 S228P is shown in SEQ ID NO: 78.
  • the amino acid sequence of the LC of hu31 A.v1 1 lgG4 S228P is shown in SEQ ID NO: 79.
  • E. coli cell paste containing the expressed Fab was harvested from fermentations expressing Fabs and dissolved into PBS buffer containing 25 mM EDTA and 1 mM phenylmethylsulfonyl fluoride (PMSF). The mixture was homogenized and then passed twice through a microfluidizer. The suspension was then centrifuged at 21 ,500 x g for 60 min. The supernatant was then loaded onto a Protein G column equilibrated with PBS at 5 ml/min.
  • PMSF phenylmethylsulfonyl fluoride
  • hu31 a.v1 1 lgG4 and hu31 a.v1 1 lgG1 were diluted from 0.05 to 100 pg/rnl (0.30 to 667 nM) in PBS, pH 7.4, and huE104.v2 lgG4 and huE G4.v2 lgG1 were diluted from 0.02 to 50 pg/mi (0.15 to 333 nM) in PBS pH 7.4.
  • Recombinant human tryptase beta 1 tetramer active enzyme was diluted to 0.75 nM in TNH Buffer (200 m Tris, 150 mM NaCI, 0.1 mg/mL heparin , 0.01 % TRITONTM X-1 Q0, pH 8.0), and combined 1 :1 with anti-tryptase antibodies in black 384-weil plates (ViewPlate-384 F, Black, Clear-Bottom, Perkin Elmer, Catalog No. 6007470). Plates were incubated for 1 h at ambient temperature with gentle agitation. Colorimetric substrate S-2288 (Chromogenix, Part No. 82-0852-39) was diluted to 1200 ⁇ in TNH Buffer and was added to the plate. Final in-well
  • CC-2576, Lonza Minneapolis, MN were cultured in a humidified incubator at 37°C with 5% C02 in complete culture media SmGM-2 (Catalog No. CC-3182, Lonza).
  • the assay media was SmGm-2 culture media without human serum or supplements added (Catalog No. CC-3181 , Lonza).
  • Human wild-type tetramer tryptase or human S195A catalytically-inactive tryptase enzyme (chymotrypsinogen numbering) were used at the specified concentrations.
  • Anti-human tryptase antibodies hu31 A.v1 1 lgG4 and E104. v2 lgG4 were used at the specified concentrations.
  • BSMCs were plated at 2x10 5 cells/ml in a 96 well tissue culture plate (Catalog No. 353072, Falcon BD) in complete culture media.
  • the final concentration of antibodies ranged from 2.0 ⁇ to 4 pM.
  • the final concentration of tryptase was 100 nM (without heparin).
  • the final salt concentration was about 130 mM.
  • Wells with tryptase alone were included as stimulation controls.
  • Wells with assay media alone were included as unstimulated controls. Plates were incubated for 24 h at 37 ° C before the addition of 1 pCi of H hymidine per well. After an additional 6 h of incubation, proliferation was measured by H hymidine incorporation. Cell-associated radioactivity was quantified by scintillation counting. Results were expressed as the mean of triplicate samples. Graphs were generated and statistical analysis was performed using KaleidaGraph (Synergy Software).
  • BSMCs were plated in collagen at 9x10 6 cells/mL in a 24 well plate (Catalog No. 353047, Falcon BD) following the manufacturer's guidelines (Catalog No. CBA-201 , Cell BioLabs Inc.). After a 1 h incubation at 37 ° C, cells were overlayed with 1 mL of assay media. After a 24 h incubation at 37 ° C, media was replaced with 250 ⁇ _ of fresh assay media.
  • Tryptase was diluted in 250 ⁇ _ assay media to 660 nM in the presence or absence of 4 ⁇ of anti-human tryptase antibodies and incubated for 30 min at 37 ° C prior to adding to the specified wells containing the cell:collagen matrix.
  • the final concentrations were 330 nM tryptase and 2 ⁇ antibody (without heparin).
  • the final salt concentration was about 130 mM.
  • Cell contraction was initiated by the release of the cell:collagen matrix from the plate wall using a sterile pipette tip. Assay media alone was used as an unstimulated control.
  • the human mast cell line LAD2 was used.
  • LAD2 cells were cultured in a humidified incubator at 37°C with 5% C02 in serum-free growth medium, StemPro®-34, containing StemPro®-34 nutrient supplement (Catalog No. 10640-019, Gibco/Life Technologies), 1x peniciiiin-streptomycin-giutamine (Catalog No. 10378-016, Gibco/Life Technologies) and 100 ng/mL recombinant human stem cell factor (SCF) (Catalog No. 573908, BioLegend). See Kirshenbaum et al. Leukemia Research 27:677-682, 2003.
  • SCF human stem cell factor
  • Human tryptase wild-type or human tryptase S195A mutant were used at the specified concentrations.
  • Anti-NP human IgE JW8.5.13; see Jackman et al. J. Biol Chem. 285(27):20850-20859, 2010
  • NP-BSA Catalog No. N5050H-10, Biosearch Technologies, Petaluma, CA
  • Anti-human tryptase antibodies hu31 A.v1 1 lgG4 and E104. v2 lgG4 were used at the specified concentrations.
  • the small molecule inhibitor G02849855 was used at the specified concentration.
  • Cell stimulations were performed using Tyrode's Salt (Catalog No. T-2397, Sigma). Histamine was measured using a histamine ELISA kit (GenWay. Catalog No. 40-371 -25010).
  • LAD2 cells were plated at 4x10 6 cells/4 ml in 2 wells of a 6 well dish.
  • Anti-NP IgE 100 ng/ml was added to one well and the cells were incubated overnight at 37 ° C to prime the cells.
  • cells were cultured in media only without the addition of anti-NP IgE to serve as a negative control. After the overnight incubation, cells were washed 3 times with cell culture media to remove the unbound IgE.
  • Cells were resuspended in 4 mL Tyrode's salts (cell density 1 x10 6 cells/ml) and aliquoted into Eppendorf® tubes (300,000 cells/tube).
  • Samples were incubated with 100 ⁇ g/mL hu31 A.v1 1 lgG4 or 10 ⁇ G02849855, mixed thoroughly, and incubated at room temperature for 1 h. Following this incubation, NP-BSA was added to the samples at a final concentration of 0.1 ⁇ g/mL to trigger cell degranulation. Samples were mixed thoroughly and incubated at 37 ° C in a CO2 incubator for 1 h. Cells were then centrifuged at 3000 rpm for 5 min at room temperature, and the supernatant was collected for histamine measurement. Histamine in the degranulation supernatant was quantitated using a histamine ELISA kit. Data were represented as the mean of duplicate samples.
  • LAD2 cells were resuspended in Tyrode's salts at a concentration of 10 6 cells/mL and aliquoted into Eppendorf® tubes (300,000 cells/tube).
  • tryptase wild-type or S195A mutant
  • 3 ⁇ g/mL tryptase which had been pre-incubated with 100 ⁇ g/mL hu31 A.v1 1 for 45 min at room temperature.
  • PBS was used as a no stimulation control. Samples were mixed thoroughly and incubated at 37°C in a CO2 incubator for 1 h.
  • the final salt concentration was about 140 mM.
  • Cells were then centrifuged at 3000 rpm for 5 min at room temperature, and the supernatant was collected for histamine measurement. Histamine in the degranulation supernatant was quantitated using a histamine ELISA kit. Data were represented as the mean of duplicate samples.
  • Human tryptase without the endogenous signal peptide (amino acid residues 1 -15 of SEQ ID NO:71) and pro-peptide (amino acid residues 16-30 of SEQ ID NO:71) was expressed in mammalian CHO cells as a His-tagged recombinant protein with an engineered enterokinase cleavage site and underwent 5x ultrafiltration followed by a 5x dilution into PBS. Media was then loaded over a Ni-NTA column and eluted with 250 mM imidazole. Eluate was dialyzed into 10 mM MOPS, 0.2M NaCI, pH 6.8 buffer yielding monomeric tryptase. Uncleaved His6-tagged tryptase monomers remain monomeric and do not form tetramers.
  • clone E104 showed the most robust inhibition activity in the enzymatic assay, and was selected for further engineering.
  • a murine anti-tryptase monoclonal antibody clone 31 A which showed inhibition activity in the enzymatic assay was also selected for further engineering.
  • the light chain of the rabbit anti-tryptase monoclonal antibody E104 is a rabbit kappa light chain, which contains a disulfide bridge between Cys80 in FR3 of the variable domain (VL) and Cys170 in the constant domain (CL).
  • VL variable domain
  • CL constant domain
  • Cys80Ala a chimeric E104 variant with the cysteine at position 80 mutated to alanine
  • Cys80 residue was not critical and in the humanized version, Cys80 was changed to a proline residue as in the VH4 graft.
  • the E104.v9 chimeric clone contains R71 and V78 as in the parent rabbit monoclonal Ab E104. See Table 3. As shown in Fig. 12B, the arginine (R) residue at position 71 and valine (V) residue at position 78 (both Kabat numbering) may play an important role in conformation of HVR-H2, and thus the binding of the antibody to tryptase. As a result, the V71 R and F78V modifications in huE104.v2 may have affected the conformation of the tryptase 80 loop that is important in the association of two protomers that form the small interface. See Example 3 below.
  • hu104.v2 which has the V71 R and F78V reversions, has improved binding and inhibitory activity as compared to v1 , which has V at position 71 and F at position 78. All variants except v1 , v5, v1 1 , and v12 showed complete inhibition of tryptase activity as measured by the enzymatic assay described above.
  • the humanized clone huE104. v2 was selected for further evaluation. The amino acid sequences of the heavy and light chain variable domains of huE104. v2 are shown in Fig. 1 .
  • Table 4 lists hu31 A variants as well as the binding affinity (in terms of KD, nanomolar) as measured by BIAcore® SPR analysis. Table 4 also shows the SEQ ID NOs of the VH and VL for each antibody. All variants showed complete inhibition of tryptase activity as measured by the enzymatic assay (data not shown). Each clone in Table 4 was tested in lgG1 format. The clone hu31 A.v1 1 showed the best affinity and best inhibitory activity in an enzymatic assay and was therefore selected for further evaluation. The amino acid sequences of the heavy and light chain variable domains of hu31 A.v1 1 are shown in Fig. 1 . Table 4: Binding affinities of humanized 31 A (hu31A) variants (binding affinity to human tryptase b1 monomer in parentheses)
  • the inhibitory activity of humanized anti-tryptase antibodies was also determined using the recombinant tryptase enzymatic activity assay described above. Both h31 A.v1 1 and huE1 04.v2 , lgG1 and lgG4, completely inhibited tryptase activity in the enzymatic assay (see Fig. 2A). The IC50 values are shown below (Table 5).
  • Both hu31A.v1 1 and huE104.v2 bind and inhibit human tryptase beta 2 and beta 3, in addition to tryptase beta 1 .
  • Representative data are shown below in Table 6 based on protocols described above for affinity analysis and enzymatic assay using human tryptase beta 1 as the target.
  • Both hu31 A.v1 1 and huE104.v2 also bind and inhibit cyno tryptase D1 .
  • the inhibitory activity of hu31 A.v1 1 lgG4 or huE104.v2 lgG4 was further assessed in several ex vivo models of human primary airway smooth muscle cell (SMC) function.
  • Addition of tryptase beta 1 to culture medium results in an increase in proliferation of human primary airway SMCs (Fig. 2B), as well as contraction of the cells (Fig. 2C).
  • Addition of hu31 A.v1 1 or huE104.v2 resulted in a dose-dependent reduction in proliferation, and at 300 pg/ml inhibited proliferation to baseline levels (Fig. 2B).
  • addition of hu31 A.v1 1 or huE104.v2 reduced contraction to baseline levels (Fig. 2C).
  • Example 2 hu31 A.v11 and huE104.v2 IgG dissociate human tryptase beta tetramer
  • the crystal structure of active tetrameric trypiase shows that the catalytic site of each protomer (represented by S195, H57, and D102 of each protomer, chymotrypsinogen numbering) is located inside the pore of the tetramer, and that access to the active sites is limited such that only peptide substrates and smaller molecules can gain access (Pereira et al. Nature 392:306-1 1 , 1999).
  • no mammalian serine protease inhibitors are known to inhibit the proteolytic activity of tryptase.
  • Human serine protease inhibitors of the Kunitz-domain type architecture are too large to access the active sites. There are no known natural inhibitors of tryptase in humans.
  • LDTI leech-derived tryptase inhibitor
  • TdPl tick-derived protease inhibitor
  • IgG and Fab of hu31 A.v1 1 are much larger than LDTI or TdPl , and yet they completely inhibit tryptase.
  • Tetrameric tryptase had a molecular weight of 120 kDa ⁇ 0.2 % according to MALS, which is consistent with the theoretical molecular weight of 1 09.537 kDa based on amino acid sequence (excluding glycosylation).
  • the protein peak containing tryptase in complex with Fab hu31 A.v1 1 was measured to be 67.7 kDa ⁇ 3% by MALS (peak 3), which reflects a complex comprising 1 tryptase monomer bound to 1 Fab. This indicates that the tryptase tetramer dissociates into monomers upon binding to Fab hu31 A.v1 1 , which is further corroborated by the crystal structure (see Example 3) and the inhibitory activity of the hu31 A.v1 1 Fab.
  • Heparin from porcine intestinal mucosa is a mixture of polyanion chains having molecu lar weights ranging from 6 io 30 kDa, with most chains in the range of 17 to 19 kDa. This result indicates that the stabilizing effect of heparin on tetrameric tryptase is also neutralized or disrupted by Fab hu31 A.v1 1 ; even a high concentration 100 pg/mi of heparin cannot prevent Fab hu31 A.v1 1 from completely dissociating the tetramer. See Fig. 3A.
  • huE104.v1 Fabs formed a homogeneous complex with WT tetrameric tryptase with a retention time of t 21 .6 mL and a molecular weight of 276.1 kDa, as determined by SEC-MALS (data not shown). This would represent a complex of tryptase tetramer with 4 Fabs bound to it. SDS-PAGE analysis of fractions from this peak confirmed the presence of Fabs and tryptase protomers. Thus, huE1 Q4.v1 Fabs formed a stable complex with tetrameric tryptase and did not affect tetramer stability (data not shown).
  • Both protein peaks were also analyzed by MALS and a molecular weight of 68 kDa ⁇ 3% was determined, which reflects a complex comprising 1 tryptase monomer bound to 1 Fab.
  • the second peak of each run had a retention time of tF31 .6 min min (run 1 , peak 6) and tF31 .8 (run 2, peak 7), respectively, and contained only Fab huE104.v2, as determined by SDS-PAGE.
  • huE1 G4.v1 Fab showed no detectable inhibitory activity, while huE104.v2 Fab completely dissociated tryptase tetramer. Unlike hu31A.v1 1 Fab or huE104.v2 IgG, however, the ability of huE104.v2 Fab to dissociate the tetramer was partially neutralized by high concentration of heparin.
