WO2018128429A1 - 이노시톨 다인산 멀티키나아제 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물 - Google Patents

이노시톨 다인산 멀티키나아제 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물 Download PDF

Info

Publication number
WO2018128429A1
WO2018128429A1 PCT/KR2018/000203 KR2018000203W WO2018128429A1 WO 2018128429 A1 WO2018128429 A1 WO 2018128429A1 KR 2018000203 W KR2018000203 W KR 2018000203W WO 2018128429 A1 WO2018128429 A1 WO 2018128429A1
Authority
WO
WIPO (PCT)
Prior art keywords
ipmk
expression
pharmaceutical composition
mice
inflammatory
Prior art date
Application number
PCT/KR2018/000203
Other languages
English (en)
French (fr)
Inventor
김세윤
김은하
변지윤
Original Assignee
한국과학기술원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한국과학기술원 filed Critical 한국과학기술원
Publication of WO2018128429A1 publication Critical patent/WO2018128429A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/13—Nucleic acids or derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/70—Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088—Compounds having three or more nucleosides or nucleotides
    • A61K31/713—Double-stranded nucleic acids or oligonucleotides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2200/00—Function of food ingredients
    • A23V2200/30—Foods, ingredients or supplements having a functional effect on health
    • A23V2200/324—Foods, ingredients or supplements having a functional effect on health having an effect on the immune system
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/01—Phosphotransferases with an alcohol group as acceptor (2.7.1)
    • C12Y207/01151—Inositol-polyphosphate multikinase (2.7.1.151)
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention relates to a pharmaceutical composition for the prevention or treatment of inflammatory diseases containing an inositol polyphosphate multikinase inhibitor.
  • SIRS Systemic Inflammatory Response Syndrome
  • cytokines such as TNF- ⁇ and IL-6
  • sepsis is a systemic infection that involves severe vascular occlusion induced by TNF- ⁇ .
  • systemic release of TNF- ⁇ causes shock by loss of plasma volume due to vasodilation and increased permeability of blood vessels (Schulte W, et al ., Mediators Inflamm, 2013: 165974).
  • Microglia corresponding to macrophages present in the central nervous system, activate immune responses due to various exogenous and endogenous substances. Activated microglia produce and release substances such as inflammatory cytokines TNF- ⁇ and IL-1 ⁇ . Production of such materials is the short term, can lead to the induction of apoptosis of the adjacent neuron functional degeneration when induce an immune response, but they are excessive or continuous production (von Bernhardi R, et al., Front Aging Neurosci, 2015 Jul 20; 7: 124).
  • IPMK inositol polyphosphate multikinase
  • mice with bone marrow cell-specific IPMK gene removal is higher survival rate than sepsis than wild-type mice, IL in tissue when inducing endotoxemia
  • the present invention was completed by confirming that an increase in mRNA and protein expression levels of inflammatory cytokines such as -1 ⁇ , IL-6, and TNF- ⁇ is suppressed.
  • Another object of the present invention is to provide a method for screening candidates for the treatment of inflammatory diseases by measuring the level of expression or activity of IPMK.
  • the present invention provides a pharmaceutical composition for the prevention or treatment of inflammatory diseases containing an inhibitor of IPMK expression or activity as an active ingredient.
  • the present invention provides a dietary supplement for improving inflammatory disease containing IPMK expression or activity inhibitor as an active ingredient.
  • the present invention comprises the steps of 1) preparing an IPMK expressing cell line; 2) treating the test substance to the cell line of step 1); 3) measuring the expression or activity level of the IPMK cell line treated with the test substance; And 4) selecting a test substance whose expression or activity of IPMK is decreased compared to a control group not treated with the test substance.
  • mice lacking the IPMK gene have a higher survival rate than sepsis, and increased mRNA and protein expression levels of inflammatory cytokines such as IL-1 ⁇ , IL-6, and TNF- ⁇ in endocytosis. Since inhibited, compositions containing IPMK inhibitors can be usefully used for the treatment of inflammatory diseases.
  • FIG. 1 is a graph comparing the survival rate by sepsis in wild-type mice (Ipmk fl / fl ) and bone marrow cells specifically IPMK-removed mice (Ipmk ⁇ Mac ).
  • Figure 2 is a graph comparing the body temperature change after induction of endotoxin with lipid polysaccharides in wild-type mice (Ipmk fl / fl ) and bone marrow cells specifically IPMK-removed mice (Ipmk ⁇ Mac ).
  • FIG. 3 is a graph comparing the weight loss of wild type mice (control) and bone marrow cell-specific mice with IPMK removed (experimental group) 48 hours after induction of endotoxin.
  • FIG. 4 is a graph comparing the feeding amount of wild-type mice (control) and bone marrow cell-specific IPMK-removed mice (experimental group) 48 hours after induction of endotoxin.
  • Figure 5 is within the lead to toxin hypertriglyceridemia induces inflammation from the spleen tissue of six hours later, the wild-type mice (Ipmk fl / fl), and bone marrow cell specific as mice (Ipmk ⁇ Mac) the IPMK is removed cytokine IL-6 or TNF It is a graph comparing the mRNA expression amount of - ⁇ .
  • FIG. 6 shows the inflammation-induced cytokine IL-6 or TNF from lung tissues of wild-type mice (Ipmk fl / fl ) and myeloid cell-specific mice (Ipmk ⁇ Mac ) 6 hours after induction of endotoxemia. It is a graph comparing the mRNA expression amount of - ⁇ .
  • FIG. 7 shows IL-6, an inflammation-inducing cytokine IL-6 from wild-type mice (Ipmk fl / fl ) and cerebral cortical tissues of bone marrow cells specifically IPMK- free mice (Ipmk ⁇ Mac ) after inducing endotoxemia or It is a graph comparing the mRNA expression amount of TNF- ⁇ .
  • FIG. 8 shows the inflammation-induced cytokines IL-1 ⁇ and TNF from cerebral cortex or hypothalamus of wild type mice (WT) and bone marrow cell-specific mice (KO) after 18 hours of induction of endotoxin. It is a graph comparing the mRNA expression amount of - ⁇ or IL-6.
  • FIG. 9 shows IL-6 or TNF-, an inflammation-inducing cytokine in serum of wild-type mice (Ipmk fl / fl ) and bone marrow cell-specific mice (Ipmk ⁇ Mac ) 6 hours after induction of endotoxemia. It is a graph comparing the amount of protein of ⁇ .
  • FIG. 10 shows IL-6, an inflammation-inducing cytokine of IL-6, from the cerebral cortical tissues of wild-type mice (Ipmk fl / fl ) and bone marrow cells specifically IPMK- depleted mice (Ipmk ⁇ Mac ) 6 hours after induction of endotoxemia. It is a graph comparing protein amount.
  • FIG. 11 is an inflammation-induced cytokine IL-1 ⁇ in macrophages obtained from bone marrow cells of wild-type mice (Ipmk fl / fl ) induced myotoxemia and bone marrow cells (Ipmk ⁇ Mac ) of bone marrow cells specifically IPMK removed, It is a graph comparing mRNA expression amount of IL-6 or TNF- ⁇ .
  • FIG. 12 shows IL-1 ⁇ , an inflammation-inducing cytokine in macrophages obtained from bone marrow cells of wild-type mice (Ipmk fl / fl ) that induced endotoxemia and mice (Ipmk ⁇ Mac ) that were specifically depleted of bone marrow cells (Ipmk ⁇ Mac ) or It is a graph comparing the protein expression amount of TNF- ⁇ .
  • FIG. 13 is a graph confirming that expression of IPMK gene is suppressed by processing siRNA targeting IPMK gene in RAW 264.7 cells (ScRNA: random siRNA; siRNA: siRNA targeting IPMK).
  • Figure 15 shows induction of endotoxemia in RAW 264.7 cells, followed by treatment with random sequence RNA (ScRNA) or siRNA (siRNA) targeting the IPMK gene, an inflammation-inducing cytokine, IL-1 ⁇ , IL-6 or TNF- ⁇ .
  • ScRNA random sequence RNA
  • siRNA siRNA
  • FIG. 16 is a diagram showing that Ipmk-targeting siRNA effectively inhibits Ipmk expression in intraperitoneal macrophages when complexed with RVG-9RC peptide targeting macrophages.
  • FIG. 17 is a diagram illustrating survival rate due to sepsis when mice injected with IPMK-targeting siRNA complexed with RVG-9RC peptides specifically targeting macrophages.
  • the present invention provides a pharmaceutical composition for the prevention or treatment of inflammatory diseases containing an inhibitor of the expression or activity of IPMK as an active ingredient.
  • the expression inhibitor of IPMK may be any one or more selected from the group consisting of antisense nucleotides, small interfering RNAs (siRNAs), and short hairpin RNAs (shRNAs) that complementarily bind to mRNAs of the IPMK gene.
  • the expression inhibitor of IPMK may be siRNA complementary to the mRNA of the IPMK gene, the siRNA is a sense strand consisting of the nucleotide sequence of SEQ ID NO: 9 and the antisense strand consisting of the nucleotide sequence of SEQ ID NO: 10 It may be configured as.
  • the IPMK gene may comprise a polynucleotide consisting of any sequence known in the art.
  • the IPMK gene may be a polynucleotide consisting of the nucleotide sequence of SEQ ID NO: 13.
  • the polynucleotide includes not only a polynucleotide sequence consisting of the nucleotide sequence of SEQ ID NO: 13, but also a polynucleotide having a nucleotide sequence substantially identical to the polynucleotide and a fragment thereof. Polynucleotides having substantially the same base sequence may have a homology of 80% or more, specifically 90% or more, more specifically 95% or more with the polynucleotide of the present invention.
  • the polynucleotide of the present invention may include a variant in which one or more nucleotide sequences are substituted, deleted or inserted as long as they encode a protein having equivalent activity.
  • the inhibitor of expression of IPMK may comprise variants having one or more substitutions, insertions, deletions and combinations thereof that do not degrade their activity. Such variants may have at least 80% homology with the IPMK expression inhibitor sequences of the invention, specifically 90%, more specifically at least 95% homology.
  • the expression inhibitor of the IPMK may be synthesized by a variety of methods known in the art, such as direct chemical synthesis, synthesis using in vitro transcription.
  • the antisense nucleotides as defined in the Watson-Crick base pair, refer to the binding (hybridization) to the complementary sequencing of DNA, immature-mRNA or mature mRNA to hinder the flow of genetic information from DNA to protein.
  • the siRNA refers to a short double-stranded RNA capable of inducing RNA interference through cleavage of specific mRNA.
  • the siRNA may be composed of a sense strand having a nucleotide sequence of SEQ ID NO: 9 and an antisense strand having a nucleotide sequence of SEQ ID NO: 10.
  • the siRNA is not limited to completely paired double-stranded RNA portion paired with RNA, mismatch (corresponding base is not complementary), bulge (the base corresponding to one chain does not have), etc. It may also include a portion that is not paired by.
  • the siRNA terminal structures can be either smooth or protruding ends as long as the expression of the target gene can be suppressed by RNA interference effects, and the adhesive end structures can be both 3 'and 5' terminal protruding structures.
  • the sense strand may further have a base sequence of dCdT by overhanging at the 3 'end.
  • the shRNA may be a double stranded RNA of hairpin structure having a loop region of the base constituting it.
  • the base of such a loop region can use those known in the art, and the double stranded portion of RNA can be constructed identically to siRNA, which can have the characteristics as described above.
