WO2018053405A1 - Methods of treating immune disorders using pd-1 binding proteins - Google Patents

Methods of treating immune disorders using pd-1 binding proteins Download PDF

Info

Publication number
WO2018053405A1
WO2018053405A1 PCT/US2017/052021 US2017052021W WO2018053405A1 WO 2018053405 A1 WO2018053405 A1 WO 2018053405A1 US 2017052021 W US2017052021 W US 2017052021W WO 2018053405 A1 WO2018053405 A1 WO 2018053405A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
amino acid
acid sequence
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/052021
Other languages
English (en)
French (fr)
Inventor
Henry H. Chan
Eun Mi Hur
Roli Khattri
Monica Leung
Garth E. RINGHEIM
Peter H. Schafer
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Celgene Corp
Original Assignee
Celgene Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EA201990747A priority Critical patent/EA201990747A1/ru
Priority to SG11201901950TA priority patent/SG11201901950TA/en
Priority to BR112019004733A priority patent/BR112019004733A2/pt
Priority to KR1020197007885A priority patent/KR102257154B1/ko
Priority to JP2019513745A priority patent/JP2019531284A/ja
Priority to AU2017329024A priority patent/AU2017329024A1/en
Priority to MX2019002867A priority patent/MX2019002867A/es
Priority to CN201780068836.7A priority patent/CN109952317A/zh
Application filed by Celgene Corp filed Critical Celgene Corp
Priority to EP17851703.3A priority patent/EP3515944A4/en
Priority to CA3036701A priority patent/CA3036701A1/en
Publication of WO2018053405A1 publication Critical patent/WO2018053405A1/en
Priority to IL265197A priority patent/IL265197A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • PD-1 Programmed Death-1
  • the present disclosure provides methods of managing, preventing, or treating an immune disorder in a subject comprising administering to a subject a therapeutically effective amount of proteins that bind to PD-1 (e.g., human PD-1, SEQ ID NO:43), including binding proteins such as antibodies that bind to PD-1.
  • PD-1 e.g., human PD-1, SEQ ID NO:43
  • binding proteins such as antibodies that bind to PD-1.
  • binding proteins can bind to a PD-1 polypeptide, a PD-1 fragment, and/or a PD-1 epitope.
  • binding proteins, including antibodies can be agonists (e.g., induce PD-1 ligand-like signaling).
  • the binding proteins do not compete with PD-1 ligand (e.g., PD-L1 and PD-L2) for the interaction with PD-1 (e.g., a non-blocking antibody).
  • the present disclosure also provides, in certain embodiments, methods of managing, preventing, or treating an immune disorder in a subject comprising administering to a subject a therapeutically effective amount of binding proteins, including antibodies or fragments thereof, that (i) bind to human PD-1, (ii) induce PD-1 ligand-like signaling, and (iii) do not compete with PD-L1 and/or PD-L2 for the interaction with PD-1.
  • a binding protein for use in the methods provided herein comprises six complementarity determining regions (CDRs) or fewer than six CDRs.
  • a binding protein e.g., an anti-PD-1 antibody
  • a binding protein (e.g., an anti-PD-1 antibody) comprises one, two, three, four, five, or six CDRs selected from VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 of a monoclonal antibody designated as PDlAB-1, PD1AB-2, PD1AB-3, PDl AB-4, PDl AB-5, or PDl AB-6 as described herein, or a humanized variant thereof.
  • a monoclonal antibody designated as PDlAB-1, PD1AB-2, PD1AB-3, PDl AB-4, PDl AB-5, or PDl AB-6 as described herein, or a humanized variant thereof.
  • a binding protein (e.g., an anti-PD-1 antibody) further comprises a scaffold region or framework region (FR), including a VH FRl, VH FR2, VH FR3, VH FR4, VL FRl, VL FR2, VL FR3, and/or VL FR4 of a human immunoglobulin amino acid sequence or a variant thereof.
  • FR scaffold region or framework region
  • the antibody or antigen-binding fragment thereof binds to an epitope of human PD-1 recognized by an antibody comprising a light chain variable region having an amino acid sequence of SEQ ID NO: 8 and a heavy chain variable region having an amino acid sequence of SEQ ID NO: 13.