  • hu31 A.v1 1 Fab is capable of dissociating tryptase tetramer with or without high concentration of heparin
  • huE104.v2 Fab is capable of dissociating tryptase tetramer in the absence of high concentration of heparin.
  • Each tryptase monomer has an identical set of catalytic triad, and the four monomers assemble to form a tetramer with the four catalytic sites facing the middle pore into which the substrate enters.
  • Pereira et al. discuss design of small molecule tryptase inhibitors by blocking the active sites.
  • Several small molecule tryptase inhibitors in development had been discontinued due to poor selectivity or poor bioavailability. See, e.g., Cairns, J.A., 2005, Pulmonary Pharmacology & Therapeutics 18:55-66.
  • Wild-type tetrameric tryptase is not covalently held together and can dissociate into monomers under physiological conditions (Schwartz et al. J. Biol. Chem. 261 :7372-7370, 1986; Alter et al. Biochem. J. 248:821 -827, 1987; Schwartz et al. J. Immunol. 144:2304-231 1 , 1990). It has been reported that mature tryptase demonstrates high enzymatic activity as a tetramer, and is inactive as a monomer under physiologically relevant conditions (Schwartz et al., J. Biol. Chem. 261 :7372-7379, 1986).
  • a dissociating anti-tryptase antibody will be inferior to an active site blocking inhibitor such as a tetramer-stabilizing, active site blocking antibody, because serum inactive monomer may act as a major sink for the dissociating antibodies that binds to the monomers.
  • a tetramer-stabilizing, active site blocking antibody may be more advantageous as a therapeutic if monomers can be enzymatically active under certain conditions.
  • PKPD pharmacokinetic-pharmacodynamic
  • the model was developed in Simbiology ® software ( athworks inc, Cambridge MA) to simulate tetrameric tryptase generation , dissociation, and clearance in the circulating and in the lung tissue, as well as the PK and binding effects of the anti-tryptase antibodies.
  • Two types of antibodies are considered: (1 ) a dissociating antibody that dissociates the tetramer rapidly upon binding, but also binds monomer; and (2) a stabilizing tetramer-specific antibody, that binds active tetramer only and neutralizes its activit by blocking the access to its substrates, but also extends half-life of the tetramer.
  • a tetramer- dissociating antibody with a KD of 0.2 n was simulated under a hypothetical dose regimen of 300 mg administered subcutaneously every four weeks. We assumed a 10% lung partition coefficient of the antibody. For the baseline scenario, we assumed 4 ng/ml total tryptase in the serum and 10 ng/m! total tryptase in the tissue compartment, and for the high-tryptase scenario, we assumed 10 ng/ml serum tryptase and 40 ng/ml tissue tryptase levels. The relative rate constants for physiologic tetrameric dissociation to monomer and the dearance of each species results in an 8:1 ratio of monomer to tetramer within the total tryptase pools.
  • Fig. 4A left panels show the antibody concentration of both total antibody and free/unbound antibody in the lung under the baseline scenario, and right panels show the corresponding lung (free) tryptase levels relative to pre-treatment levels for both monomer and tetramer.
  • For the stabilizing antibody bottom panels
  • nearly all of the antibody is free (bottom left panel); however, reduction in tetramer is only maintained at or above 80%.
  • the antibody achieves less neutralization (minimum ⁇ 7G%) as compared with the dissociating antibody under the same conditions, despite a 0-fold higher affinity assumed for the stabilizing antibody in the simulations (Fig. 4B, bottom right panel).
  • the lesser neutralization is due to greater stability (half-life) of the bound target which serves as a "reservoir” for tetramer.
  • our simulations predict that a dissociating antibody is promising and would perform better than tetramer-specific stabilizing antibody under different scenarios tested.
  • FIG. 4C shows the tetramer neutralization for both types of antibodies, at both baseline and high tryptase scenarios, as a function of antibody dose level (30, 100, 300mg sc q4w).
  • the dissociating antibody consistently reduces tetramer activity more than the stabilizing antibody, across all doses considered.
  • the dissociating antibody outperforms the stabilizing antibody with respect to tetramer neutralization at ail but the lowest dose (30 mg), at. which point the two antibodies perform comparably.
  • the optimal dose for (90%) tetramer neutralization is lower for the dissociating antibody than for the stabilizing antibody (results not shown), despite the 10x greater affinity assumed for the stabilizing antibody.
  • the dissociating antibody would outperform or at least match the stabilizing antibody that has 1 0x higher affinity, across the dose range and serum and lung tryptase concentrations tested.
  • hu31 A.v1 1 and huE104.v2 IgG completely inhibited all tryptase activity. See Fig. 2A and Table 5.
  • human tryptase beta tetramer (1 .0 pg/mL) was preincubated with the tested antibody for 30 min in TNH buffer at pH 6.0 or 7.5 (50 mM Tris, 150 mM NaCI, 0.1 mg/ml heparin) at room temperature.
  • the mixture was then incubated with 5 pg human fibrinogen substrate (Haematologic Technologies, Inc. , Cat. No. HIC-01 50R) for 2.5 h at 37 ° C.
  • hu31 A.v1 1 Fab, huE104.v2 Fab, and B12 mlgG1 were each tested at 200 pg/mL.
  • the cleavage products were analyzed by SDS-PAGE and Coomassie Blue staining.
  • human tryptase beta 1 cleaved fibrinogen alpha and beta chains at both pH 6 and 7.5 (compare lane 1 , fibrinogen only, with lane 2, fibrinogen plus tryptase beta 1 ).
  • Antibody hu31 A.v1 1 Fab inhibited human tryptase beta at both pH 6 and pH 7.5 (lane 3), while huE104.v2 Fab, under the assay condition of 0.1 mg/ml of high concentration of heparin, did not (lane 5).
  • Lane 6 was B12 mlgG1 alone.
  • the decrease in fibrinogen alpha chain is indicative of tryptase proteolytic activity.
  • the fibrinogen beta chain is also cleaved , but the beta chain cleavage tends to be obscured on the gel.
  • the intensity of the alpha chain was thus quantified and shown in the bottom panels of Figs. 5A and 5B.
  • hu31 A.v1 1 Fab inhibited tryptase activity at pH 6 and 7.5, while huE104.v2 Fab under the assay condition of high heparin concentration , was not inhibitory.
  • IgG format antibodies hu31 A.v1 1 lgG4 and huE104.v2 lgG4
  • S-2288 peptide as a substrate in an inhibition assay in the presence of 1 nM tryptase and 400 ⁇ chromogenic S-2288 in TNH buffer at pH 6, 7, or 8.
  • the final concentration of heparin in this experiment was about 95 ⁇ 9 ⁇ .
  • Both hu31A.v1 1 and huE104.v2 in the IgG format completely inhibited tryptase activity at pH 6, 7, and 8 (data not shown).
  • hu31 A.v1 1 IgG and huE104.v2 IgG both bind to tryptase with high affinity and also efficiently inhibit tryptase activity under physiologically relevant conditions for tryptase-associated disorders such as asthma.
  • murine monoclonal anti-human tryptase antibody B12 lgG1 also showed inhibition of human tryptase beta at pH 6 (Fig. 5A, lane 4), contrary to published results.
  • the discrepancy may be attributed to any residual non-tryptase protease activity present in the material used for the assay in the published data that was activated by acidic pH and resistant to B12 inhibition.
  • Wild-type tetrameric tryptase was mixed with 1 .5-fold molar excess Fab hu31 A.v1 1 and 2-fold molar excess soybean trypsin inhibitor (STI) (Roche) and incubated for 10 min at room temperature. STI was added to facilitate crystallization. The mixture was then subjected to SEC using an S200 column (GE Healthcare) in 10 mM MOPS (pH 6.8), 0.5 M NaCI. Fractions containing the ternary complex of tryptase, STI, and Fab hu31A.v1 1 were pooled and concentrated to 40 mg/mL.
  • STI soybean trypsin inhibitor
  • Crystals of tryptase/Fab hu31A.v1 1/STI were grown at 19°C using the vapor diffusion method in hanging drops.
  • Crystallization buffer containing 0.1 M Tris (pH 7.5), 0.2 M lithium sulfate, and 5% polyethylene glycol (PEG) 4000 was mixed in equal volume with the protein solution. The crystals were dipped in artificial mother liquor containing 25% ethylene glycol and vitrified in liquid nitrogen.
  • Table 7 shows X-ray data collection and refinement information for the structure of Fab hu31 A.v1 1/tryptase/STI. Diffraction data extending to 2.15 A were collected in a hexagonal lattice at ALS Beamline 5.0.2. Data reduction and scaling allowed assignment of the Laue class to 6/mmm
  • Crystallogr. 67, 235-242, 201 Based on unit cell volume and proposed protein content, a single Fab hu31 A.v1 1/tryptase/STI complex was expected in the crystallographic asymmetric unit.
  • the structure was solved using molecular replacement (McCoy et al. J. Appl. Crystallogr. 40:658-674, 2007) in space group P6 ⁇ 22.
  • the following search probes were used, each as separate bodies: a previously determined tryptase protomer derived from PDB accession 4A6L (Liang et al. Bioorg. Med. Chem. Lett. 22:1049- 1054, 2012), STI from PDB 1AVU (Song et al. J. Mol.
  • the Fab heavy chain is continuous except for a five amino acid residue gap in the constant domain.
  • the value for the shape complementarity statistic (Sc) (Lawrence et al. J. Mol. Biol. 234:946- 950, 1993) is 0.73, consistent with other tight-binding Fab/antigen complexes.
  • the largest inter-protein contact area is that between tryptase and STI, as they each lose 1260 A 2 solvent accessible surface (Broger C, xsae, F. Hoffman-La Roche, Basel, Switzerland, 2000) at their interface.
  • the Fab/tryptase contact is only 760 A 2 on each side, evenly distributed between light and heavy chains of the Fab.
  • Crystal packing contacts 4 A or less are well distributed around STI, tryptase, and all four Fab domains, and include numerous hydrogen bonds as well as hydrophobic contacts.
  • Table 7 X-ray Data Collection and Refinement Fab hu31A.v11/Tryptase/STI
  • Deuterium uptake rates of monomeric tryptase in the presence and absence of antibody were measured to determine structural regions that are modified upon antibody binding.
  • Bound samples contained a 1 :1 mixture of tryptase and the respective antibody, prepared and incubated at room temperature for 1 h. Tryptase concentration prior to deuterium labeling was 30 ⁇ in antibody-bound and unbound samples.
  • HDX experiments involved diluting samples 15-fold into deuterium labeling buffer containing 20 mM histidine acetate at pD 7.0.
  • Purified proteins were acidified with 0.1 % trifluoroacidic acid (TFA) (Thermo, Rockford, IL) and diluted to a final concentration of 10 ⁇ .
  • TFA trifluoroacidic acid
  • Samples were analyzed on an Agilent 6520 Accurate-Mass quadrupole time-of-flight (Q-TOF) coupled with an Agilent 1260 Infinity high performance liquid chromatography (HPLC)-Chip Cube Interface (Agilent, Santa Clara, CA).
  • Proteins were separated by reversed phase HPLC on a PLRP-S 150 mm x 75 pm column at 40 nL/min flow rate with a 10 min, 5-80% gradient of aqueous solvent A (97% H20, 3% acetonitrile, 0.1 % formic acid) to organic solvent B (98% acetonitrile, 0.1 % formic acid).
  • Data was collected with a MassHunter® Workstation (Agilent, Santa Clara, CA) and raw mass spectra were deconvoluted to generate intact mass data. Major peaks were observed at 61764.4 Da and 63152.9 Da. The addition of multiple GlcNAc (203 Da) masses were also observed.
  • the crystal structure of human tryptase shows that each monomer of the tetramer contacts its neighbors at two different interfaces through six loop segments: the large interface (between protomers A/D and B/C) or the small interface (between protomer A/B and C/D) according to protomer nomenclature described by Pereira et al. Nature 392:306-1 1 , 1998, which is incorporated herein by reference in its entirety.
  • the six surface loops of each protomer surround the active site and engage in intermonomer contacts (Pereira, supra). Among which, the 147 loop, the 70-80 loop and the 37 loop engage in the interaction of small interface, and the 173 flap, the 97 loop and the 60 loop are important in large interface interaction.
  • the small interface involves only hydrophobic interactions
  • the large interface comprises several polar, charged interactions in addition to hydrophobic interactions.
  • Heparin further stabilizes the small interfaces, which are believed to be the shear points of the tetramer, by binding non- covalently to positively charged residues spanning the two adjacent protomers A/B and C/D. See Pereira supra.
  • the small interfaces are the shear points of the tetramer, followed by the dissociation of the dimer held by the large interfaces.
  • the half-life of tryptase is about 2-3 hours in circulation in human blood after development of systemic anaphylaxis (see, e.g., Schwartz et al. J. Clin, invest. 83:1551 - 1555,1989).
  • the normal half-life of the tetramer is about 30 minutes.
  • Tyr75 in the small interface and Ile99 in the large interface were individually mutated to cysteine. These sites were selected because they face themselves in these interfaces due to the quasi 2-fold symmetry of the tetramer (Sommerhoff et al. Proc. Natl. Acad. Sci. USA 96:10984-91 , 1999).
  • Replacement of Tyr75 or Ile99 to cysteine in siiico using Py OL software showed respective distances of 2.4 A and 3.2 A between the thiols of each opposing cysteines, which is somewhat greater than a typical disulfide bond length of 2.05 A.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Pulmonology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Rheumatology (AREA)
  • Dermatology (AREA)
  • Mycology (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Endocrinology (AREA)
  • Child & Adolescent Psychology (AREA)
  • Obesity (AREA)
  • Biomedical Technology (AREA)
  • Pain & Pain Management (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Biotechnology (AREA)
PCT/US2018/017680 2017-02-10 2018-02-09 Anti-tryptase antibodies, compositions thereof, and uses thereof Ceased WO2018148585A1 (en)