  • the activity inhibitor of the IPMK may be any one or more selected from the group consisting of compounds, peptides, peptide mimetics and antibodies that complementarily bind to the IPMK protein.
  • the IPMK protein may comprise a polypeptide consisting of any sequence known in the art.
  • the IPMK protein may be a polypeptide consisting of the amino acid sequence of SEQ ID NO: 14.
  • the polypeptide may be a variant or fragment of an amino acid having a different sequence by deletion, insertion, substitution, or a combination of amino acid residues within a range that does not affect the function of the protein.
  • Amino acid exchange in proteins or peptides that do not alter the activity of the molecule as a whole is known in the art. In some cases, it may be modified by phosphorylation, sulfation, acrylation, glycosylation, methylation, farnesylation, or the like.
  • the present invention may include a polypeptide having an amino acid sequence substantially identical to a polypeptide having an amino acid sequence set forth in SEQ ID NO: 14, and variants or fragments thereof. Such substantially identical polypeptides may have homology with at least 80%, in particular at least 90%, more specifically at least 95%, with the polypeptides of the invention.
  • the peptide and peptide mimetics may be to inhibit the activity of the IPMK protein by inhibiting the IPMK protein from binding to other proteins.
  • Peptides may be variants or fragments of amino acids having different sequences by deletion, insertion, substitution or combination of amino acid residues, to the extent that they do not affect the function of the protein.
  • Non-hydrolyzable peptide mimetics can be prepared using ⁇ -turn dipeptide cores, keto-methylene pseudopeptides, azepins, benzodiazepines, ⁇ -aminoalcohols or substituted gammalactam rings as major residues.
  • the antibody may be a monoclonal antibody, polyclonal antibody or recombinant antibody.
  • Antibodies to a particular protein can be readily prepared using techniques well known in the art, provided that the sequence of the protein is known. Such monoclonal antibodies can be prepared using hybridoma methods, or phage antibody library techniques known in the art. In general, hybridoma cells secreting monoclonal antibodies can be made by fusing cancer cells with immune cells isolated from immunologically suitable host animals, such as mice injected with antigenic proteins. These two populations of cell fusion are fused using methods known in the art, such as polyethylene glycol, and the antibody producing cells are propagated by standard culture methods.
  • Subcloning can be performed using limiting dilution and hybridoma cells capable of producing an antibody specific for the antigen after obtaining a uniform cell population can be prepared by culturing in large quantities in vitro or in vivo.
  • Antibodies prepared by the above method can be isolated and purified using methods such as gel electrophoresis, dialysis, salt precipitation, ion exchange chromatography, affinity chromatography and the like.
  • the polyclonal antibody can be prepared by injecting an immunogen biomarker protein or fragment thereof into an external host according to methods known in the art.
  • the external host can be a mammal such as a mouse, rat, sheep, rabbit.
  • the immunogen When the immunogen is injected by intramuscular, intraperitoneal or subcutaneous injection methods, it can be administered with an adjuvant to increase antigenicity. Thereafter, blood may be collected periodically from an external host to obtain serum showing improved titer and specificity for the antigen, from which the antibody may be isolated and purified.
  • the inflammatory diseases include inflammatory skin diseases, allergic diseases, inflammatory bowel disease, peritonitis, osteomyelitis, cellulitis, meningitis, encephalitis, pancreatitis, cystic fibrosis, bronchitis, gout, spondylitis, arthritis, Lyme disease, vasculitis, sepsis, septic shock , Acute respiratory distress syndrome, chronic hepatitis, esophagitis, gastritis, colitis, pneumonia, bronchitis, sore throat, kidney failure, psoriasis, anemia or fibrosis.
  • the present inventors have a high survival rate for sepsis compared to wild-type mice in which the bone marrow cell-specific IPMK gene is removed (see Fig. 1), the body temperature and weight loss is reduced, the amount of feeding This increase was confirmed (see FIGS. 2 to 4).
  • mice in which the bone marrow cell-specific IPMK gene was removed during endotoxemia induction increased the mRNA and protein expression levels of IL-1 ⁇ , IL-6 and TNF- ⁇ , which are inflammation-inducing cytokines, in tissues, unlike wild-type mice. It was confirmed that is suppressed (see Figs. 5 to 10).
  • mice in which bone marrow-specific IPMK genes were removed during endotoxemia induction mRNAs of IL-1 ⁇ , IL-6 and TNF- ⁇ , which are inflammation-inducing cytokines in macrophages isolated from bone marrow cells, unlike wild-type mice And it was confirmed that the increase in the amount of protein expression is inhibited (see FIGS. 11 and 12).
  • FIGS. 11 and 12 it was confirmed that an increase in the mRNA and protein expression levels of the inflammation-induced cytokines IL-1 ⁇ , IL-6 and TNF- ⁇ in cells treated with siRNA for the IPMK gene was inhibited (FIG. 14 and FIG. 15). It was confirmed that the siRNA complexed with the phagocytic specific peptide increased the survival rate by inhibition of the expression of the IPMK gene in mice inducing sepsis (see FIGS. 16 and 17).
  • substances that inhibit the expression or activity of IPMK can be usefully used for the treatment of inflammatory diseases.
  • the pharmaceutical composition may include 10 to 95% by weight of an inhibitor of expression or activity of IPMK according to the present invention, which is an active ingredient, based on the total weight of the pharmaceutical composition.
  • the pharmaceutical composition of the present invention may further contain one or more active ingredients exhibiting the same or similar functions in addition to the active ingredient.
  • compositions of the present invention may also include carriers, diluents, excipients or combinations of two or more commonly used in biological agents.
  • Pharmaceutically acceptable carriers are not particularly limited so long as they are suitable for delivery of the composition in vivo, see, eg, Merck Index, 13th ed., Merck & Co. Inc.
  • the compound, saline solution, sterile water, Ringer's solution, buffered saline solution, dextrose solution, maltodextrin solution, glycerol, ethanol or one or more of these components may be mixed.
  • other conventional additives such as antioxidants, buffers, bacteriostatic agents, and the like may be added.
  • composition When formulating the composition, it is prepared using commonly used diluents or excipients, such as fillers, extenders, binders, wetting agents, disintegrating agents, surfactants.
  • diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrating agents, surfactants.
  • composition of the present invention may be formulated as an oral or parenteral preparation.
  • Solid form preparations for oral administration include tablets, pills, powders, granules, capsules, troches, and the like, which may comprise at least one excipient such as starch, calcium carbonate, sucrose, It may be prepared by mixing lactose and gelatin.
  • lubricants such as magnesium styrate and talc may also be added.
  • liquid preparations include suspensions, solvents, emulsions, or syrups, and may include excipients such as wetting agents, sweeteners, fragrances, and preservatives.
  • Formulations for parenteral administration may include injections such as sterile aqueous solutions, non-aqueous solutions, suspensions, emulsions, and the like.
  • non-aqueous solvent and the suspension solvent propylene glycol, polyethylene glycol, vegetable oil such as olive oil, injectable ester such as ethyl oleate, and the like can be used.
  • composition of the present invention may be administered orally or parenterally according to a desired method, and parenteral administration may be external or intraperitoneal injection, rectal injection, subcutaneous injection, intravenous injection, intramuscular injection or intrathoracic injection injection. Can be selected.
  • composition according to the invention is administered in a pharmaceutically effective amount. This may vary depending on the type of disease, the severity, the activity of the drug, the sensitivity to the drug, the time of administration, the route of administration and the rate of release, the duration of treatment, the drug being used simultaneously, and the like.
  • the composition of the present invention may be administered alone or in combination with other therapeutic agents. In combination administration, administration may be sequential or simultaneous.
  • the amount of the active ingredient included in the pharmaceutical composition according to the present invention may be 0.001 to 10,000 mg / kg, specifically 0.1 g to 5 g / kg.
  • the administration may be once a day or may be divided several times.
  • the present invention provides a dietary supplement for improving inflammatory disease containing IPMK expression or activity inhibitor as an active ingredient.
  • the inhibitor of expression or activity of IMPK may have the characteristics as described above.
  • the expression inhibitor of IPMK may be any one or more selected from the group consisting of antisense nucleotides, small interfering RNA and short hairpin RNA that complementarily binds to the mRNA of the IPMK gene.
  • the activity inhibitor of the IPMK may be any one or more selected from the group consisting of compounds, peptides, peptide mimetics and antibodies that complementarily bind to IPMK protein.
  • the inflammatory diseases include inflammatory skin diseases, allergic diseases, inflammatory bowel disease, peritonitis, osteomyelitis, cellulitis, meningitis, encephalitis, pancreatitis, cystic fibrosis, bronchitis, gout, spondylitis, arthritis, Lyme disease, vasculitis, sepsis, septic shock , Acute respiratory distress syndrome, chronic hepatitis, esophagitis, gastritis, colitis, pneumonia, bronchitis, sore throat, kidney failure, psoriasis, anemia or fibrosis.
  • the present inventors have a high survival rate for sepsis compared to wild-type mice in which the bone marrow cell-specific IPMK gene is removed (see FIG. 1), and the degree of body temperature and weight decrease is small (FIG. 2 and FIG. 3), induction of endothelial hypertension inhibits the increase of mRNA and protein expression levels of the inflammatory-induced cytokines IL-1 ⁇ , IL-6 and TNF- ⁇ in macrophages isolated from tissues or bone marrow cells. It was confirmed (see FIGS. 5-12).
  • substances that inhibit the expression or activity of IPMK can be usefully used for the improvement of inflammatory diseases.
  • Inhibitors of expression or activity of IPMKs of the present invention can be added to foods as is or used in combination with other foods or food ingredients. At this time, the amount of the active ingredient added may be determined according to the purpose. In general, the content in the dietary supplement may be from 0.01 to 90 parts by weight of the total food weight.
  • the form and type of the health functional food is not particularly limited.
  • the health functional food to which the substance can be added may be tablets, capsules, powders, granules, liquids and pills.
  • the health functional food of the present invention may contain various flavors or natural carbohydrates and the like as additional ingredients, as in the general health functional food.