  • the antibody or antibody fragment thereof competes for the binding to human PD-1 with an antibody comprising a light chain variable region having an amino acid sequence of SEQ ID NO: 8 and a heavy chain variable region having an amino acid sequence of SEQ ID NO: 13.
  • the antibody or antigen-binding fragment thereof comprises a VL comprising VL CDR1, VL CDR2, and VL CDR3 of any one of antibodies PDlAB-1, PD lAB-2, PD1AB-3, PDl AB-4, PDl AB-5, or PDl AB-6 as set forth in Table 1
  • the antibody or antigen-binding fragment thereof comprises a VH comprising VH CDR1, VH CDR2, and VH CDR3 of any one of antibodies PDlAB-1, PD lAB-2, PD1AB-3, PDl AB-4, PDl AB-5, or PDl AB-6 as set forth in Table 2
  • the antibody or antigen-binding fragment thereof comprises:
  • VL comprising VL FRl, VL FR2, VL FR3, and VL FR4 of any one of antibodies
  • VH comprising VH FRl, VH FR2, VH FR3, and VH FR4 of any one of antibodies PDl AB-1, PDl AB-2, PDl AB-3, PDl AB-4, PDl AB-5, or PDl AB-6 as set forth in Table 4
  • the VL CDR1, VL CDR2, and VL CDR3 of the antibody or antigen-binding fragment thereof comprise amino acid sequences of SEQ ID NOS: l, 2, and 3, respectively, and the VH CDR1, VH CDR2, and VH CDR3 of the antibody or antigen-binding fragment thereof comprise amino acid sequences of SEQ ID NOS:4, 5, and 6, respectively.
  • the VL CDR1, VL CDR2, and VL CDR3 of the antibody or antigen-binding fragment thereof comprise amino acid sequences of SEQ ID NOS:7, 2, and 3, respectively
  • the VH CDR1, VH CDR2, and VH CDR3 of the antibody or antigen-binding fragment thereof comprise amino acid sequences of SEQ ID NOS:4, 5, and 6, respectively.
  • the antibody or antigen-binding fragment thereof comprises a VL comprising an amino acid sequence of SEQ ID NO:8.
  • the amino acid sequence comprises one or more conservative modifications thereof.
  • the antibody or antigen-binding fragment thereof comprises a VL comprising an amino acid sequence of SEQ ID NO:9.
  • the amino acid sequence comprises one or more conservative modifications thereof.
  • the antibody or antigen-binding fragment thereof comprises a VL comprising an amino acid sequence of SEQ ID NO: 10.
  • the amino acid sequence comprises one or more conservative modifications thereof.
  • the antibody or antigen-binding fragment thereof comprises a VH comprising an amino acid sequence of SEQ ID NO: 11.
  • the amino acid sequence comprises one or more conservative modifications thereof.
  • the antibody or antigen-binding fragment thereof comprises a VH comprising an amino acid sequence of SEQ ID NO: 12.
  • the amino acid sequence comprises one or more conservative modifications thereof.
  • the antibody or antigen-binding fragment thereof comprises a VH comprising an amino acid sequence of SEQ ID NO: 13.
  • the amino acid sequence comprises one or more conservative modifications thereof.
  • the antibody or antigen-binding fragment thereof comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:8; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 11.
  • the antibody or antigen-binding fragment thereof comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:9; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 11.
  • the antibody or antigen-binding fragment thereof comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO: 10; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 11.
  • the antibody or antigen-binding fragment thereof comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:8; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 12.
  • the antibody or antigen-binding fragment thereof comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:9; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 12.
  • the antibody or antigen-binding fragment thereof comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO: 10; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 12.
  • the antibody or antigen-binding fragment thereof comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:8; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 13.
  • the antibody or antigen-binding fragment thereof comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:9; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 13.
  • the antibody or antigen-binding fragment thereof comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO: 10; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 13.
  • the amino acid sequence of the VL comprises one or more conservative modifications thereof. In some embodiments, the amino acid sequence of the VH comprises one or more conservative modifications thereof. In some embodiments, the amino acid sequence of the VL and the VH comprises one or more conservative modifications thereof.
  • the antibody comprises a human IgGl Fc region. In other embodiments, the antibody comprises a variant human IgGl Fc region.
  • the antibody comprises a human IgGl-K322A Fc region.