Priority Applications (19)

Application Number Priority Date Filing Date Title
CN201880024550.3A CN110494453B (zh) 2017-02-10 2018-02-09 抗类胰蛋白酶抗体、其组合物及其用途
MYPI2019004606A MY197534A (en) 2017-02-10 2018-02-09 Anti-tryptase antibodies, compositions thereof, and uses thereof
JP2019541323A JP6995127B2 (ja) 2017-02-10 2018-02-09 抗トリプターゼ抗体、その組成物、及びその使用
BR112019016595-9A BR112019016595A2 (pt) 2017-02-10 2018-02-09 Anticorpos isolados, métodos de produção do anticorpo e de tratamento de um distúrbio, ácido nucleico isolado, vetor ou conjunto de vetores, célula hospedeira, composições farmacêuticas e uso
UAA201909161A UA126574C2 (uk) 2017-02-10 2018-02-09 Антитіло проти триптази, його композиція та застосування
MX2019009485A MX2019009485A (es) 2017-02-10 2018-02-09 Anticuerpos contra triptasa, composiciones de estos y usos de estos.
AU2018217816A AU2018217816A1 (en) 2017-02-10 2018-02-09 Anti-tryptase antibodies, compositions thereof, and uses thereof
CA3051700A CA3051700A1 (en) 2017-02-10 2018-02-09 Anti-tryptase antibodies, compositions thereof, and uses thereof
CN202310592021.6A CN116715775A (zh) 2017-02-10 2018-02-09 抗类胰蛋白酶抗体、其组合物及其用途
SG11201907364WA SG11201907364WA (en) 2017-02-10 2018-02-09 Anti-tryptase antibodies, compositions thereof, and uses thereof
EP18707205.3A EP3580240A1 (en) 2017-02-10 2018-02-09 Anti-tryptase antibodies, compositions thereof, and uses thereof
RU2019127870A RU2771485C2 (ru) 2017-02-10 2018-02-09 Антитела против триптазы, их композиции и применения
CR20190387A CR20190387A (es) 2017-02-10 2018-02-09 Anticuerpos contra triptasa, composiciones de estos y usos de estos
KR1020197026305A KR102362006B1 (ko) 2017-02-10 2018-02-09 항-트립타제 항체, 이의 조성물, 및 그의 용도
PE2019001580A PE20191548A1 (es) 2017-02-10 2018-02-09 Anticuerpos contra triptasa, composiciones de estos y usos de estos
IL268249A IL268249A (en) 2017-02-10 2019-07-24 Anti-tryptase antibodies, their preparations and their uses
ZA2019/05023A ZA201905023B (en) 2017-02-10 2019-07-30 Anti-tryptase antibodies, compositions thereof, and uses thereof
PH12019501872A PH12019501872A1 (en) 2017-02-10 2019-08-13 Anti-tryptase antibodies, compositions thereof, and uses thereof
CONC2019/0009787A CO2019009787A2 (es) 2017-02-10 2019-09-09 Anticuerpos contra triptasa, composiciones de estos y usos de estos