  • the above-mentioned natural carbohydrates are sugars such as monosaccharides such as glucose and fructose, malsaccharides such as maltose and sucrose, polysaccharides such as dextrin and cyclodextrin, xylitol, sorbitol and erythritol.
  • natural sweetening agents such as tautin and stevia extract, synthetic sweetening agents such as saccharin and aspartame, and the like can be used.
  • the health functional food of the present invention includes various nutrients, vitamins, electrolytes, flavors, coloring agents, pectic acid and salts thereof, alginic acid and salts thereof, organic acids, protective colloid thickeners, pH adjusting agents, stabilizers, preservatives, glycerin, Alcohol and the like. These components can be used independently or in combination. The proportion of such additives may be selected in the range of 0.01 to 0.1 parts by weight per 100 parts by weight of the composition of the present invention.
  • the present invention comprises the steps of 1) preparing an IPMK expressing cell line; 2) treating the test substance to the cell line of step 1); 3) measuring the expression or activity level of the IPMK cell line treated with the test substance; And 4) provides a method for screening an inflammatory disease treatment candidate comprising the step of screening the test substance is reduced in expression or activity of the IPMK compared to the control group not treated with the test substance.
  • the IPMK gene expressed in the cell line of step 1) may include a polynucleotide consisting of any sequence known in the art.
  • the IPMK gene may be a polynucleotide consisting of the nucleotide sequence of SEQ ID NO: 13.
  • the polynucleotide may have the characteristics as described above.
  • the cell line may be overexpressed IPMK protein or fragment thereof by transformation of the IPMK gene.
  • the expression or activity of the IPMK may be measured by immunoprecipitation, radioimmunoassay, enzyme immunoassay, immunohistochemistry, RT-PCR, Western blot or flow cytometry, but the transcripts or proteins encoded therefrom known to those skilled in the art. Any method of measuring quantity can be used.
  • the inflammatory diseases include inflammatory skin diseases, allergic diseases, inflammatory bowel disease, peritonitis, osteomyelitis, cellulitis, meningitis, encephalitis, pancreatitis, cystic fibrosis, bronchitis, gout, spondylitis, arthritis, Lyme disease, vasculitis, sepsis, septic shock , Acute respiratory distress syndrome, chronic hepatitis, esophagitis, gastritis, colitis, pneumonia, bronchitis, sore throat, kidney failure, psoriasis, anemia or fibrosis.
  • the present inventors have a high survival rate for sepsis compared to wild-type mice in which the bone marrow cell-specific IPMK gene is removed (see FIG. 1), and the degree of body temperature and weight decrease is small (FIG. 2 and FIG. 3), induction of endothelial hypertension inhibits the increase of mRNA and protein expression levels of the inflammatory-induced cytokines IL-1 ⁇ , IL-6 and TNF- ⁇ in macrophages isolated from tissues or bone marrow cells. It was confirmed (see FIGS. 5-12).
  • a substance whose expression or activity of IPMK screened by the above method is reduced compared to the control may be useful for the treatment of inflammatory diseases.
  • mice with IPMK gene specifically removed from bone marrow cells were prepared. Specifically, a mouse was constructed by inserting a loxP site into the 51 bp upper intron of the start of the 6th exon of IPMK and another loxP site below the 2476 bp of the 6th exon stop codon, and defined it as Ipmk fl / fl .
  • Ipmk fl / fl mice prepared in the above method and the mice expressing Cre-recombinase only by the activation of the LysM promoter expressing bone marrow cells to produce a mouse bone marrow cells specific IPMK gene is removed, This was defined as Ipmk ⁇ Mac .
  • the control and experimental mice were anesthetized and then opened, and the cecum was removed. About 70% of the total cecum was tied with a surgical suture and knotted, and then passed through the cecal region bound with a 21G injection needle.
  • the abdominal cavity was sutured with a surgical suture and the skin was sutured once more with a clip. 1 ml of 37 ° C. saline was injected to revive, and survival rate was observed every 24 hours after surgery. Survival was calculated by Kaplan-Meier survival analysis. Statistical analysis was performed using log rank method, and the maximum limit of significance was p ⁇ 0.05.
  • mice with the bone marrow cell-specific IPMK gene was removed compared to the wild type mice increased the survival rate for sepsis (Fig. 1).
  • RNA concentration 300 ng / ⁇ l. 10 ⁇ l of RNA, oligo-dT primers, and water to which diethylpyrocarboxylic acid was added were mixed and initially denatured at 65 ° C. for 5 minutes.
  • IL-6 forward (SEQ ID NO: 1) ATGAACAACGATGATGCACTT IL-6 reverse (SEQ ID NO: 2) TATCCAGTTTGGTAGCATCCAT TNF- ⁇ forward (SEQ ID NO: 3) CACAAGATGCTGGGACAGTGA TNF- ⁇ reverse (SEQ ID NO: 4) GAGGCTCCAGTGAATTCGGA IL-1 ⁇ forward (SEQ ID NO: 5) GCCTCGTGCTGTCGGACC IL-1 ⁇ reverse (SEQ ID NO: 6) TGTCGTTGCTTGGTTCTCCTTG
  • the bone marrow cell-specific IPMK gene-free mice unlike wild-type mice, the mRNA expression level of IL-6 and TNF- ⁇ in the spleen, lung and cortical tissues The increase was suppressed (FIGS. 5-7).
  • Example ⁇ 3-1> 18 hours after induction of endotoxin, IL-1 ⁇ , IL-6 and TNF- ⁇ under the same conditions and methods as in Example ⁇ 3-1>, except that cerebral cortex or hypothalamus tissue obtained from the sacrificed mice was used. MRNA expression level was analyzed. Primer sequences used are as shown in Table 1 above. All experimental values were mean ⁇ standard error (mean ⁇ SEM). Statistics were analyzed by Student's t-test, and the maximum limit of significance was p ⁇ 0.05.
  • mice in which bone marrow cell-specific IPMK genes were removed were found to express mRNA levels of IL-1 ⁇ , IL-6, and TNF- ⁇ in cerebral cortex or hypothalamus tissue. The increase was suppressed (FIG. 8).
  • endotoxemia was induced in mice under the same conditions and methods as in Example 2. After 6 hours, blood was collected from the orbital vein and coagulated at room temperature for 30 minutes, followed by centrifugation to obtain supernatant serum. On the other hand, the mice were sacrificed, cortical tissues were obtained from the sacrificed mice, and proteins were extracted according to a conventional method. Protein levels of IL-6 and TNF- ⁇ were analyzed according to the manufacturer's method using an enzyme-linked immunosorbent assay (ELISA) kit (BD biosciences, Cat no. 555240 and 558534). All experimental values were mean ⁇ standard error (mean ⁇ SEM). Statistics were analyzed by Student's t-test, and the maximum limit of significance was p ⁇ 0.05.
  • ELISA enzyme-linked immunosorbent assay
  • mice in which bone marrow cell-specific IPMK genes were removed are proteins of IL-6 or TNF- ⁇ , which are inflammation-inducing cytokines in serum and cerebral cortical tissues. An increase in the amount of expression was suppressed (FIGS. 9 and 10).
  • mice in which the bone marrow cell-specific IPMK gene was removed are different from wild-type mice in the myeloid cell-derived macrophage, IL-1 ⁇ , IL-6 or TNF. Increasing mRNA and protein expression levels of - ⁇ were inhibited (FIGS. 11 and 12).
  • Random RNA was used to determine whether the expression of the IPMK gene was suppressed by siRNA against the IPMK gene.
  • Random RNA is composed of a sense strand having a nucleotide sequence of SEQ ID NO: 7 and an antisense strand having a nucleotide sequence of SEQ ID NO: 8, the sense strand was designed to have a more nucleotide sequence of dTdT by overhanging at the 3 'end.
  • siRNA targeting the IPMK gene consists of a sense strand having a nucleotide sequence of SEQ ID NO: 9 and an antisense strand having a nucleotide sequence of SEQ ID NO: 10, the sense strand is further added to the base sequence of dCdT by the overhang at the 3 'end It was made to have.
  • the RAW 264.7 cell line a mouse-derived macrophage line, was dispensed in 7.5 ⁇ 10 5 cells in each well into 6-well plates. After 16 hours, siRNA or 100 pmole random RNA for 100 pmole IPMK gene was mixed with 125 ⁇ l Opti-MEM (invitrogen, US, Cat No. 31985070).
  • siRNA and random RNA were mixed with 125 ⁇ l Opti-MEM containing 9 ⁇ l of lipofectamine LTX (invitrogen, US, Cat No. 15338-100) and reacted. After 5 minutes, 250 ⁇ l of the reaction solution was dispensed and cultured in 6-well plates in which RAW 264.7 cell lines were grown. After 48 hours, the cell culture was removed, and 700 ⁇ l of Tri-reagent (MRC) was added to the remaining cells to obtain cells.
  • MRC Tri-reagent
  • Example ⁇ 6-1> the siRNA or random RNA targeting the IPMK gene was treated to RAW 264.7 cells, and 42 hours later, lipopolysaccharide dissolved in PBS was treated to cells at a concentration of 100 ng / ml. Toxinemia was induced. After 6 hours, cell cultures were obtained and analyzed for protein levels of IL-1 ⁇ , IL-6 and TNF- ⁇ according to the manufacturer's method using ELISA kits (BD biosciences, Cat no. 559603, 555240 and 558534).
  • the RVG-9RC peptide (YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRRC; SEQ ID NO: 15), reported to be capable of delivering siRNA specifically macrophages, was synthesized through Peptron, and purified by HPLC with greater than 95% purity (Kim et al., Silencing CCR2 in Macrophages Alleviates). Adipose Tissue Inflammation and the Associated Metabolic Syndrome in Dietary Obese Mice.Molecular Therapy-Nucleic Acid, 2016, 5: e280). Lyophilized RVG-9RC peptide was suspended in distilled water at a concentration of 5 mg / ml, and siRNA for IPMK gene was prepared at a concentration of 100 mM.
  • the peptide was suspended in 100 ml PBS at 16 nmole and siRNA at 400 pmole, followed by reaction at room temperature for 5 minutes. Then, the PBS suspension containing siRNA was mixed drop by drop into a tube containing peptide, and the complex thus prepared was reacted at room temperature for 15 minutes and delivered into the abdominal cavity.
  • siRNA was specifically delivered to the scRNA or IPMK gene. After 24 hours, 10 ml of PBS was injected into the abdominal cavity, and then massaged to collect the cells in the abdominal cavity. Then, the intraperitoneal PBS was recovered using a syringe and centrifuged at 1200 rpm for 5 minutes.
  • all experimental values were expressed as mean ⁇ standard error (mean ⁇ SEM), and statistical analysis was performed by Student's t-test, and the maximum significance limit was set to p ⁇ 0.05.
  • the male C57BL / 6J mice were opened, and the caecum was removed, and about 70% of the entire caecum was tied with surgical sutures and knotted and passed through the caecum area bound with 21G needles.
  • the abdominal cavity was sutured with a surgical suture and the skin was sutured once more with a clip.
  • 1 ml injection of 37 ° C. physiological saline was resuspended and 2 hours after surgery, the method was delivered macrophages specific siRNA targeting scRNA or IPMK. Thereafter, siRNA was further delivered two times at 24 hour intervals, and survival rate was observed.
  • the survival rate was calculated by kaplan-Meier survival analysis and statistical analysis was performed by log-rank test. The maximum significance limit was set at p ⁇ 0.05.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Mycology (AREA)
  • Cell Biology (AREA)
  • Hematology (AREA)
  • Microbiology (AREA)
  • Urology & Nephrology (AREA)
  • Food Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Polymers & Plastics (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Toxicology (AREA)
  • Nutrition Science (AREA)
  • Analytical Chemistry (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Organic Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)