  • the antibody comprises a human IgG4 Fc region. In other embodiments, the antibody comprises a variant human IgG4 Fc region.
  • the antibody comprises a human IgG4P Fc region.
  • the antibody comprises a human IgG4PE Fc region.
  • the antibody or antigen-binding fragment thereof further comprises a light chain constant region comprising an amino acid sequence of SEQ ID NO:41.
  • the antibody or antigen-binding fragment thereof further comprises a heavy chain Fc region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS:36-40.
  • the antibody or antigen-binding fragment thereof further comprises a light chain constant region comprising an amino acid sequence of SEQ ID NO:41; and a heavy chain Fc region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS:36-40.
  • the antibody or antigen-binding fragment thereof comprises a light chain comprising an amino acid sequence of SEQ ID NO:31.
  • the antibody or antigen-binding fragment thereof comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:32.
  • the antibody or antigen-binding fragment thereof comprises: (a) a light chain comprising an amino acid sequence of SEQ ID NO:31; and (b) a heavy chain comprising an amino acid sequence of SEQ ID NO:32.
  • the antibody or antigen-binding fragment thereof comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:33.
  • the antibody or antigen-binding fragment thereof comprises: (a) a light chain comprising an amino acid sequence of SEQ ID NO:31; and (b) a heavy chain comprising an amino acid sequence of SEQ ID NO:33.
  • the antibody or antigen-binding fragment thereof comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:34.
  • the antibody or antigen-binding fragment thereof comprises: (a) a light chain comprising an amino acid sequence of SEQ ID NO:31;
  • the antibody or antigen-binding fragment thereof comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:35.
  • the antibody or antigen-binding fragment thereof comprises: (a) a light chain comprising an amino acid sequence of SEQ ID NO:31;
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to at least one of residues 100-109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to at least one of residues 100-105 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to at least one residue selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to two or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to three or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to four or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to five or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to six or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to seven or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to eight or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to nine or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to all ten residues from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof, when bound to PD-1 binds to N33 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof, when bound to PD-1 binds to T51 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to S57 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to L100 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to N102 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to G103 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to R104 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to G103 and R104 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to D105 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to H107 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to S109 within an amino acid sequence of SEQ ID NO:42.
  • the epitope of human PD-1 is distinct from the PD-Ll binding site. In another embodiment, the epitope of human PD-1 is distinct from the PD- L2 binding site. In a specific embodiment, the epitope of human PD-1 is distinct from both the PD-Ll binding site and the PD-L2 binding site.
  • the antibody or antigen-binding fragment thereof specifically binds to human PD-1 and/or monkey PD-1 (for example, cynomolgus monkey), but not rodent PD-1.
  • the antibody or antigen-binding fragment thereof has attenuated antibody dependent cellular cytotoxicity (ADCC) activity. In other embodiments, the antibody or antigen-binding fragment thereof has attenuated complement dependent cytotoxicity (CDC) activity. In some embodiments, the antibody or antigen-binding fragment thereof has attenuated ADCC and/or attenuated CDC activity.
  • ADCC antibody dependent cellular cytotoxicity
  • CDC complement dependent cytotoxicity
  • a method of managing, preventing, or treating an immune disorder in a subject comprising administering to a subject a therapeutically effective amount of an antibody or antigen-binding fragment thereof that binds to an epitope of human PD-1, wherein the antibody or antigen-binding fragment thereof: (a) attenuates T cell activity; and/or (b) downregulates PD-1 expression on the surface of T cells.
  • the antibody attenuates T cell activity. In another embodiment, the antibody downregulates PD-1 expression on the surface of T cells.
  • the attenuation of T cell activity is measured by a T cell effector function.
  • the attenuation of T cell activity is measured by inhibition of cytokine production.
  • the cytokine that is inhibited by the antibody or antigen-binding fragment thereof comprises IL-2, IL-17, and/or IFN- ⁇ .
  • the cytokine is selected from the group consisting of IL-1, IL-2, IL-6, IL-12, IL-17, IL-22, IL-23, GM-CSF, IFN- ⁇ , and TNF-a.
  • the cytokine is IL-1.