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762457722P 2017-02-10 2017-02-10
US62/457,722 2017-02-10

Publications (1)

Publication Number Publication Date
WO2018148585A1 true WO2018148585A1 (en) 2018-08-16

Family

ID=61274365

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/017680 Ceased WO2018148585A1 (en) 2017-02-10 2018-02-09 Anti-tryptase antibodies, compositions thereof, and uses thereof

Country Status (24)

Country Link
US (4) US10738131B2 (enExample)
EP (1) EP3580240A1 (enExample)
JP (3) JP6995127B2 (enExample)
KR (1) KR102362006B1 (enExample)
CN (2) CN110494453B (enExample)
AR (1) AR110873A1 (enExample)
AU (1) AU2018217816A1 (enExample)
BR (1) BR112019016595A2 (enExample)
CA (1) CA3051700A1 (enExample)
CL (2) CL2019002251A1 (enExample)
CO (1) CO2019009787A2 (enExample)
CR (1) CR20190387A (enExample)
IL (1) IL268249A (enExample)
MA (1) MA47459A (enExample)
MX (1) MX2019009485A (enExample)
MY (1) MY197534A (enExample)
PE (1) PE20191548A1 (enExample)
PH (1) PH12019501872A1 (enExample)
RU (1) RU2771485C2 (enExample)
SG (1) SG11201907364WA (enExample)
TW (1) TWI778018B (enExample)
UA (1) UA126574C2 (enExample)
WO (1) WO2018148585A1 (enExample)
ZA (1) ZA201905023B (enExample)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110006871A (zh) * 2019-02-20 2019-07-12 常州大学 一个基于外源性组胺检测的细胞模型以及应用
WO2019157358A1 (en) 2018-02-09 2019-08-15 Genentech, Inc. Therapeutic and diagnostic methods for mast cell-mediated inflammatory diseases
WO2021055694A1 (en) 2019-09-20 2021-03-25 Genentech, Inc. Dosing for anti-tryptase antibodies
WO2023019239A1 (en) 2021-08-13 2023-02-16 Genentech, Inc. Dosing for anti-tryptase antibodies

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017189805A1 (en) 2016-04-27 2017-11-02 Abbvie Inc. Methods of treatment of diseases in which il-13 activity is detrimental using anti-il-13 antibodies
CN118994394A (zh) 2017-06-12 2024-11-22 蓝鳍生物医药公司 抗-il1rap抗体和抗体药物缀合物
EP4009953A4 (en) * 2019-08-07 2023-08-23 Icahn School of Medicine at Mount Sinai METHOD OF TREATMENT OF KELOIDS
KR102801198B1 (ko) * 2021-06-28 2025-04-30 (주) 넥셀 특발성 폐섬유증 예방 또는 치료용 폴리펩타이드 및 이를 포함하는 약학 조성물
CN117858898A (zh) * 2021-08-27 2024-04-09 免疫医疗有限公司 用抗白介素-33抗体治疗慢性阻塞性肺病
CN114515296B (zh) * 2022-02-25 2024-01-12 和携科技有限公司 一种脂肪间充质干细胞分泌因子的制备方法
EP4540284A2 (en) 2022-06-17 2025-04-23 Apogee Therapeutics, Inc. Antibodies that bind interleukin 13 and methods of use
WO2024003825A1 (en) * 2022-06-29 2024-01-04 Kashiv Biosciences, Llc An improved assay method of antibody
CN118962135A (zh) * 2024-08-13 2024-11-15 武汉大白小白科技有限公司 类胰蛋白酶快速定量试剂盒及其在鼻炎诊断产品中的应用