Abstract

본 발명은 이노시톨 다인산 멀티키나아제 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물에 관한 것이다. 구체적으로, IPMK가 제거된 생쥐는 야생형 생쥐에 비해 패혈증에 대한 생존율이 높고, 내독소혈증 유도시 조직 내 IL-1β, IL-6 및 TNF-α와 같은 염증성 사이토카인의 mRNA 및 단백질 발현량의 증가가 억제되므로, IPMK 억제제를 함유하는 조성물은 염증성 질환의 치료에 유용하게 사용될 수 있다.

Description

이노시톨 다인산 멀티키나아제 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물
본 발명은 이노시톨 다인산 멀티키나아제 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물에 관한 것이다.
박테리아 등에 의한 감염은 전신적 염증 또는 전신적 염증성 반응 증후군(Systemic Inflammatory Response Syndrome, SIRS)을 일으킬 수 있는 면역 반응을 개시하게 한다. 과도한 면역반응은 다양한 중증도의 발열, 저독혈증(hypotoxemia), 트라킵니아(trachypnea), 빈박, 내피 염증, 심근 기능부전 등을 발생시키며, 특히 신경계에서의 과도한 면역반응은 정신상태이상, 급성 호흡곤란 증후군, 혼수 등을 발생시킬 수 있다. 감염이 일어나면, 감염 부위의 대식세포가 활성화되어 TNF-α 및 IL-6 등의 사이토카인을 분비하여, 조직으로의 혈장 단백질 방출량, 및 대식세포와 림프구의 이동이 증가하고, 혈관벽에 대한 혈소판의 부착이 증가한다. 이러한 방식으로, 국소 혈관이 폐색되고 병원체가 감염 부위에 집중된다. 특히, 패혈증은 전신성 감염으로서, TNF-α에 의해 유도된 심각한 혈관 폐색을 수반한다. 또한, TNF-α의 전신적 방출은 혈관확장 및 혈관의 투과성 증가로 인한 혈장 체적의 손실을 초래하여 쇼크를 일으킨다(Schulte W, et al., Mediators Inflamm, 2013:165974).
최근 염증반응이 신경퇴행을 유발하는 주요 기전의 하나라는 사실이 밝혀지고 있다. 중추신경계에 존재하는 대식세포에 해당하는 소신경교세포는 다양한 외인성 및 내인성 물질로 인해 면역반응을 활성화시킨다. 활성화된 소신경교세포는 염증성 사이토카인인 TNF-α 및 IL-1β 등의 물질을 생산 및 방출한다. 이러한 물질들의 생성은 단기적으로는 면역반응을 유발하지만, 이들이 과도하거나 지속적으로 생산되면 근접한 신경세포들의 사멸을 유도하여 기능성 퇴행을 유발할 수 있다(von Bernhardi R, et al., Front Aging Neurosci, 2015 Jul 20;7:124).
이때, 세균감염에 의한 과도한 면역반응을 억제한다는 점에 착안하여 염증성 사이토카인인 TNF-α, IL-1β, IL-6 등에 대한 길항물질을 염증 치료제로서 사용하고자 하였으나 대부분 실패하였다. 또한, 활성 단백질 C(activated protein C)를 투여하거나 글루코코르티코이드를 이용한 치료 등이 현재 시도되고 있으나 여러 가지 한계점이 있다. 따라서, 높은 사망률을 보임에도 아직까지 뚜렷한 치료제가 개발되지 않은 과다 선천성 면역질환인 패혈증 및 이와 관련된 염증의 치료를 위한 새로운 치료제의 개발이 필요하다.
한편, 이노시톨 다인산 멀티키나아제(IPMK)는 세포 내에서 이노시톨 다인산의 생합성에 필수적인 대사효소로서 세포의 성장 및 대사반응에 관여하는 단백질이다(Chakraborty A, et al., Sci Signal, 2011 Aug 23;4(188)). 이와 관련하여, IPMK 효소 단백질이 세포내 신호전달과 대사를 조절함으로써 세포사멸 및 성장과 관련된 유전자의 발현을 활성화시키는 기전들이 알려져 있다(Xu R et al., Sci Signal, 2013 Apr 2;6(269); Kim E et al., Proc Natl Acad Sci USA, 2013 Dec 3;110(49):19938-43).
이에, 본 발명자들은 염증성 질환의 치료에 사용하기 위한 물질을 개발하던 중, 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐가 야생형 생쥐에 비해 패혈증에 대한 생존율이 높고, 내독소혈증 유도시 조직 내 IL-1β, IL-6 및 TNF-α와 같은 염증성 사이토카인의 mRNA 및 단백질 발현량의 증가가 억제됨을 확인함으로써, 본 발명을 완성하였다.
본 발명의 목적은 IPMK의 발현 또는 활성 억제제를 유효성분으로 함유하는 조성물 및 이의 용도를 제공하는 것이다.
본 발명의 다른 목적은 IPMK의 발현 또는 활성 정도의 측정을 통해 염증성 질환의 치료를 위한 후보물질을 스크리닝하는 방법을 제공하는 것이다.
상기 목적을 달성하기 위하여, 본 발명은 IPMK의 발현 또는 활성 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 본 발명은 IPMK의 발현 또는 활성 억제제를 유효성분으로 함유하는 염증성 질환의 개선용 건강기능식품을 제공한다.
아울러, 본 발명은 1) IPMK 발현 세포주를 준비하는 단계; 2) 상기 단계 1)의 세포주에 피검물질을 처리하는 단계; 3) 상기 피검물질이 처리된 세포주의 IPMK의 발현 또는 활성 정도를 측정하는 단계; 및 4) 상기 IPMK의 발현 또는 활성 정도가 피검물질을 처리하지 않은 대조군에 비해 감소하는 피검물질을 선별하는 단계를 포함하는 염증성 질환의 치료를 위한 후보물질의 스크리닝 방법을 제공한다.
IPMK 유전자가 제거된 생쥐는 야생형 생쥐에 비해 패혈증에 대한 생존율이 높고, 내독소혈증 유도시 조직 내 IL-1β, IL-6 및 TNF-α와 같은 염증성 사이토카인의 mRNA 및 단백질 발현량의 증가가 억제되므로, IPMK 억제제를 함유하는 조성물은 염증성 질환의 치료에 유용하게 사용될 수 있다.
도 1은 야생형 생쥐(Ipmkfl /fl)와 골수세포 특이적으로 IPMK가 제거된 생쥐(IpmkΔMac)에서 패혈증에 의한 생존률을 비교한 그래프이다.
도 2는 야생형 생쥐(Ipmkfl /fl)와 골수세포 특이적으로 IPMK가 제거된 생쥐(IpmkΔMac)에서 지질 다당류로 내독소혈증을 유도한 후 체온 변화를 비교한 그래프이다.
도 3은 내독소혈증을 유도하고 48시간 뒤, 야생형 생쥐(대조군)와 골수세포 특이적으로 IPMK가 제거된 생쥐(실험군)의 체중 감소량을 비교한 그래프이다.
도 4는 내독소혈증을 유도하고 48시간 뒤, 야생형 생쥐(대조군)와 골수세포 특이적으로 IPMK가 제거된 생쥐(실험군)의 섭식량을 비교한 그래프이다.
도 5는 내독소혈증을 유도하고 6시간 뒤, 야생형 생쥐(Ipmkfl /fl)와 골수세포 특이적으로 IPMK가 제거된 생쥐(IpmkΔMac)의 비장 조직으로부터 염증 유도 사이토카인인 IL-6 또는 TNF-α의 mRNA 발현량을 비교한 그래프이다.
도 6은 내독소혈증을 유도하고 6시간 뒤, 야생형 생쥐(Ipmkfl /fl)와 골수세포 특이적으로 IPMK가 제거된 생쥐(IpmkΔMac)의 폐 조직으로부터 염증 유도 사이토카인인 IL-6 또는 TNF-α의 mRNA 발현량을 비교한 그래프이다.
도 7은 내독소혈증을 유도하고 6시간 뒤, 야생형 생쥐(Ipmkfl /fl)와 골수세포 특이적으로 IPMK가 제거된 생쥐(IpmkΔMac)의 대뇌피질 조직으로부터 염증 유도 사이토카인인 IL-6 또는 TNF-α의 mRNA 발현량을 비교한 그래프이다.
도 8은 내독소혈증을 유도하고 18시간 뒤, 야생형 생쥐(WT)와 골수세포 특이적으로 IPMK가 제거된 생쥐(KO)의 대뇌피질 또는 시상하부 조직으로부터 염증 유도 사이토카인인 IL-1β, TNF-α 또는 IL-6의 mRNA 발현량을 비교한 그래프이다.
도 9는 내독소혈증을 유도하고 6시간 뒤, 야생형 생쥐(Ipmkfl /fl)와 골수세포 특이적으로 IPMK가 제거된 생쥐(IpmkΔMac)의 혈청 내 염증 유도 사이토카인인 IL-6 또는 TNF-α의 단백질량을 비교한 그래프이다.
도 10은 내독소혈증을 유도하고 6시간 뒤, 야생형 생쥐(Ipmkfl /fl)와 골수세포 특이적으로 IPMK가 제거된 생쥐(IpmkΔMac)의 대뇌피질 조직으로부터 염증 유도 사이토카인인 IL-6의 단백질량을 비교한 그래프이다.
도 11은 내독소혈증을 유도한 야생형 생쥐(Ipmkfl /fl)와 골수세포 특이적으로 IPMK가 제거된 생쥐(IpmkΔMac)의 골수세포로부터 수득한 대식세포에서 염증 유도 사이토카인인 IL-1β, IL-6 또는 TNF-α의 mRNA 발현량을 비교한 그래프이다.
도 12는 내독소혈증을 유도한 야생형 생쥐(Ipmkfl /fl)와 골수세포 특이적으로 IPMK가 제거된 생쥐(IpmkΔMac)의 골수세포로부터 수득한 대식세포에서 염증 유도 사이토카인인 IL-1β 또는 TNF-α의 단백질 발현량을 비교한 그래프이다.
도 13은 RAW 264.7 세포에서 IPMK 유전자를 타겟하는 siRNA를 처리함으로써 IPMK 유전자의 발현이 억제되는 것을 확인한 그래프(ScRNA: 무작위 siRNA; siRNA: IPMK를 타겟하는 siRNA)이다.
도 14는 RAW 264.7 세포에 내독소혈증을 유도한 후, 무작위 서열 RNA(ScRNA) 또는 IPMK 유전자를 타겟하는 siRNA(siRNA)를 처리하여 염증 유도 사이토카인인 IL-1β, IL-6 또는 TNF-α의 mRNA 발현량을 비교한 그래프이다.
도 15는 RAW 264.7 세포에 내독소혈증을 유도한 후, 무작위 서열 RNA(ScRNA) 또는 IPMK 유전자를 타겟하는 siRNA(siRNA)를 처리하여 염증 유도 사이토카인인 IL-1β, IL-6 또는 TNF-α의 단백질량을 비교한 그래프이다.
도 16은 생쥐에 Ipmk를 타겟하는 siRNA를 대식세포를 특이적으로 타겟하는 RVG-9RC 펩티드와 복합체를 형성하여 주입하였을 때 복강 내 대식세포에서 효과적으로 Ipmk 발현을 저해함을 나타낸 도이다.
도 17은 생쥐에 Ipmk를 타겟하는 siRNA를 대식세포를 특이적으로 타겟하는 RVG-9RC 펩티드와 복합체를 형성하여 주입하였을 때, 패혈증으로 인한 생존율을 분석한 도이다.
이하 본 발명을 상세히 설명한다.
본 발명은 IPMK의 발현 또는 활성 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물을 제공한다.
상기 IPMK의 발현 억제제는 IPMK 유전자의 mRNA에 상보적으로 결합하는 안티센스 뉴클레오티드, 작은 간섭 RNA(small interfering RNA, siRNA) 및 짧은 헤어핀 RNA(short hairpin RNA, shRNA)로 구성된 군에서 선택되는 어느 하나 이상일 수 있다. 구체적으로, 상기 IPMK의 발현 억제제는 IPMK 유전자의 mRNA에 상보적으로 결합하는 siRNA일 수 있으며, 상기 siRNA는 서열번호 9의 염기서열로 구성되는 센스 가닥 및 서열번호 10의 염기서열로 구성되는 안티센스 가닥으로 구성될 수 있다.
상기 IPMK 유전자는 통상의 기술분야에 알려진 어떠한 서열로 구성되는 폴리뉴클레오티드를 포함할 수 있다. 본 발명의 일 실시예에서, 상기 IPMK 유전자는 서열번호 13의 염기서열로 구성되는 폴리뉴클레오티드일 수 있다.
상기 폴리뉴클레오티드는 서열번호 13의 염기서열로 구성되는 폴리뉴클레오티드 서열뿐만 아니라, 상기 폴리뉴클레오티드와 실질적으로 동일한 염기서열을 갖는 폴리뉴클레오티드 및 이의 단편을 포함한다. 실질적으로 동일한 염기서열을 갖는 폴리뉴클레오티드는 본 발명의 폴리뉴클레오티드와 80％ 이상, 구체적으로는 90％ 이상, 더욱 구체적으로는 95％ 이상의 상동성을 가질 수 있다. 본 발명의 폴리뉴클레오티드는 이와 동등한 활성을 갖는 단백질을 코딩하는 한, 하나 이상의 염기서열이 치환, 결실 또는 삽입된 변이체를 포함할 수 있다.