Citations (119)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0379295A2 (en) * 1989-01-13 1990-07-25 Taisho Pharmaceutical Co. Ltd Anti-tryptase antibody and composition for treatment of AIDS using the same
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
EP0425235A2 (en) 1989-10-25 1991-05-02 Immunogen Inc Cytotoxic agents comprising maytansinoids and their therapeutic use
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
WO1997030087A1 (en) 1996-02-16 1997-08-21 Glaxo Group Limited Preparation of glycosylated antibodies
US5712374A (en) 1995-06-07 1998-01-27 American Cyanamid Company Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates
US5714586A (en) 1995-06-07 1998-02-03 American Cyanamid Company Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5739116A (en) 1994-06-03 1998-04-14 American Cyanamid Company Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents
US5744319A (en) * 1995-11-08 1998-04-28 Promega Corporation Avian tryptase polyclonal antibody and purification method for use in human tryptase immunoassay
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5770710A (en) 1987-10-30 1998-06-23 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group
US5770701A (en) 1987-10-30 1998-06-23 American Cyanamid Company Process for preparing targeted forms of methyltrithio antitumor agents
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
WO1998058964A1 (en) 1997-06-24 1998-12-30 Genentech, Inc. Methods and compositions for galactosylated glycoproteins
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
WO1999022764A1 (en) 1997-10-31 1999-05-14 Genentech, Inc. Methods and compositions comprising glycoprotein glycoforms
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
WO1999060139A1 (en) * 1998-05-15 1999-11-25 Promega Corporation ENZYMATICALLY-ACTIVE RECOMBINANT HUMAN β-TRYPTASE AND METHOD OF MAKING SAME
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6171586B1 (en) 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO2001029246A1 (fr) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Procede de production d'un polypeptide
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
US6630579B2 (en) 1999-12-29 2003-10-07 Immunogen Inc. Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
WO2005035586A1 (ja) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. 融合蛋白質組成物
WO2005035778A1 (ja) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
US20050123546A1 (en) 2003-11-05 2005-06-09 Glycart Biotechnology Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
WO2005053742A1 (ja) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. 抗体組成物を含有する医薬
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
US20050260186A1 (en) 2003-03-05 2005-11-24 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US20060025576A1 (en) 2000-04-11 2006-02-02 Genentech, Inc. Multivalent antibodies and uses therefor
WO2006013107A1 (en) 2004-08-05 2006-02-09 Novartis Ag Il-17 antagonistic antibodies
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
WO2006044908A2 (en) 2004-10-20 2006-04-27 Genentech, Inc. Antibody formulation in histidine-acetate buffer
US7041870B2 (en) 2000-11-30 2006-05-09 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
US20060104968A1 (en) 2003-03-05 2006-05-18 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
EP1725261A2 (en) 2004-02-17 2006-11-29 Schering Corporation Use for interleukin-33 (il-33) and the il-33 receptor complex
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
US20070061900A1 (en) 2000-10-31 2007-03-15 Murphy Andrew J Methods of modifying eukaryotic cells
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
WO2007070750A1 (en) 2005-12-13 2007-06-21 Eli Lilly And Company Anti-il-17 antibodies
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070253948A1 (en) 2004-09-02 2007-11-01 Chan Andrew C Anti-FC-gamma RIIB receptor antibody and uses therefor
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
US20080069820A1 (en) 2006-08-30 2008-03-20 Genentech, Inc. Multispecific antibodies
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
WO2008077546A1 (en) 2006-12-22 2008-07-03 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor i receptor and uses thereof
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
US7498298B2 (en) 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
US20090182127A1 (en) 2006-06-22 2009-07-16 Novo Nordisk A/S Production of Bispecific Antibodies
US7674459B2 (en) 2003-12-23 2010-03-09 Genentech, Inc. Treatment of cancer with a novel anti-IL13 monoclonal antibody
WO2011031600A1 (en) 2009-09-10 2011-03-17 Schering Corporation Use of il-33 antagonists to treat fibrotic disease
US20110287009A1 (en) 2010-04-23 2011-11-24 Genentech, Inc. Production of Heteromultimeric Proteins
US8187596B1 (en) 2006-07-20 2012-05-29 Schering Corporation Method of treating asthma or allergy by administering an IL-33 receptor antibody
US20120156194A1 (en) 2010-12-16 2012-06-21 Genentech, Inc. Diagnosis and treatments relating to th2 inhibition
WO2012156219A1 (en) 2011-05-05 2012-11-22 Ablynx Nv Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
WO2013165894A2 (en) 2012-04-30 2013-11-07 Janssen Biotech, Inc. St2l antagonists and methods of use
WO2013173761A2 (en) 2012-05-18 2013-11-21 Amgen Inc. St2 antigen binding proteins
US8715669B2 (en) 2008-05-05 2014-05-06 Novimmune Sa Anti-IL-17A/IL-17F cross-reactive antibodies
WO2014152195A1 (en) 2013-03-15 2014-09-25 Regeneron Pharmaceuticals, Inc. Il-33 antagonists and uses thereof
WO2014164959A2 (en) 2013-03-13 2014-10-09 Regeneron Pharmaceuticals, Inc. Anti-il-33 antibodies and uses thereof
WO2015061441A1 (en) 2013-10-23 2015-04-30 Genentech, Inc. Methods of diagnosing and treating eosinophilic disorders
WO2015099175A1 (ja) 2013-12-26 2015-07-02 田辺三菱製薬株式会社 ヒト抗il-33中和モノクローナル抗体
WO2015106080A2 (en) 2014-01-10 2015-07-16 Anaptysbio, Inc. Antibodies directed against interleukin-33 (il-33)
EP2913062A1 (en) * 2012-10-24 2015-09-02 Japan Innovative Therapeutics, Inc. Therapeutic or prophylactic agent for retinopathy of prematurity, method of testing for retinopathy of prematurity, and screening method for therapeutic or prophylactic substance for retinopathy of prematurity
US20160168242A1 (en) 2014-11-10 2016-06-16 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2025630A1 (en) 1989-09-22 1991-03-23 Nobuhiko Katunuma Human tryptase-like protein
US5595756A (en) * 1993-12-22 1997-01-21 Inex Pharmaceuticals Corporation Liposomal compositions for enhanced retention of bioactive agents
US5861264A (en) 1996-05-21 1999-01-19 Axys Pharmaceuticals, Inc. Anti-tryptase detection as a diagnostic for inflammatory diseases
US6998260B1 (en) 1998-05-15 2006-02-14 Promega Corporation Recombinant proteolytic tryptases, active site mutants thereof, and methods of making same
DOP2005000039A (es) * 2004-03-26 2005-10-31 Aventis Pharma Inc Hidrocloruro de [4-(5-aminometil-2-fluoro-fenil)- piperidin-1-il]-(4-bomo-3-metil-5-propoxi-tiofen-2-il)-metanona como un inhibidor de la triptasa de mastocitos
WO2006010492A1 (en) 2004-07-28 2006-02-02 Bayer Healthcare Ag Diagnostics and therapeutics for diseases associated with tryptase 1 (tps1)

Patent Citations (132)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5770710A (en) 1987-10-30 1998-06-23 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group
US5770701A (en) 1987-10-30 1998-06-23 American Cyanamid Company Process for preparing targeted forms of methyltrithio antitumor agents
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
EP0379295A2 (en) * 1989-01-13 1990-07-25 Taisho Pharmaceutical Co. Ltd Anti-tryptase antibody and composition for treatment of AIDS using the same
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
EP0425235A2 (en) 1989-10-25 1991-05-02 Immunogen Inc Cytotoxic agents comprising maytansinoids and their therapeutic use
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5416064A (en) 1989-10-25 1995-05-16 Immunogen, Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US6417429B1 (en) 1989-10-27 2002-07-09 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5739116A (en) 1994-06-03 1998-04-14 American Cyanamid Company Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents
US5767285A (en) 1994-06-03 1998-06-16 American Cyanamid Company Linkers useful for the synthesis of conjugates of methyltrithio antitumor agents
US5773001A (en) 1994-06-03 1998-06-30 American Cyanamid Company Conjugates of methyltrithio antitumor agents and intermediates for their synthesis
US5877296A (en) 1994-06-03 1999-03-02 American Cyanamid Company Process for preparing conjugates of methyltrithio antitumor agents
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US7642228B2 (en) 1995-03-01 2010-01-05 Genentech, Inc. Method for making heteromultimeric polypeptides
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5712374A (en) 1995-06-07 1998-01-27 American Cyanamid Company Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates
US5714586A (en) 1995-06-07 1998-02-03 American Cyanamid Company Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
US5744319A (en) * 1995-11-08 1998-04-28 Promega Corporation Avian tryptase polyclonal antibody and purification method for use in human tryptase immunoassay
WO1997030087A1 (en) 1996-02-16 1997-08-21 Glaxo Group Limited Preparation of glycosylated antibodies
US6171586B1 (en) 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
WO1998058964A1 (en) 1997-06-24 1998-12-30 Genentech, Inc. Methods and compositions for galactosylated glycoproteins
WO1999022764A1 (en) 1997-10-31 1999-05-14 Genentech, Inc. Methods and compositions comprising glycoprotein glycoforms
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
WO1999060139A1 (en) * 1998-05-15 1999-11-25 Promega Corporation ENZYMATICALLY-ACTIVE RECOMBINANT HUMAN β-TRYPTASE AND METHOD OF MAKING SAME
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US7332581B2 (en) 1999-01-15 2008-02-19 Genentech, Inc. Polypeptide variants with altered effector function
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
WO2001029246A1 (fr) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Procede de production d'un polypeptide
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US6630579B2 (en) 1999-12-29 2003-10-07 Immunogen Inc. Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use
US20060025576A1 (en) 2000-04-11 2006-02-02 Genentech, Inc. Multivalent antibodies and uses therefor
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
US20070061900A1 (en) 2000-10-31 2007-03-15 Murphy Andrew J Methods of modifying eukaryotic cells
US7041870B2 (en) 2000-11-30 2006-05-09 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
US20040110704A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells of which genome is modified
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
US20050260186A1 (en) 2003-03-05 2005-11-24 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases
US20060104968A1 (en) 2003-03-05 2006-05-18 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases
WO2005035586A1 (ja) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. 融合蛋白質組成物
WO2005035778A1 (ja) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法
US20050123546A1 (en) 2003-11-05 2005-06-09 Glycart Biotechnology Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
US7498298B2 (en) 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
WO2005053742A1 (ja) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. 抗体組成物を含有する医薬
US8318160B2 (en) 2003-12-23 2012-11-27 Genentech, Inc. Treatment of cancer with novel anti-IL13 monoclonal antibodies
US7674459B2 (en) 2003-12-23 2010-03-09 Genentech, Inc. Treatment of cancer with a novel anti-IL13 monoclonal antibody
US8088618B2 (en) 2003-12-23 2012-01-03 Genentech, Inc. Anti-IL 13 antibodies and uses thereof
US8734797B2 (en) 2003-12-23 2014-05-27 Genentech, Inc. Anti-IL13 antibodies and uses thereof
US8067199B2 (en) 2003-12-23 2011-11-29 Genentech, Inc. Anti-IL13 antibodies and uses thereof
EP1725261A2 (en) 2004-02-17 2006-11-29 Schering Corporation Use for interleukin-33 (il-33) and the il-33 receptor complex
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
WO2006013107A1 (en) 2004-08-05 2006-02-09 Novartis Ag Il-17 antagonistic antibodies
US20070253948A1 (en) 2004-09-02 2007-11-01 Chan Andrew C Anti-FC-gamma RIIB receptor antibody and uses therefor
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
WO2006044908A2 (en) 2004-10-20 2006-04-27 Genentech, Inc. Antibody formulation in histidine-acetate buffer
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
WO2007070750A1 (en) 2005-12-13 2007-06-21 Eli Lilly And Company Anti-il-17 antibodies
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
US20090182127A1 (en) 2006-06-22 2009-07-16 Novo Nordisk A/S Production of Bispecific Antibodies
US8187596B1 (en) 2006-07-20 2012-05-29 Schering Corporation Method of treating asthma or allergy by administering an IL-33 receptor antibody
US20080069820A1 (en) 2006-08-30 2008-03-20 Genentech, Inc. Multispecific antibodies
WO2008077546A1 (en) 2006-12-22 2008-07-03 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor i receptor and uses thereof
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
US8715669B2 (en) 2008-05-05 2014-05-06 Novimmune Sa Anti-IL-17A/IL-17F cross-reactive antibodies
WO2011031600A1 (en) 2009-09-10 2011-03-17 Schering Corporation Use of il-33 antagonists to treat fibrotic disease
US20110287009A1 (en) 2010-04-23 2011-11-24 Genentech, Inc. Production of Heteromultimeric Proteins
US20120156194A1 (en) 2010-12-16 2012-06-21 Genentech, Inc. Diagnosis and treatments relating to th2 inhibition
WO2012156219A1 (en) 2011-05-05 2012-11-22 Ablynx Nv Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
WO2013165894A2 (en) 2012-04-30 2013-11-07 Janssen Biotech, Inc. St2l antagonists and methods of use
WO2013173761A2 (en) 2012-05-18 2013-11-21 Amgen Inc. St2 antigen binding proteins
EP2913062A1 (en) * 2012-10-24 2015-09-02 Japan Innovative Therapeutics, Inc. Therapeutic or prophylactic agent for retinopathy of prematurity, method of testing for retinopathy of prematurity, and screening method for therapeutic or prophylactic substance for retinopathy of prematurity
WO2014164959A2 (en) 2013-03-13 2014-10-09 Regeneron Pharmaceuticals, Inc. Anti-il-33 antibodies and uses thereof
WO2014152195A1 (en) 2013-03-15 2014-09-25 Regeneron Pharmaceuticals, Inc. Il-33 antagonists and uses thereof
WO2015061441A1 (en) 2013-10-23 2015-04-30 Genentech, Inc. Methods of diagnosing and treating eosinophilic disorders
WO2015099175A1 (ja) 2013-12-26 2015-07-02 田辺三菱製薬株式会社 ヒト抗il-33中和モノクローナル抗体
WO2015106080A2 (en) 2014-01-10 2015-07-16 Anaptysbio, Inc. Antibodies directed against interleukin-33 (il-33)
US20160168242A1 (en) 2014-11-10 2016-06-16 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof

Non-Patent Citations (203)

* Cited by examiner, † Cited by third party
Title
"Peptide and Protein Drug Delivery", 1991, MARCEL DEKKER, INC., pages: 247 - 301
"Remington's Pharmaceutical Sciences", 1980
"UniProtKB", Database accession no. 095760
"UniProtKB", Database accession no. P05113
"UniProtKB", Database accession no. P35225
"UniProtKB", Database accession no. Q01638
"UniProtKB", Database accession no. Q16552
"UniProtKB", Database accession no. Q8TAD2
"UniProtKB", Database accession no. Q96PD4
"UniProtKB", Database accession no. Q9H293
"UniProtKB", Database accession no. Q9POM4
"UniProtKB", Database accession no. Q9UHF5
ADAMS ET AL., ACTA CRYSTALLOGR. D BIOL. CRYSTALLOGR., vol. 66, 2010, pages 213 - 221
ADAMS ET AL., ACTA CRYSTALLOGR. SECT. D-BIOL. CRYSTALLOGR., vol. 66, 2010, pages 213 - 221
ALMAGRO ET AL., FRONT. BIOSCI., vol. 13, 2008, pages 1619 - 1633
ALTER ET AL., BIOCHEM. J., vol. 248, 1987, pages 821 - 827
ANDRE FRENZEL ET AL: "Expression of Recombinant Antibodies", FRONTIERS IN IMMUNOLOGY, vol. 4, 1 January 2013 (2013-01-01), CH, XP055283974, ISSN: 1664-3224, DOI: 10.3389/fimmu.2013.00217 *
BACA ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684
BAEKKEVOLD ET AL., AM. J. PATHOL., vol. 163, no. 1, 2003, pages 69 - 79
BARBAS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 3809 - 3813
BELLOCQ ET AL., J. BIOL. CHEM., vol. 273, 1998, pages 5086
BOERNER ET AL., J. IMMUNOL., vol. 147, 1991, pages 86
BRENNAN ET AL., SCIENCE, vol. 229, no. 81, 1985
BRODEUR ET AL.: "Monoclonal Antibody Production Techniques and Applications", 1987, MARCEL DEKKER, INC., pages: 51 - 63
BRUGGEMANN ET AL., J. EXP. MED., vol. 166, 1987, pages 1351 - 1361
BRYCE ET AL., J. ALLERGY CLIN IMMUNOL., vol. 138, no. 3, 2016, pages 769 - 779
CAIRNS, J.A., PULMONARY PHARMACOLOGY & THERAPEUTICS, vol. 18, 2005, pages 55 - 66
CAPEL ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34
CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285
CATHERINE OVERED-SAYER ET AL: "Are mast cells instrumental for fibrotic diseases?", FRONTIERS IN PHARMACOLOGY, vol. 4, 1 January 2014 (2014-01-01), XP055466356, DOI: 10.3389/fphar.2013.00174 *
CHARI ET AL., CANCER RES., vol. 52, 1992, pages 127 - 131
CHARLTON: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 245 - 254
CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881
CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOWDHURY, METHODS MOL. BIOL., vol. 207, 2008, pages 179 - 196
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLYNES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656
CRAGG ET AL., BLOOD, vol. 101, 2003, pages 1045 - 1052
CRAGG ET AL., BLOOD, vol. 103, 2004, pages 2738 - 2743
CUNNINGHAM ET AL., SCIENCE, vol. 244, 1989, pages 1081 - 1085
DALL'ACQUA ET AL., METHODS, vol. 36, 2005, pages 43 - 60
DAUGHERTY A L ET AL: "Formulation and delivery issues for monoclonal antibody therapeutics", ADVANCED DRUG DELIVERY REVIEWS, ELSEVIER, AMSTERDAM, NL, vol. 58, no. 5-6, 7 August 2006 (2006-08-07), pages 686 - 706, XP024892149, ISSN: 0169-409X, [retrieved on 20060807], DOI: 10.1016/J.ADDR.2006.03.011 *
DAVIDS ET AL., S. AFR. MED. J., vol. 100, 2010, pages 307 - 307
DE HAAS ET AL., J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 41
DENNIS ET AL.: "Current Trends in Monoclonal Antibody Development and Manufacturing", SPRINGER, article "Ch. 2 CDR Repair: A Novel Approach to Antibody Humanization"
DIEGO MASELLI ET AL: "Profile of lebrikizumab and its potential in the treatment of asthma", JOURNAL OF ASTHMA AND ALLERGY, 1 August 2015 (2015-08-01), pages 87, XP055466247, DOI: 10.2147/JAA.S69932 *
DUBOWCHIK ET AL., BIOORG. & MED. CHEM. LETTERS, vol. 12, 2002, pages 1529 - 1532
DUNCAN ET AL., NATURE, vol. 322, 1988, pages 738 - 40
EIGENBROT ET AL., J. MOL. BIOL., vol. 229, 1993, pages 969 - 995
EMSLEY ET AL., ACTA CRYSTALLOGR. D BIOL. CRYSTALLOGR., vol. 66, 2010, pages 486 - 501
EMSLEY ET AL., ACTA CRYSTALLOGR. SECT. D-BIOL. CRYSTALLOGR., vol. 66, 2010, pages 486 - 501
ENGELBERG ET AL., CIRCULATION, vol. 23, 1961, pages 578 - 581
FAJARDO ET AL., BIOCHEM. J., vol. 369, 2003, pages 603 - 610
FA-PING WANG ET AL: "Efficacy and Safety of Anti-Interleukin 5 Therapy in Patients with Asthma: A Systematic Review and Meta-Analysis", PLOS ONE, 22 November 2016 (2016-11-22), pages 1 - 20, XP055466268, Retrieved from the Internet <URL:http://journals.plos.org/plosone/article/file?id=10.1371/journal.pone.0166833&type=printable> [retrieved on 20180411] *
FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472
FENG LI ET AL: "Current therapeutic antibody production and process optimisation", BIOPROCESSING: ADVANCES AND TRENDS IN BIOLOGICAL PRODUCTDEVELOPMENT, WILLIAMSBURG BIOPROCESSING FOUNDATION, US, 1 September 2005 (2005-09-01), pages 23 - 30, XP002519952, ISSN: 1538-8786 *
FLATMAN ET AL., J. CHROMATOGR. B, vol. 848, 2007, pages 79 - 87
FUKUOKA ET AL., J. IMMUNOL., vol. 176, 2006, pages 3165
FUKUOKA ET AL., J. IMMUNOL., vol. 176, 2006, pages 3165 - 3172
GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163
GEORGE H. CAUGHEY: "Mast cell tryptases and chymases in inflammation and host defense", IMMUNOLOGICAL REVIEWS., vol. 217, no. 1, 1 June 2007 (2007-06-01), US, pages 141 - 154, XP055466243, ISSN: 0105-2896, DOI: 10.1111/j.1600-065X.2007.00509.x *
GERNGROSS, NAT. BIOTECH., vol. 22, 2004, pages 1409 - 1414
GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59
GRIFFITHS ET AL., EMBO J., vol. 12, 1993, pages 725 - 734
GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368
GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587
HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY
HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896
HELLSTROM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502
HELLSTROM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063
HINMAN ET AL., CANCER RES., vol. 53, 1993, pages 3336 - 3342
HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HONG ET AL., J. BIOL. CHEM., vol. 286, no. 22, 2011, pages 20078 - 20086
HOOGENBOOM ET AL., J. MOL. BIOL., vol. 227, 1992, pages 381 - 388
HOOGENBOOM ET AL.: "Methods in Molecular Biology", vol. 178, 2001, HUMAN PRESS, pages: 1 - 37
HUDSON ET AL., NAT. MED., vol. 9, 2003, pages 129 - 134
HUNT ET AL., AM. J. RESPIR. CRIT. CARE MED., vol. 161, 2000, pages 694 - 699
IDUSOGIE ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184
JACKMAN ET AL., J. BIOL CHEM., vol. 285, no. 27, 2010, pages 20850 - 20859
JACKMAN ET AL., J. BIOL. CHEM., vol. 285, no. 27, 2010, pages 20850 - 20859
JACKSON ET AL., J. IMMUNOL., vol. 154, no. 7, 1995, pages 3310 - 3319
JEFFREY ET AL., BIOORGANIC & MED. CHEM. LETTERS, vol. 16, 2006, pages 358 - 362
JI ET AL., BIOTECHNOLOGY, vol. 98, 2009, pages 4485 - 4500
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
JONES, A., ADV. DRUG DELIVERY REV., vol. 10, 1993, pages 29 - 90
JUNYAN A. JI ET AL: "Methionine, tryptophan, and histidine oxidation in a model protein, PTH: Mechanisms and stabilization", JOURNAL OF PHARMACEUTICAL SCIENCES, vol. 98, no. 12, 19 May 2009 (2009-05-19), US, pages 4485 - 4500, XP055289086, ISSN: 0022-3549, DOI: 10.1002/jps.21746 *
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences of proteins of immunological interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", vol. 1-3, 1991, NIH PUBLICATION 91-3242
KABSCH, ACTA CRYSTALLOGR. D BIOL. CRYSTALLOGR., vol. 66, 2010, pages 125 - 132
KAKKAR ET AL., NAT. REV. DRUG DISC., vol. 7, 2008, pages 827 - 840
KAM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 102, 2005, pages 11600 - 11605
KAN ET AL., J. AM. SOC. MASS. SPECTROM., vol. 22, 2011, pages 1906 - 1915
KANDA ET AL., BIOTECHNOL. BIOENG., vol. 94, no. 4, 2006, pages 680 - 688
KASHMIRI ET AL., METHODS, vol. 36, 2005, pages 25 - 34
KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249
KING ET AL., J. MED. CHEM., vol. 45, 2002, pages 4336 - 4343
KIRSHENBAUM ET AL., LEUKEMIA RESEARCH, vol. 27, 2003, pages 677 - 682
KLIMKA ET AL., BR. J. CANCER, vol. 83, 2000, pages 252 - 260
KONTERMANN, ACTA PHARMACOL. SIN., vol. 26, 2005, pages 1 - 9
KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553
KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001
KRATZ ET AL., CURRENT MED. CHEM., vol. 13, 2006, pages 477 - 523
LARDNER J., LEUKOCYTE BIOL., vol. 69, 2001, pages 522
LAWREN C WU ET AL: "Targeting IgE production in mice and humans", CURRENT OPINION IN IMMUNOLOGY., vol. 31, 1 December 2014 (2014-12-01), GB, pages 8 - 15, XP055466249, ISSN: 0952-7915, DOI: 10.1016/j.coi.2014.08.001 *