상기 IPMK의 발현 억제제는 그 활성을 저하시키지 않는 하나 이상의 치환, 삽입, 결실 및 그 조합을 갖는 변이체를 포함할 수 있다. 이러한 변이체는 본 발명의 IPMK 발현 억제제 서열과 80% 이상의 상동성을 가질 수 있으며, 구체적으로는 90%, 더욱 구체적으로는 95% 이상의 상동성을 가질 수 있다. 또한, 상기 IPMK의 발현 억제제는 직접 화학적으로 합성하거나, 인비트로 전사를 이용하여 합성하는 등 당업계에 공지된 다양한 방법에 의해 합성될 수 있다.
상기 안티센스 뉴클레오티드는 왓슨-크릭 염기쌍에 정의된 바에 따라, DNA, 미성숙-mRNA 또는 성숙된 mRNA의 상보적 염기서열에 결합(혼성화)하여 DNA에서 단백질로의 유전정보 흐름을 방해하는 것을 말한다.
상기 siRNA는 특정 mRNA의 절단을 통하여 RNA 간섭을 유도할 수 있는 짧은 이중가닥 RNA를 말한다. 본 발명의 일 실시예에서, 상기 siRNA는 서열번호 9의 염기서열을 갖는 센스 가닥과 서열번호 10의 염기서열을 갖는 안티센스 가닥으로 구성될 수 있다. 또한, 상기 siRNA는 RNA끼리 짝을 이루는 이중가닥 RNA 부분이 완전히 쌍을 이루는 것에 한정되지 않고, 미스매치(대응하는 염기가 상보적이지 않음), 벌지(일방의 사슬에 대응하는 염기가 없음) 등에 의하여 쌍을 이루지 않는 부분도 포함할 수 있다. siRNA 말단 구조는 표적 유전자의 발현을 RNA 간섭 효과에 의하여 억제할 수 있는 것이면 평활 말단 또는 돌출 말단 모두 가능하며, 점착 말단 구조는 3' 말단 돌출 구조와 5' 말단 돌출 구조 모두 가능하다. 센스 가닥은 3'말단에 오버행으로 dCdT의 염기서열을 추가로 더 가질 수 있다.
상기 shRNA는 이를 구성하는 염기의 루프 영역을 갖는 헤어핀 구조의 이중 가닥 RNA일 수 있다. 이러한 루프 영역의 염기는 당업계에 공지된 것들을 사용할 수 있으며, RNA의 이중 가닥 부분은 상술한 바와 같은 특징을 가질 수 있는 siRNA와 동일하게 구성할 수 있다.
상기 IPMK의 활성 억제제는 IPMK 단백질에 상보적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스 및 항체로 구성된 군에서 선택되는 어느 하나 이상일 수 있다.
상기 IPMK 단백질은 통상의 기술분야에 알려진 어떠한 서열로 구성되는 폴리펩티드를 포함할 수 있다. 본 발명의 일 실시예에서, 상기 IPMK 단백질은 서열번호 14의 아미노산 서열로 구성되는 폴리펩티드일 수 있다.
상기 폴리펩티드는 단백질의 기능에 영향을 미치지 않는 범위 내에서, 아미노산 잔기의 결실, 삽입, 치환 또는 이들의 조합에 의해서 상이한 서열을 가지는 아미노산의 변이체 또는 단편일 수 있다. 분자의 활성을 전체적으로 변경시키지 않는 단백질 또는 펩티드에서의 아미노산 교환은 당해 분야에 공지되어 있다. 경우에 따라서는 인산화(phosphorylation), 황화(sulfation), 아크릴화(acrylation), 당화(glycosylation), 메틸화(methylation), 파네실화(farnesylation) 등으로 수식(modification)될 수 있다. 따라서, 본 발명은 상기 서열번호 14로 기재되는 아미노산 서열을 갖는 폴리펩티드와 실질적으로 동일한 아미노산 서열을 갖는 폴리펩티드, 및 이의 변이체 또는 단편을 포함할 수 있다. 상기 실질적으로 동일한 폴리펩티드는 본 발명의 폴리펩티드와 80％ 이상, 구체적으로 90％ 이상, 더욱 구체적으로 95％ 이상으로 상동성을 가질 수 있다.
상기 펩티드 및 펩티드 미메틱스(Peptide Mimetics)는 IPMK 단백질이 다른 단백질과 결합하는 것을 억제함으로써 IPMK 단백질의 활성을 억제하는 것일 수 있다. 펩티드는 단백질의 기능에 영향을 미치지 않는 범위 내에서, 아미노산 잔기의 결실, 삽입, 치환 또는 이들의 조합에 의해서 상이한 서열을 가지는 아미노산의 변이체 또는 단편일 수 있다. 비가수분해성 펩티드 미메틱스는 주요 잔기로서 β-턴 디펩티드 코어, 케토-메틸렌 슈도펩티드류, 아제핀, 벤조디아제핀, β-아미노알콜 또는 치환 감마락탐환을 사용하여 제조할 수 있다.
상기 항체는 단일클론항체, 다클론항체 또는 재조합항체일 수 있다. 특정 단백질에 대한 항체는 단백질의 서열이 공지되어 있다면 당업계에 잘 알려진 기술을 이용하여 용이하게 제조할 수 있다. 상기 단일클론 항체는 당업계에 공지된 하이브리도마 방법, 또는 파지 항체 라이브러리 기술을 이용하여 제조될 수 있다. 일반적으로, 단일클론항체를 분비하는 하이브리도마 세포는 항원 단백질을 주사한 마우스와 같이 면역학적으로 적합한 숙주 동물로부터 분리된 면역 세포와 암 세포주를 융합하여 만들 수 있다. 이런 두 집단의 세포 융합은 폴리에틸렌글리콜과 같이 본 발명이 속하는 기술 분야에 공지되어 있는 방법을 이용하여 융합시키고 항체 생산 세포를 표준적인 배양 방법에 의해 증식시킨다. 한계 희석법을 이용하여 서브 클로닝을 실시하고, 균일한 세포 집단을 수득한 뒤 항원에 특이적인 항체를 생산할 수 있는 하이브리도마 세포를 시험관 또는 생체 내에서 대량으로 배양하여 제조할 수 있다. 상기 방법으로 제조된 항체는 겔 전기영동, 투석, 염 침전, 이온교환 크로마토그래피, 친화성 크로마토그래피 등의 방법을 이용하여 분리 및 정제될 수 있다.
상기 다클론 항체는 당업계에 알려진 방법에 따라 면역원인 바이오마커 단백질 또는 그 단편을 외부 숙주에 주사함으로써 제조될 수 있다. 외부 숙주는 마우스, 래트, 양, 토끼와 같은 포유동물일 수 있다. 상기 면역원이 근내, 복강내 또는 피하 주사 방법으로 주사되는 경우, 항원성을 증가시키기 위한 보조제(adjuvant)와 함께 투여될 수 있다. 이후, 외부 숙주로부터 정기적으로 혈액을 채취하여 향상된 역가 및 항원에 대한 특이성을 보이는 혈청을 수득하고 이로부터 항체를 분리 및 정제하여 제조될 수 있다.
상기 염증성 질환은 염증성 피부질환, 알레르기성 질환, 염증성 장 질환, 복막염, 골수염, 봉소염, 뇌막염, 뇌염, 췌장염, 낭포성 섬유증, 기관지염, 통풍, 척추염, 관절염, 라임병, 혈관염, 패혈증, 패혈성 쇼크, 급성 호흡곤란 증후군, 만성간염, 식도염, 위염, 대장염, 폐렴, 기관지염, 인후염, 신부전, 건선, 빈혈 또는 섬유화증일 수 있다.
본 발명의 구체적인 실시예에서, 본 발명자들은 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐가 야생형 생쥐에 비해 패혈증에 대한 생존율이 높고(도 1 참조), 체온과 체중이 감소한 정도가 적으며, 섭식량이 증가함을 확인하였다(도 2 내지 도 4 참조). 또한, 내독소혈증 유도시 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐는 야생형 생쥐와 달리 조직 내에서 염증 유도 사이토카인인 IL-1β, IL-6 및 TNF-α의 mRNA 및 단백질 발현량의 증가가 억제됨을 확인하였다(도 5 내지 도 10 참조). 또한, 내독소혈증 유도시 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐는 야생형 생쥐와 달리 골수세포로부터 분리된 대식세포 내에서 염증 유도 사이토카인인 IL-1β, IL-6 및 TNF-α의 mRNA 및 단백질 발현량의 증가가 억제됨을 확인하였다(도 11 및 도 12 참조). 아울러, IPMK 유전자에 대한 siRNA를 처리한 세포에서 염증 유도 사이토카인인 IL-1β, IL-6 및 TNF-α의 mRNA 및 단백질 발현량의 증가가 억제됨을 확인하였고(도 14 및 도 15), 대식세포 특이적 펩티드와 복합체를 형성한 상기 siRNA가 패혈증이 유도된 생쥐에서 IPMK 유전자의 발현이 억제에 의한 생존률이 증가하였음을 확인하였다(도 16 및 17 참조).
따라서, IPMK의 발현 또는 활성을 억제하는 물질은 염증성 질환의 치료에 유용하게 사용될 수 있다.
상기 약학적 조성물은 약학적 조성물 전체 중량에 대하여 유효성분인 본 발명에 따른 IPMK의 발현 또는 활성 억제제를 10 내지 95 중량%로 포함할 수 있다. 또한, 본 발명의 약학적 조성물은 상기 유효성분 외에 추가로 동일 또는 유사한 기능을 나타내는 유효성분을 1종 이상 추가로 함유할 수 있다.
본 발명의 조성물은 또한 생물학적 제제에 통상적으로 사용되는 담체, 희석제, 부형제 또는 둘 이상의 이들의 조합을 포함할 수 있다. 약제학적으로 허용 가능한 담체는 조성물을 생체 내에 전달하는데 적합한 것이면 특별히 제한되지 않으며, 예로서, Merck Index, 13th ed., Merck & Co. Inc. 에 기재된 화합물, 식염수, 멸균수, 링거액, 완충 식염수, 덱스트로스 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 또는 이들 성분 중 1 성분 이상을 혼합한 것일 수 있다. 이때, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다.
상기 조성물을 제제화할 경우, 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 제조된다.
본 발명의 조성물은 경구제제 또는 비경구제제로 제형화 될 수 있다. 경구 투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제, 트로키제 등이 포함되며, 이러한 고형 제제는 하나 이상의 조성물에 적어도 하나 이상의 부형제, 예를 들면, 전분, 탄산칼슘, 수크로스, 락토오스 및 젤라틴 등을 섞어 조제될 수 있다. 또한, 마그네슘 스티레이트, 탈크 같은 윤활제들도 첨가될 수 있다. 한편, 액상 제제로는 현탁제, 내용액제, 유제 또는 시럽제 등이 해당되는데, 여기에는 습윤제, 감미제, 방향제, 보존제 등과 같은 부형제가 포함될 수 있다.
비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁용제, 유제 등의 주사제가 포함될 수 있다.
비수성용제, 현탁용제로는 프로필렌글리콜, 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다.
본 발명의 조성물은 목적하는 방법에 따라 경구 투여하거나 비경구 투여될수 있으며, 비경구 투여는 피부 외용 또는 복강내 주사, 직장내 주사, 피하주사, 정맥주사, 근육내 주사 또는 흉부내 주사 주입방식중 선택될 수 있다.
본 발명에 따른 조성물은 약제학적으로 유효한 양으로 투여된다. 이는 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 동시 사용되는 약물 등에 따라 달라질 수 있다. 본 발명의 조성물은 단독 또는 다른 치료제와 병용하여 투여될 수 있다. 병용 투여시, 투여는 순차적 또는 동시일 수 있다.
그러나, 바람직한 효과를 위해서, 본 발명에 따른 약학적 조성물에 포함되는 유효성분의 양은 0.001 ~ 10,000 mg/㎏, 구체적으로는 0.1 g ~ 5 g/kg 일 수 있다. 상기 투여는 하루에 1회일 수 있고, 수회로 나뉠 수도 있다.
또한, 본 발명은 IPMK의 발현 또는 활성 억제제를 유효성분으로 함유하는 염증성 질환의 개선용 건강기능식품을 제공한다.
상기 IMPK의 발현 또는 활성 억제제는 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 IPMK의 발현 억제제는 IPMK 유전자의 mRNA에 상보적으로 결합하는 안티센스 뉴클레오티드, 작은 간섭 RNA 및 짧은 헤어핀 RNA로 구성된 군에서 선택되는 어느 하나 이상일 수 있다. 한편, 상기 IPMK의 활성 억제제는 IPMK 단백질에 상보적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스 및 항체로 구성된 군에서 선택되는 어느 하나 이상일 수 있다.