LAWRENCE ET AL., J. MOL. BIOL., vol. 234, 1993, pages 946 - 950
LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132
LEE ET AL., J. MOL. BIOL., vol. 340, no. 5, 2004, pages 1073 - 1093
LEFRANGAIS ET AL., PROC. NATL. ACAD. SCI., vol. 109, no. 5, 2012, pages 1673 - 1678
LI ET AL., NAT. BIOTECH., vol. 24, 2006, pages 210 - 215
LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 3557 - 3562
LIANG ET AL., BIOORG. MED. CHEM. LETT., vol. 22, 2012, pages 1049 - 1054
LINGEL ET AL., STRUCTURE, vol. 17, no. 10, 2009, pages 1398 - 1410
LIU ET AL., PROC. NATL. ACAD. SCI., vol. 110, no. 37, 2013, pages 14918 - 14924
LODE ET AL., CANCER RES., vol. 58, 1998, pages 2925 - 2928
LOMBANA ET AL., SCI. REP., vol. 5, 2015, pages 17488
LONBERG, CURR. OPIN. IMMUNOL., vol. 20, 2008, pages 450 - 459
LONBERG, NAT. BIOTECH., vol. 23, 2005, pages 1117 - 1125
M. IN DAERON, ANNU. REV. IMMUNOL., vol. 15, 1997, pages 203 - 234
MALI ET AL., SCIENCE, vol. 339, 2013, pages 823 - 26
MARKS ET AL., BIOLTECHNOLOGY, vol. 10, 1992, pages 779 - 783
MARKS ET AL., J. MOL. BIOL., vol. 222, 1992, pages 581 - 597
MARKS ET AL.: "Methods in Molecular Biology", vol. 248, 2003, HUMAN PRESS, pages: 161 - 175
MARTIN, SEMIN. IMMUNOL., vol. 25, 2013, pages 449 - 457
MARVIN; ZHU, ACTA PHARMACOL. SIN., vol. 26, no. 6, 2005, pages 649 - 658
MATHER BIOL. REPROD., vol. 23, 1980, pages 243 - 251
MATHER ET AL., ANNALS N. Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68
MAYNE ET AL., J. AM. SOC. MASS. SPECTROM., vol. 22, 2011, pages 1898 - 1905
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554
MCCOY ET AL., J. APPL. CRYSTALLOGR., vol. 40, 2007, pages 658 - 674
MILSTEIN ET AL., NATURE, vol. 305, 1983, pages 537
MORRIS: "Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS, article "Epitope Mapping Protocols"
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
MURSHUDOV ET AL., ACTA CRYSTALLOGR. D BIOL. CRYSTALLOGR., vol. 67, 2011, pages 355 - 367
MURSHUDOV ET AL., ACTA CRYSTALLOGR. SECT. D-BIOL. CRYSTALLOGR., vol. 67, 2011, pages 355 - 367
NAGY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 829 - 834
NI, XIANDAI MIANYIXUE, vol. 26, no. 4, 2006, pages 265 - 268
OKAZAKI ET AL., J. MOL. BIOL., vol. 336, 2004, pages 1239 - 1249
OSBOURN ET AL., METHODS, vol. 36, 2005, pages 61 - 68
OTWINOWSKI, METHODS IN ENZYMOL., vol. 276, 1997, pages 307 - 326
PADLAN, MOL. IMMUNOL., vol. 28, 1991, pages 489 - 498
PAESEN ET AL., J. MOL. BIOI., vol. 368, 2007, pages 1172 - 86
PAN ET AL., BIOORG. MED. CHEM. LETT., vol. 16, 2006, pages 2882 - 85
PEREIRA ET AL., NATURE, vol. 392, 1998, pages 306 - 11
PEREIRA ET AL., NATURE, vol. 392, 1998, pages 306 - 311
PEREIRA ET AL., NATURE, vol. 392, 1999, pages 306 - 11
PETKOVA ET AL., INTL. IMMUNOL., vol. 18, no. 12, 2006, pages 1759 - 1769
PINHEIRO DE OLIVEIRA ET AL., CRITICAL CARE, vol. 14, 2010, pages R39
PLUCKTHUN: "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, pages: 269 - 315
PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599
PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
QIAN ET AL., J. ORG. CHEM., vol. 67, 2002, pages 3595 - 3600
QUEEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 10029 - 10033
RAVETCH ET AL., ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329
RIPKA ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 249, 1986, pages 533 - 545
ROSOK ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 22611 - 22618
S REN ET AL: "Human tryptase fibrinogenolysis is optimal at acidic pH and generates anticoagulant fragments in the presence of the anti-tryptase monoclonal antibody B12", THE JOURNAL OF IMMUNOLOGY, 1 October 1997 (1997-10-01), United States, pages 3540, XP055491271, Retrieved from the Internet <URL:http://www.jimmunol.org/content/jimmunol/159/7/3540.full.pdf> *
SAKAI ET AL., J. CLIN. INVEST., vol. 97, 1996, pages 988 - 995
SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155
SCHWARTZ ET AL., IMMUNOL. ALLERGY CLIN. N. AM., vol. 26, 2006, pages 451 - 463
SCHWARTZ ET AL., J. BIOL. CHEM., vol. 261, 1986, pages 7372 - 7370
SCHWARTZ ET AL., J. BIOL. CHEM., vol. 261, 1986, pages 7372 - 7379
SCHWARTZ ET AL., J. CLIN. INVEST., vol. 83, 1989, pages 1551 - 1555
SCHWARTZ ET AL., J. IMMUNOL., vol. 144, 1990, pages 2304 - 11
SCHWARTZ ET AL., J. IMMUNOL., vol. 144, 1990, pages 2304 - 2311
SCHWARTZ L B ET AL: "DEVELOPMENT OF A NEW, MORE SENSITIVE IMMUNOASSAY FOR HUMAN TRYPTASE: USE IN SYSTEMIC ANAPHYLAXIS", JOURNAL OF CLINICAL IMMUNOLOGY, KLUWER ACADEMIC PUBLISHERS, NEW YORK, vol. 14, no. 3, 1 May 1994 (1994-05-01), pages 190 - 204, XP000647677, ISSN: 0271-9142, DOI: 10.1007/BF01533368 *
SCHWARTZ L B ET AL: "IMMUNOLOGIC AND PHYSICOCHEMICAL EVIDENCE FOR CONFORMATIONAL CHANGES OCCURRING ON CONVERSION OF HUMAN MAST CELL TRYPTASE FROM ACTIVE TETRAMER TO INACTIVE MONOMER", THE JOURNAL OF IMMUNOLOGY, THE AMERICAN ASSOCIATION OF IMMUNOLOGISTS, US, vol. 144, no. 6, 15 March 1990 (1990-03-15), pages 2304 - 2311, XP002028190, ISSN: 0022-1767 *
SCHWARTZ, IMMUNOL. ALLERGY CLIN. N. AM., vol. 26, 2006, pages 451 - 463
SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604
SIDHU ET AL., J. MOL. BIOL., vol. 338, no. 2, 2004, pages 299 - 310
SIMMONS ET AL., J. IMMUNOL. METHODS, vol. 263, 2002, pages 133 - 147
SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296
SOMMERHOFF ET AL., BIOI. CHEM., vol. 373, 1997, pages 685 - 94
SOMMERHOFF ET AL., PROC. NATL. ACAD. SCI. USA, vol. 96, 1999, pages 10984 - 91
SONG ET AL., J. MOL. BIOL., vol. 275, 1998, pages 347 - 363
STEEN ET AL., J. NEUROSCIENCE, vol. 15, 1995, pages 3982
STELLA ET AL.: "Directed Drug Delivery", 1985, HUMANA PRESS, article "Prodrugs: A Chemical Approach to Targeted Drug Delivery", pages: 247 - 267
SUTTON ET AL., BIOORG. MED. CHEM. LETT., vol. 12, 2002, pages 3229 - 33
TORGOV ET AL., BIOCONJ. CHEM., vol. 16, 2005, pages 717 - 721
TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655
TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60
URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216
VAN DIJK ET AL., CURR. OPIN. PHARMACOL., vol. 5, 2001, pages 368 - 74
VOLLMERS ET AL., HISTOLOGY AND HISTOPATHOLOGY, vol. 20, no. 3, 2005, pages 927 - 937
VOLLMERS ET AL., METHODS AND FINDINGS IN EXPERIMENTAL AND CLINICAL PHARMACOLOGY, vol. 27, no. 3, 2005, pages 185 - 91
VONRHEIN ET AL., ACTA. CRYSTALLOGR., vol. D67, 2011, pages 293 - 302
WALLS A F ET AL: "PRODUCTION AND CHARACTERIZATION OF MONOCLONAL ANTIBODIES SPECIFIC FOR HUMAN MAST CELL TRYPTASE", CLINICAL & EXPERIMENTAL ALLERGY : JOURNAL OF THE BRITISH SOCIETY FOR ALLERGY AND CLINICAL IMMUNOLOGY, WILEY INTERSCIENCE, UK, vol. 20, no. 5, 1 September 1990 (1990-09-01), pages 581 - 589, XP000647681, ISSN: 0954-7894 *
WALTERS ET AL., J. AM. SOC. MASS SPECTROM., vol. 23, 2012, pages 2132 - 2139
WALTERS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 110, 2013, pages 18898 - 18903
WANG W ET AL: "ANTIBODY STRUCTURE, INSTABILITY, AND FORMULATION", JOURNAL OF PHARMACEUTICAL SCIENCES, AMERICAN CHEMICAL SOCIETY AND AMERICAN PHARMACEUTICAL ASSOCIATION, US, vol. 96, no. 1, 1 January 2007 (2007-01-01), pages 1 - 26, XP009084505, ISSN: 0022-3549, DOI: 10.1002/JPS.20727 *
WILMAN: "Prodrugs in Cancer Chemotherapy", BIOCHEMICAL SOCIETY TRANSACTIONS, vol. 14, 1986, pages 375 - 382
WINN ET AL., ACTA CRYSTALLOGR. D BIOL. CRYSTALLOGR., vol. 67, 2011, pages 235 - 242
WINN ET AL., ACTA CRYSTALLOGR. SECT. D-BIOL. CRYSTALLOGR., vol. 67, 2011, pages 235 - 242
WINTER ET AL., ANN. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455
WRIGHT ET AL., TIBTECH, vol. 15, 1997, pages 26 - 32
Y. FUKUOKA ET AL: "The B12 Anti-Tryptase Monoclonal Antibody Disrupts the Tetrameric Structure of Heparin-Stabilized -Tryptase to Form Monomers That Are Inactive at Neutral pH and Active at Acidic pH", THE JOURNAL OF IMMUNOLOGY, vol. 176, no. 5, 1 March 2006 (2006-03-01), US, pages 3165 - 3172, XP055465896, ISSN: 0022-1767, DOI: 10.4049/jimmunol.176.5.3165 *
YAMANE-OHNUKI ET AL., BIOTECH. BIOENG., vol. 87, 2004, pages 614
YANYAN GUO ET AL: "Tryptase is a candidate autoantigen in rheumatoid arthritis", IMMUNOLOGY, vol. 142, no. 1, 10 April 2014 (2014-04-10), GB, pages 67 - 77, XP055465877, ISSN: 0019-2805, DOI: 10.1111/imm.12197 *
YAZAKI ET AL.: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 255 - 268
YELTON ET AL., J. IMMUNOL., vol. 155, 1995, pages 1994 - 2004
ZAPATA ET AL., PROTEIN ENG., vol. 8, no. 10, 1995, pages 1057 - 1062

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019157358A1 (en) 2018-02-09 2019-08-15 Genentech, Inc. Therapeutic and diagnostic methods for mast cell-mediated inflammatory diseases
CN110006871A (zh) * 2019-02-20 2019-07-12 常州大学 一个基于外源性组胺检测的细胞模型以及应用
WO2021055694A1 (en) 2019-09-20 2021-03-25 Genentech, Inc. Dosing for anti-tryptase antibodies
JP2022549218A (ja) * 2019-09-20 2022-11-24 ジェネンテック, インコーポレイテッド 抗トリプターゼ抗体の投薬
WO2023019239A1 (en) 2021-08-13 2023-02-16 Genentech, Inc. Dosing for anti-tryptase antibodies

Also Published As

Publication number Publication date
US20190367637A1 (en) 2019-12-05
UA126574C2 (uk) 2022-11-02
JP2020505927A (ja) 2020-02-27
JP2021098699A (ja) 2021-07-01
BR112019016595A2 (pt) 2020-03-31
CL2021002503A1 (es) 2022-04-22
TWI778018B (zh) 2022-09-21
CN116715775A (zh) 2023-09-08
AR110873A1 (es) 2019-05-08
JP2023103257A (ja) 2023-07-26
MX2019009485A (es) 2019-11-05
JP6995127B2 (ja) 2022-02-04
US11939396B2 (en) 2024-03-26
RU2019127870A (ru) 2021-03-10
AU2018217816A1 (en) 2019-08-15
CN110494453A (zh) 2019-11-22
US20240368306A1 (en) 2024-11-07
US20180230233A1 (en) 2018-08-16
CN110494453B (zh) 2023-05-26
US20200325248A1 (en) 2020-10-15
ZA201905023B (en) 2023-12-20
KR20190129040A (ko) 2019-11-19
RU2771485C2 (ru) 2022-05-04
CL2019002251A1 (es) 2019-11-29
MY197534A (en) 2023-06-21
IL268249A (en) 2019-09-26
US10738131B2 (en) 2020-08-11
EP3580240A1 (en) 2019-12-18
US10752703B2 (en) 2020-08-25
PE20191548A1 (es) 2019-10-24
MA47459A (fr) 2019-12-18
CO2019009787A2 (es) 2019-09-18
TW201835105A (zh) 2018-10-01
KR102362006B1 (ko) 2022-02-14
CR20190387A (es) 2019-09-25
CA3051700A1 (en) 2018-08-16
SG11201907364WA (en) 2019-09-27
JP7716858B2 (ja) 2025-08-01
PH12019501872A1 (en) 2020-06-29
RU2019127870A3 (enExample) 2021-06-08

Similar Documents

Publication Publication Date Title
US20240368306A1 (en) Anti-tryptase antibodies, compositions thereof, and uses thereof
US20160207995A1 (en) Anti-il-4 antibodies and bispecific antibodies and uses thereof
US20170334985A1 (en) Anti-il-13/il-17 bispecific antibodies and uses thereof
US20250002609A1 (en) Anti-klk5 antibodies and methods of use
WO2015123325A1 (en) Anti-jagged1 antibodies and methods of use
HK40018388A (en) Anti-tryptase antibodies, compositions thereof, and uses thereof
HK40018388B (en) Anti-tryptase antibodies, compositions thereof, and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18707205

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3051700

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019541323

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018217816

Country of ref document: AU

Date of ref document: 20180209

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019016595

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20197026305

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: NC2019/0009787

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 2018707205

Country of ref document: EP

Effective date: 20190910

WWP Wipo information: published in national office

Ref document number: NC2019/0009787

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112019016595

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190809

WWG Wipo information: grant in national office

Ref document number: NC2019/0009787

Country of ref document: CO

WWW Wipo information: withdrawn in national office

Ref document number: 268249

Country of ref document: IL