상기 염증성 질환은 염증성 피부질환, 알레르기성 질환, 염증성 장 질환, 복막염, 골수염, 봉소염, 뇌막염, 뇌염, 췌장염, 낭포성 섬유증, 기관지염, 통풍, 척추염, 관절염, 라임병, 혈관염, 패혈증, 패혈성 쇼크, 급성 호흡곤란 증후군, 만성간염, 식도염, 위염, 대장염, 폐렴, 기관지염, 인후염, 신부전, 건선, 빈혈 또는 섬유화증일 수 있다.
본 발명의 구체적인 실시예에서, 본 발명자들은 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐가 야생형 생쥐에 비해 패혈증에 대한 생존율이 높고(도 1 참조), 체온과 체중이 감소한 정도가 적으며(도 2 및 도 3 참조), 내독소혈증 유도시 조직 또는 골수세포로부터 분리된 대식세포내에서 염증 유도 사이토카인인 IL-1β, IL-6 및 TNF-α의 mRNA 및 단백질 발현량의 증가가 억제됨을 확인하였다(도 5 내지 도 12 참조). 또한, IPMK 유전자에 대한 siRNA를 처리한 세포에서 염증 유도 사이토카인인 IL-1β, IL-6 및 TNF-α의 mRNA 및 단백질 발현량의 증가가 억제됨을 확인하였고(도 14 및 도 15), 대식세포 특이적 펩티드와 복합체를 형성한 상기 siRNA가 패혈증이 유도된 생쥐에서 IPMK 유전자의 발현이 억제에 의한 생존률이 증가하였음을 확인하였다(도 16 및 17 참조).
따라서, IPMK의 발현 또는 활성을 억제하는 물질은 염증성 질환의 개선에 유용하게 사용될 수 있다.
본 발명의 IPMK의 발현 또는 활성 억제제는 식품에 그대로 첨가하거나 다른 식품 또는 식품 성분과 함께 사용될 수 있다. 이때, 첨가되는 유효성분의 함량은 목적에 따라 결정될 수 있다. 일반적으로, 건강기능식품 중의 함량은 전체 식품 중량의 0.01 내지 90 중량부일 수 있다.
또한, 상기 건강기능식품의 형태 및 종류에는 특별한 제한은 없다. 상기 물질을 첨가할 수 있는 건강기능식품의 형태는 정제, 캅셀, 분말, 과립, 액상 및 환 등일 수 있다.
본 발명의 건강기능식품은 통상의 건강기능식품과 같이 여러 가지 향미제 또는 천연 탄수화물 등을 추가 성분으로서 함유할 수 있다. 상술한 천연 탄수화물은 포도당, 과당과 같은 모노사카라이드, 말토스, 슈크로스와 같은 디사카라이드, 덱스트린, 사이클로덱스트린과 같은 폴리사카라이드, 자일리톨, 소르비톨, 에리트리톨 등의 당알코올이다. 감미제로서는 타우마틴, 스테비아 추출물과 같은 천연 감미제나, 사카린, 아스파르탐과 같은 합성 감미제 등을 사용할 수 있다.
상기 외에 본 발명의 건강기능식품은 여러 가지 영양제, 비타민, 전해질, 풍미제, 착색제, 펙트산 및 그의 염, 알긴산 및 그의 염, 유기산, 보호성 콜로이드 증점제, pH 조절제, 안정화제, 방부제, 글리세린, 알코올 등을 함유할 수 있다. 이러한 성분은 독립적으로 또는 조합하여 사용 될 수 있다. 이러한 첨가제의 비율은 본 발명의 조성물 100 중량부당 0.01~0.1 중량부의 범위에서 선택될 수 있다.
또한, 본 발명은 1) IPMK 발현 세포주를 준비하는 단계; 2) 상기 단계 1)의 세포주에 피검물질을 처리하는 단계; 3) 상기 피검물질이 처리된 세포주의 IPMK의 발현 또는 활성 정도를 측정하는 단계; 및 4) 상기 IPMK의 발현 또는 활성 정도가 피검물질을 처리하지 않은 대조군에 비해 감소하는 피검물질을 선별하는 단계를 포함하는 염증성 질환 치료 후보물질의 스크리닝 방법을 제공한다.
상기 단계 1)의 세포주에서 발현되는 IPMK 유전자는 통상의 기술분야에 알려진 어떠한 서열로 구성되는 폴리뉴클레오티드를 포함할 수 있다. 본 발명의 일 실시예에서, 상기 IPMK 유전자는 서열번호 13의 염기서열로 구성되는 폴리뉴클레오티드일 수 있다. 상기 폴리뉴클레오티드는 상술한 바와 같은 특징을 가질 수 있다. 또한, 상기 세포주는 IPMK 유전자의 형질전환에 의해 IPMK 단백질 또는 이의 단편이 과발현되는 것일 수 있다.
상기 IPMK의 발현 또는 활성 정도는 면역침강법, 방사선 면역분석법, 효소면역분석법, 면역조직화학, RT-PCR, 웨스턴블랏 또는 유세포 분석법으로 측정할 수 있으나, 당업자에게 알려진 전사체 또는 그로부터 코딩된 단백질의 양을 측정하는 방법이라면 모두 사용할 수 있다.
상기 염증성 질환은 염증성 피부질환, 알레르기성 질환, 염증성 장 질환, 복막염, 골수염, 봉소염, 뇌막염, 뇌염, 췌장염, 낭포성 섬유증, 기관지염, 통풍, 척추염, 관절염, 라임병, 혈관염, 패혈증, 패혈성 쇼크, 급성 호흡곤란 증후군, 만성간염, 식도염, 위염, 대장염, 폐렴, 기관지염, 인후염, 신부전, 건선, 빈혈 또는 섬유화증일 수 있다.
본 발명의 구체적인 실시예에서, 본 발명자들은 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐가 야생형 생쥐에 비해 패혈증에 대한 생존율이 높고(도 1 참조), 체온과 체중이 감소한 정도가 적으며(도 2 및 도 3 참조), 내독소혈증 유도시 조직 또는 골수세포로부터 분리된 대식세포내에서 염증 유도 사이토카인인 IL-1β, IL-6 및 TNF-α의 mRNA 및 단백질 발현량의 증가가 억제됨을 확인하였다(도 5 내지 도 12 참조). 또한, IPMK 유전자에 대한 siRNA를 처리한 세포에서 염증 유도 사이토카인인 IL-1β, IL-6 및 TNF-α의 mRNA 및 단백질 발현량의 증가가 억제됨을 확인하였고(도 14 및 도 15), 대식세포 특이적 펩티드와 복합체를 형성한 상기 siRNA가 패혈증이 유도된 생쥐에서 IPMK 유전자의 발현이 억제에 의한 생존률이 증가하였음을 확인하였다(도 16 및 17 참조).
따라서 상기 방법으로 스크리닝된 IPMK의 발현 또는 활성이 대조군에 비해 감소하는 물질은 염증성 질환의 치료에 유용하게 사용될 수 있다.
이하, 본 발명을 하기 실시예에 의해 상세히 설명한다.
단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 이들에 의해 한정되는 것은 아니다.
< 실시예 1> 패혈증을 유도한 생쥐에서 IPMK 유전자의 유무에 따른 생존율 비교
패혈증을 유도한 생쥐에서 IPMK 유전자의 유무에 따른 생존율을 비교하기 위해 먼저 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐를 제작하였다. 구체적으로, IPMK의 6번째 엑손 시작부분의 51 bp 상위 인트론에 loxP 사이트를, 6번째 엑손 종결코돈의 2476 bp 하위에 다른 loxP 사이트를 삽입하여 생쥐를 제작하고, 이를 Ipmkfl /fl로 정의하였다. 상기 방법으로 제작된 Ipmkfl /fl 생쥐와 골수세포 특이적으로 발현하는 LysM 프로모터의 활성화에 의해서만 Cre-재조합 효소를 발현하는 생쥐를 교배하여 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐를 제작하고, 이를 IpmkΔMac이라고 정의하였다.
야생형 8주령 수컷 C57BL/6J 생쥐(Ipmkfl /fl)를 대조군으로, 상기 방법으로 제작된 골수세포 특이적으로 IPMK 유전자가 제거된 8주령 수컷 C57BL/6J 생쥐(IpmkΔMac)를 실험군으로 준비하였다. 대조군 및 실험군 생쥐를 마취한 후 개복하여 맹장을 꺼내고, 전체 맹장의 70% 정도 위치를 수술용 봉합사로 묶어 매듭지은 후, 21G 주사 바늘로 묶은 맹장 부위를 통과시켰다. 수술용 봉합사로 복강을 봉합하고, 클립으로 피부를 한번 더 봉합하였다. 1 ㎖의 37℃ 생리식염수를 주사하여 소생시키고 수술 후부터 24시간 간격으로 생존율을 관찰하였다. 생존율은 카플란-마이어 생존분석 방법으로 산출되었고, 통계분석은 로그순위법을 이용하였으며, 유의성 최대 한계는 p<0.05로 하였다.
그 결과, 도 1에 나타낸 바와 같이, 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐는 야생형 생쥐에 비해 패혈증에 대한 생존율이 증가하였다(도 1).
< 실시예 2> 내독소혈증이 유도된 생쥐에서 IPMK 유전자 유무에 따른 체온변화 비교
야생형 8주령 수컷 C57BL/6J 생쥐와 골수세포 특이적으로 IPMK 유전자가 제거된 8주령 수컷 C57BL/6J 생쥐에, 생리식염수에 녹인 지질다당류(Lipopolyssacharides O26:B6, Sigma aldrich)를 4.5 ㎎/㎏의 투여량으로 주사하여 내독소혈증을 유도하였다. 내독소혈증이 유도된 마우스에서 6시간 간격으로 48시간 동안 직장온도를 측정하였으며, 체중 및 섭식량은 내독소혈증 유도 48시간 후에 측정하였다.
그 결과, 도 2 내지 도 4에 나타낸 바와 같이, 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐는 야생형 생쥐에 비해 체온과 체중이 감소한 정도가 적고, 섭식량이 증가하였다(도 2 내지 도 4).
< 실시예 3> 내독소혈증이 유도된 생쥐에서 IPMK 유전자 유무에 따른 염증성 사이토카인의 mRNA 발현 변화 비교
<3-1> 내독소혈증 유도 6시간 후 mRNA 발현 변화 비교
먼저, <실시예 2>와 동일한 조건 및 방법으로 생쥐에서 내독소혈증을 유도하였다. 6시간 후, 생쥐를 희생시키고, 희생된 생쥐로부터 비장, 폐 및 대뇌피질 조직을 각각 수득하여 통상적인 방법에 따라 RNA를 추출하고, 추출된 RNA는 260 nm의 자외선 흡수 파장으로 나노드롭(NanoDrop Technologies Inc., USA)을 이용해 정량하였다. 정량한 RNA에 디에틸피로카르본산을 첨가한 물(DEPC water)을 첨가하여, RNA 농도가 300 ng/㎕가 되도록 준비하였다. 10 ㎕의 RNA, oligo-dT 프라이머, 디에틸피로카르본산을 첨가한 물을 혼합하여, 먼저 65℃에서 5분 동안 초기변성하였다. 여기에 4 ㎕의 5x 반응버퍼(reaction buffer), 2 ㎕의 dNTP, 0.5 ㎕의 RNA 분해효소 저해제(RNase inhibitor), 0.5 ㎕의 RTase를 첨가하고, cDNA Synthesis Kit(Enzynomics, KOREA)를 이용하여, 50℃에서 1시간, 75℃에서 5분 동안 반응시켜 역전사 반응을 수행하였다. 합성된 cDNA, SYBRgreen(Toyobo, JAPAN) 및 하기 표 1의 프라이머를 이용하여, 제조사의 방법에 따라 실시간 역전사 반응을 수행해 IL-6 및 TNF-α의 mRNA 발현량을 분석하였다. 모든 실험값은 평균±표준오차(mean±SEM)로 나타내었으며, 통계는 스튜던트의 t검정으로 분석하였고, 유의성의 최대 한계는 p<0.05로 하였다.
PCR에 사용한 프라이머
프라이머 프라이머 서열(5'→3')
IL-6 정방향(서열번호 1) ATGAACAACGATGATGCACTT
IL-6 역방향(서열번호 2) TATCCAGTTTGGTAGCATCCAT
TNF-α 정방향(서열번호 3) CACAAGATGCTGGGACAGTGA
TNF-α 역방향(서열번호 4) GAGGCTCCAGTGAATTCGGA
IL-1β 정방향(서열번호 5) GCCTCGTGCTGTCGGACC
IL-1β 역방향(서열번호 6) TGTCGTTGCTTGGTTCTCCTTG
그 결과, 도 5 내지 도 7에 나타낸 바와 같이, 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐는 야생형 생쥐와 달리 비장, 폐 및 대뇌피질 조직 내에서 IL-6 및 TNF-α의 mRNA 발현량의 증가가 억제되었다(도 5 내지 도 7).
<3-2> 내독소혈증 유도 18시간 후 mRNA 발현 변화 비교
내독소혈증 유도 18시간 후, 희생된 생쥐로부터 얻은 대뇌피질 또는 시상하부 조직을 이용한 것을 제외하고는, 실시예 <3-1>과 동일한 조건 및 방법으로 IL-1β, IL-6 및 TNF-α의 mRNA 발현량을 분석하였다. 사용한 프라이머 서열은 상기 표 1에 나타낸 바와 같다. 모든 실험값은 평균±표준오차(mean±SEM)로 나타내었으며, 통계는 스튜던트의 t검정으로 분석하였고, 유의성의 최대 한계는 p<0.05로 하였다.
그 결과, 도 8에 나타낸 바와 같이, 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐는 야생형 생쥐와 달리 대뇌피질 또는 시상하부 조직 내에서 IL-1β, IL-6 및 TNF-α의 mRNA 발현량의 증가가 억제되었다(도 8).
< 실시예 4> 내독소혈증이 유도된 생쥐에서 IPMK 유전자 유무에 따른 염증성 사이토카인의 단백질 발현 변화 비교
먼저, <실시예 2>와 동일한 조건 및 방법으로 생쥐에서 내독소혈증을 유도하였다. 6시간 후, 안와정맥에서 혈액을 채취하여 상온에서 30분 동안 응고시킨 후, 원심분리를 통해 상층액인 혈청을 수득하였다. 한편, 생쥐는 희생시키고, 희생된 생쥐로부터 대뇌피질 조직을 수득하여 통상적인 방법에 따라 단백질을 추출하였다. IL-6 및 TNF-α의 단백질량은 효소결합면역흡수분석법(ELISA) 키트(BD biosciences, Cat no. 555240 및 558534)를 사용하여 제조사의 방법에 따라 분석하였다. 모든 실험값은 평균±표준오차(mean±SEM)로 나타내었으며, 통계는 스튜던트의 t검정으로 분석하였고, 유의성의 최대 한계는 p<0.05로 하였다.
그 결과, 도 9 및 도 10에 나타낸 바와 같이, 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐는 야생형 생쥐와 달리 혈청 및 대뇌피질 조직 내에서 염증 유도 사이토카인인 IL-6 또는 TNF-α의 단백질 발현량의 증가가 억제되었다(도 9 및 도 10).
< 실시예 5> 내독소혈증이 유도된 생쥐의 골수세포 유래 대식세포에서 IPMK 유전자 유무에 따른 염증성 사이토카인의 발현 변화 비교
야생형 8주령 수컷 C57BL/6J 생쥐와 골수세포 특이적으로 IPMK 유전자가 제거된 8주령 수컷 C57BL/6J 생쥐의 골수로부터 대식세포를 분리하여 6-웰 플레이트에 각 웰 당 1x106개씩 분주하였다. 24시간 후, PBS에 녹인 지질다당류를 100 ng/㎖의 농도로 세포에 처리하여 내독소혈증을 유도하였다. 6시간 후, 세포 배양액을 수득하여 ELISA 키트(BD biosciences, Cat no. 559603 및 558534)를 사용하여 제조사의 방법에 따라 IL-1β 및 TNF-α의 단백질량을 분석하였다.
한편, 상기 과정에서 배양액을 제거하고 남은 세포에 700 ㎕의 Tri-reagent(MRC)를 넣어 세포를 수득하였다. 통상적인 방법에 따라 RNA를 추출하고, 실시예 <3-1>과 같은 방법으로 세포 내 IL-1β, IL-6 및 TNF-α의 mRNA 발현량을 분석하였다. 모든 실험값은 평균±표준오차(mean±SEM)로 나타내었으며, 통계는 스튜던트의 t검정으로 분석하였고, 유의성의 최대 한계는 p<0.05로 하였다.
그 결과, 도 11 및 도 12에 나타낸 바와 같이, 골수세포 특이적으로 IPMK 유전자가 제거된 생쥐는 야생형 생쥐와 달리 골수세포 유래 대식세포 내에서 염증 유도 사이토카인인 IL-1β, IL-6 또는 TNF-α의 mRNA 및 단백질 발현량의 증가가 억제되었다(도 11 및 도 12).
< 실시예 6> 내독소혈증이 유도된 세포에서 IPMK 유전자에 대한 siRNA에 의한 염증성 사이토카인의 발현 변화 비교
<6-1> siRNA에 의한 IPMK 유전자 발현 억제 확인
대조군으로 무작위 RNA(scrambled RNA, ScRNA)를 사용하여, IPMK 유전자에 대한 siRNA에 의해 IPMK 유전자의 발현이 억제되는지 확인하였다. 무작위 RNA는 서열번호 7의 염기서열을 갖는 센스 가닥과 서열번호 8의 염기서열을 갖는 안티센스 가닥으로 이루어져 있으며, 센스 가닥은 3' 말단에 오버행(overhang)으로 dTdT의 염기서열을 더 갖도록 제작되었다. 한편, IPMK 유전자를 타겟으로 하는 siRNA는 서열번호 9의 염기서열을 갖는 센스 가닥과 서열번호 10의 염기서열을 갖는 안티센스 가닥으로 이루어져 있으며, 센스 가닥은 3' 말단에 오버행으로 dCdT의 염기서열을 더 갖도록 제작되었다. 생쥐 유래 대식세포주인 RAW 264.7 세포주를 6-웰 플레이트에 각 웰 당 7.5x105개씩 분주하였다. 16시간 후, 100 pmole의 IPMK 유전자에 대한 siRNA 또는 100 pmole의 무작위 RNA를 125 ㎕의 Opti-MEM(invitrogen, US, Cat No. 31985070)과 섞어주었다. 이후, 상기 siRNA 및 무작위 RNA를 9 ㎕의 lipofectamine LTX(invitrogen, US, Cat No. 15338-100)를 포함하는 125 ㎕의 Opti-MEM에 섞어준 후 반응시켰다. 5분 후, RAW 264.7 세포주가 자라고 있는 6-웰 플레이트에 상기 반응액을 각 웰 당 250 ㎕씩 분주하고 배양하였다. 48시간 후, 세포 배양액을 제거하고 남은 세포에 700 ㎕의 Tri-reagent(MRC)를 넣어 세포를 수득하였다. 통상적인 방법에 따라 RNA를 추출하고, 서열번호 11로 기재되는 IPMK 정방향 프라이머(5'-CAGAGAGGUCCUAGUUAAUUUCA-3') 및 서열번호 12(5'-AGUGAAAUUAACUAGGACCUCUCUGUU-3')로 기재되는 IPMK 역방향 프라이머를 사용한 것을 제외하고는 실시예 <3-1>과 같은 방법으로 IPMK 유전자의 발현 저해 정도를 분석하였다. 모든 실험값은 평균±표준오차(mean±SEM)로 나타내었으며, 통계는 스튜던트의 t검정으로 분석하였고, 유의성의 최대 한계는 p<0.05로 하였다.
그 결과, 도 13에 나타낸 바와 같이, 내독소혈증의 유도 유무에 관계없이 IPMK 유전자에 대한 siRNA를 처리함으로써 IPMK 유전자의 발현이 억제되었다(도 13).
<6-2> IPMK 유전자의 발현이 억제된 세포주에서 염증성 사이토카인의 발현 변화 비교
실시예 <6-1>과 같은 방법으로 IPMK 유전자를 타겟으로 하는 siRNA 또는 무작위 RNA를 RAW 264.7 세포에 처리하고 42시간 후, PBS에 녹인 지질다당류를 100 ng/㎖의 농도로 세포에 처리하여 내독소혈증을 유도하였다. 6시간 후, 세포 배양액을 수득하여 ELISA 키트(BD biosciences, Cat no. 559603, 555240 및 558534)를 사용하여 제조사의 방법에 따라 IL-1β, IL-6 및 TNF-α의 단백질량을 분석하였다.
한편, 상기 과정에서 배양액을 제거하고 남은 세포에 700 ㎕의 Tri-reagent(MRC)를 넣어 세포를 수득하였다. 통상적인 방법에 따라 RNA를 추출하고, 실시예 <3-1>과 같은 방법으로 세포 내 IL-1β, IL-6 및 TNF-α의 mRNA 발현량을 분석하였다. 모든 실험값은 평균±표준오차(mean±SEM)로 나타내었으며, 통계는 스튜던트의 t검정으로 분석하였고, 유의성의 최대 한계는 p<0.05로 하였다.
그 결과, 도 14 및 도 15에 나타낸 바와 같이, IPMK 유전자에 대한 siRNA를 처리한 세포에서 염증 유도 사이토카인인 IL-1β, IL-6 및 TNF-α의 mRNA 및 단백질 발현량의 증가가 억제되었다(도 14 및 도 15).
< 실시예 7> 패혈증이 유도된 생쥐 모델에서 IPMK 유전자에 대한 siRNA 전달을 통한 치료 효과 확인
대식세포 특이적으로 siRNA를 전달할 수 있다고 보고된 RVG-9RC 펩티드(YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRRC; 서열번호 15)는 펩트론사를 통해 합성하였으며, 95% 이상의 순도로 HPLC 정제하였다(Kim et al., Silencing CCR2 in Macrophages Alleviates Adipose Tissue Inflammation and the Associated Metabolic Syndrome in Dietary Obese Mice. Molecular Therapy-Nucleic Acid, 2016년, 5:e280). 동결건조된 RVG-9RC 펩티드는 증류수에 5 mg/ml 농도로 현탁하고, IPMK 유전자에 대한 siRNA는 100 mM 농도로 준비하였다. 각각 100 ml PBS에 펩티드를 16 nmole, siRNA를 400 pmole로 현탁한 뒤 상온에서 5분간 반응시켰다. 그 후 siRNA가 포함된 PBS 현탁액을 펩티드가 담긴 튜브에 한 방울씩 넣어주며 섞었으며, 이렇게 만들어진 복합체는 15분간 상온에서 반응시키고 복강 내로 전달하였다.
<7-1> 복강 내 대식세포 특이적 siRNA 전달 효능 확인
8 주령 수컷 C57BL/6J 생쥐에 타이오글라이콜산염액체배지를 1 ml 주입 후 3일 뒤 상기 방법을 통해 대식세포 특이적으로 scRNA 또는 IPMK 유전자에 대한 siRNA를 전달하였다. 24시간 뒤 PBS 10 ml을 복강 내에 주입한 후 마사지하여 복강 내의 세포를 모은 후, 다시 주사기를 사용하여 복강 내 PBS를 회수하고 1200 rpm에서 5 분간 원심분리하였다. 가라앉은 복강 내 세포에 ACK lysis 버퍼(150 mM NH4Cl, 10 mM KHCO3, 0.1 mM sodium EDTA, 제조사 Sigma aldrich) 2 ml을 넣고 2분간 상온에서 반응시킨 후 13 ml의 DMEM 배지를 넣어 반응을 멈추고 1200 rpm에서 5분간 원심분리하였다. 분리된 세포를 DMEM, 10% FBS, Penicillin/streptomycin(100 μg/ml)로 1 x 106 cells/ml로 현탁시켜 6 well plate에 2 ml 씩 분주하여 배양하였다. 24시간 후 세포 배양액을 제거하고 세포에 Tri-reagent (제조사 MRC)를 700 ul 넣어 세포를 수거한 후 RNA를 추출하여 IPMK 유전자의 발현 저해 정도를 분석하였다. 본 발명의 통계처리는 모든 실험값은 평균±표준오차(mean ± SEM)로 표시했으며, 통계분석은 Student's t-test로 처리했으며, 유의성 최대 한계는 p<0.05로 정하였다.
그 결과, 도 16에 나타낸 바와 같이 대식세포 특이적으로 전달된 siRNA로 인해 IPMK mRNA의 발현이 저해된 것을 확인하였다.
<7-2> 패혈증 유도 생쥐 모델에서 복강 내 대식세포 특이적 siRNA 전달 효능 확인
수컷 C57BL/6J 생쥐를 마취 후 개복하여 맹장을 꺼내고 전체 맹장의 70% 정도 위치를 수술용 봉합사로 묶어 매듭지은 후 21G 주사바늘로 묶은 맹장 부위를 통과시켰다. 수술용 봉합사로 복강을 봉합하고, 클립으로 피부를 한번 더 봉합하였다. 37℃ 생리식염수를 1 ml 주사하여 소생시키고 수술 후로부터 2 시간 후 상기 방법을 통해 대식세포 특이적으로 scRNA 또는 IPMK를 타겟하는 siRNA를 전달하였다. 그 후 24시간 간격으로 두 번에 걸쳐 siRNA를 추가로 전달하며, 생존율을 관찰하였다. 본 발명은 kaplan-Meier 생존분석으로 생존율을 산출하였으며 통계분석은 log-rank test로 처리하였다. 유의성 최대 한계는 p<0.05로 정하였다.
그 결과, 도 17에 나타낸 바와 같이 대식세포 특이적으로 전달된 siRNA로 인해 IPMK가 제거된 생쥐에서 scRNA가 전달된 생쥐에 비해 생존율이 증가된 것을 확인하였다.

Claims (10)

  1. IPMK(inositol polyphosphate multikinase)의 발현 또는 활성 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물.
  2. 제 1항에 있어서, 상기 IPMK의 발현 억제제가 IPMK 유전자의 mRNA에 상보적으로 결합하는 안티센스 뉴클레오티드, 작은 간섭 RNA(small interfering RNA) 및 짧은 헤어핀 RNA(short hairpin RNA)로 구성된 군에서 선택되는 어느 하나 이상인, 염증성 질환의 예방 또는 치료용 약학적 조성물.
  3. 제 2항에 있어서, 상기 IPMK의 발현 억제제가 IPMK 유전자의 mRNA에 상보적으로 결합하는 작은 간섭 RNA인, 염증성 질환의 예방 또는 치료용 약학적 조성물.
  4. 제 3항에 있어서, 상기 작은 간섭 RNA가 서열번호 9의 염기서열로 구성되는 센스 가닥 및 서열번호 10의 염기서열로 구성되는 안티센스 가닥으로 구성되는, 염증성 질환의 예방 또는 치료용 약학적 조성물.
  5. 제 2항 또는 제 3항에 있어서, 상기 IPMK 유전자가 서열번호 13의 염기서열로 구성되는 폴리뉴클레오티드인, 염증성 질환의 예방 또는 치료용 약학적 조성물.
  6. 제 1항에 있어서, 상기 IPMK의 활성 억제제가 IPMK 단백질에 상보적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스 및 항체로 구성된 군에서 선택되는 어느 하나 이상인, 염증성 질환의 예방 또는 치료용 약학적 조성물.
  7. 제 6항에 있어서, 상기 IPMK 단백질이 서열번호 14의 아미노산 서열로 구성되는 폴리펩티드인, 염증성 질환의 예방 또는 치료용 약학적 조성물.
  8. 제 1항에 있어서, 상기 염증성 질환이 염증성 피부질환, 알레르기성 질환, 염증성 장 질환, 복막염, 골수염, 봉소염, 뇌막염, 뇌염, 췌장염, 낭포성 섬유증, 기관지염, 통풍, 척추염, 관절염, 라임병, 혈관염, 패혈증, 패혈성 쇼크, 급성 호흡곤란 증후군, 만성간염, 식도염, 위염, 대장염, 폐렴, 기관지염, 인후염, 신부전, 건선, 빈혈 또는 섬유화증인, 염증성 질환의 예방 또는 치료용 약학적 조성물.
  9. IPMK의 발현 또는 활성 억제제를 유효성분으로 함유하는 염증성 질환의 개선용 건강기능식품.
  10. 1) IPMK 발현 세포주를 준비하는 단계;
    2) 상기 단계 1)의 세포주에 피검물질을 처리하는 단계;
    3) 상기 피검물질이 처리된 세포주의 IPMK의 발현 또는 활성 정도를 측정하는 단계; 및
    4) 상기 IPMK의 발현 또는 활성 정도가 피검물질을 처리하지 않은 대조군에 비해 감소하는 피검물질을 선별하는 단계를 포함하는 염증성 질환의 치료를 위한 후보물질의 스크리닝 방법.
PCT/KR2018/000203 2017-01-04 2018-01-04 이노시톨 다인산 멀티키나아제 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물 WO2018128429A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2017-0001164 2017-01-04
KR1020170001164A KR101793474B1 (ko) 2017-01-04 2017-01-04 이노시톨 다인산 멀티키나아제 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물

Publications (1)

Publication Number Publication Date
WO2018128429A1 true WO2018128429A1 (ko) 2018-07-12

Family

ID=60384637

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2018/000203 WO2018128429A1 (ko) 2017-01-04 2018-01-04 이노시톨 다인산 멀티키나아제 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물

Country Status (2)

Country Link
KR (1) KR101793474B1 (ko)
WO (1) WO2018128429A1 (ko)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20210146498A (ko) * 2020-05-26 2021-12-06 한국과학기술원 이노시톨 다인산 멀티키나아제 억제제를 유효성분으로 포함하는 암의 예방 또는 치료용 약제학적 조성물

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR0179347B1 (ko) * 1995-09-15 1999-04-01 구본철 수문 개폐 장치
WO2014201021A2 (en) * 2013-06-10 2014-12-18 Dana-Farber Cancer Institute, Inc. Methods and compositions for reducing immunosupression by tumor cells

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR0179347B1 (ko) * 1995-09-15 1999-04-01 구본철 수문 개폐 장치
WO2014201021A2 (en) * 2013-06-10 2014-12-18 Dana-Farber Cancer Institute, Inc. Methods and compositions for reducing immunosupression by tumor cells

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
DAILEY, M. J. ET AL.: "Inositol Polyphosphate Multikinase: An Emerging Player for the Central Action of AMP-activated Protein Kinase", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 421, 7 April 2012 (2012-04-07), pages 1 - 3, XP028421334 *
KIM, E. ET AL.: "Inositol Polyphosphate Multikinase Is a Coactivator for Serum Response Factor-dependent Induction of Immediate Early Genes", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 110, no. 49, 3 December 2013 (2013-12-03), pages 19938 - 19943, XP055512928 *
LEE, J. Y. ET AL.: "Inositol Polyphosphate Multikinase Signaling in the Regulation of Metabolism", ANNALS OF THE NEW YORK ACADEMY OF SCIENCES, vol. 1271, no. 1, 2012, pages 68 - 74, XP055512919 *
MAAG, D. ET AL.: "Inositol Polyphosphate Multikinase Is a Physiologic PI3-kinase that Activates Akt/PKB", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 108, no. 4, 25 January 2011 (2011-01-25), pages 1391 - 1396, XP055512923 *

Also Published As

Publication number Publication date
KR101793474B1 (ko) 2017-11-07

Similar Documents

Publication Publication Date Title
US20120171201A1 (en) Methods of treating her2 positive cancer with her2 receptor antagonist in combination with multi-arm polymeric conjugates of 7-ethyl-10-hydroxycamptothecin
EP2185174B1 (en) Use of trim72 as a target for muscle and heart enhancer
KR20100099249A (ko) 세포막 재봉합을 조절하기 위한 조성물 및 방법
WO2014182051A1 (ko) Ａｓｍ 억제제를 유효성분으로 포함하는 퇴행성 신경질환의 예방 또는 치료용 조성물
JP2020073562A (ja) 抗ｎｍｅ抗体
WO2013036610A2 (en) Compositions comprising mg53 and methods for the treatment and prevention of airway injury
WO2018128429A1 (ko) 이노시톨 다인산 멀티키나아제 억제제를 유효성분으로 함유하는 염증성 질환의 예방 또는 치료용 약학적 조성물
US20150110778A1 (en) Compositions comprising mg53 and methods for the treatment and prevention of airway injury
EP3347376B1 (en) Novel igfr-like receptor and uses thereof
KR102076777B1 (ko) Gas6 단백질 또는 이의 수용체 활성화제를 포함하는 섬유증의 예방 또는 치료용 조성물
EP4088735A1 (en) Application of cst1 in prevention and/or treatment of liver immune dysregulation diseases
WO2020149727A2 (ko) 12-lox 발현 촉진제를 포함하는 간 질환 예방 또는 치료용 조성물
Huang et al. Partitioning of aquaporin-4 water channel mRNA and protein in gastric glands
AU2009270826B2 (en) Compositions comprising MG29 nucleic acids, polypeptides and associated methods of use
WO2024096354A1 (ko) Ifitm3 억제제를 포함하는 신장암 예방 또는 치료용 약학적 조성물
KR101951550B1 (ko) 라이실-tRNA 합성효소 억제제를 유효성분으로 함유하는 골대사성 질환 예방 또는 치료용 약학적 조성물
US8236758B2 (en) Method of treatment of diabestes or reduction in pancreatic beta-cells
WO2020241816A1 (ja) 新規な消化器がん治療剤およびそのスクリーニング方法
KR20190122163A (ko) Taz의 pdx1 활성 조절을 통한 혈당 조절 용도
WO2022055093A1 (ko) 종양미세환경 회피능을 갖는 면역세포치료제 조성물
WO2019057120A1 (zh) LGR4和R-spondin结合抑制剂及其在肿瘤治疗中的用途
WO2023140524A1 (ko) 항섬유화 억제용 조성물
US20170326208A1 (en) Treatment of diseases asssociated with fat accumulation
WO2022124626A1 (ko) 자가유지능이 향상된 중간엽줄기세포를 선별하는 방법 및 그에 의해 선별된 중간엽줄기세포
WO2024090800A1 (ko) 리포칼린 2 억제제를 포함하는 간섬유화 예방 또는 치료용 약학적 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18736446

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 18736446

Country of ref document: EP

Kind code of ref document: A1