  • the cytokine is IL-2. In other embodiments, the cytokine is IL-6. In another embodiment, the cytokine is IL-12. In some other embodiments, the cytokine is IL-17. In yet other embodiments, the cytokine is IL-22. In still other embodiments, the cytokine is IL-23. In some embodiments, the cytokine is GM-CSF. In other embodiments, the cytokine is IFN- ⁇ . In yet other embodiments, the cytokine is TNF-a. In certain embodiments, the cytokine is IL-2 and IL-17. In some embodiments, the cytokine is IL-2 and IFN- ⁇ .
  • the cytokine is IL-17 and IFN- ⁇ . In still other embodiments, the cytokine is IL-2, IL-17, and IFN- ⁇ . Other combinations of two, three or more of the above-mentioned cytokines are also
  • the attenuation of T cell activity is measured by inhibition of T cell proliferation.
  • the attenuation of T cell activity is measured by upregulation of expression of an inhibitory receptor on the surface of T cells, wherein the inhibitory receptor is not PD-1.
  • the inhibitory receptor is selected from the group consisting of LAG-3, CTLA-4, and TIM-3.
  • the inhibitory receptor is LAG-3.
  • the inhibitory receptor is CTLA-4.
  • the inhibitory receptor is TIM-3.
  • the attenuation of T cell activity is measured by inhibition of T cell recall response.
  • the attenuation of T cell activity is measured by increase of T cell exhaustion.
  • the attenuation of T cell activity is measured by downregulation of T cell activation markers.
  • the attenuation of T cell activity is measured by upregulation of regulatory T cell biomarkers.
  • the attenuation of T cell activity is measured by increase of regulatory T cell numbers.
  • the downregulation of PD-1 expression on the surface of T cells occurs as early as 4 hours after the contact with the antibody or antigen- binding fragment thereof. In another embodiment, the downregulation occurs as early as 6 hours after the contact. In yet another embodiment, the downregulation occurs as early as 8 hours after the contact. In still another embodiment, the downregulation occurs as early as 10 hours after the contact. In one embodiment, the downregulation occurs as early as 12 hours after the contact. In another embodiment, the downregulation occurs as early as 14 hours after the contact. In yet another embodiment, the downregulation occurs as early as 16 hours after the contact. In still another embodiment, the downregulation occurs as early as 18 hours after the contact. In one embodiment, the downregulation occurs as early as 20 hours after the contact.
  • the downregulation occurs as early as 22 hours after the contact. In yet another embodiment, the downregulation occurs as early as 24 hours after the contact.
  • the contact is with the antibody. In other embodiments, the contact is with an antigen-binding fragment thereof.
  • the downregulation of PD-1 expression on the surface of T cells precedes cytokine inhibition.
  • the downregulation of PD-1 expression on the surface of T cells occurs as early as 4 hours after the contact with the antibody or antigen- binding fragment thereof, and precedes cytokine inhibition.
  • the downregulation occurs as early as 6 hours after the contact with the antibody or antigen-binding fragment thereof, and precedes cytokine inhibition.
  • downregulation occurs as early as 8 hours after the contact with the antibody or antigen-binding fragment thereof, and precedes cytokine inhibition.
  • the antibody or antigen-binding fragment thereof precedes cytokine inhibition.
  • downregulation occurs as early as 10 hours after the contact with the antibody or antigen-binding fragment thereof, and precedes cytokine inhibition. In one embodiment, the downregulation occurs as early as 12 hours after the contact with the antibody or antigen-binding fragment thereof, and precedes cytokine inhibition. In another embodiment, the downregulation occurs as early as 14 hours after the contact with the antibody or antigen-binding fragment thereof, and precedes cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 16 hours after the contact with the antibody or antigen -binding fragment thereof, and precedes cytokine inhibition. In still another embodiment, the downregulation occurs as early as 18 hours after the contact with the antibody or antigen-binding fragment thereof, and precedes cytokine inhibition.
  • the downregulation occurs as early as 20 hours after the contact with the antibody or antigen-binding fragment thereof, and precedes cytokine inhibition. In another embodiment, the downregulation occurs as early as 22 hours after the contact with the antibody or antigen-binding fragment thereof, and precedes cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 24 hours after the contact with the antibody or antigen-binding fragment thereof, and precedes cytokine inhibition.
  • the downregulation of PD-1 expression on the surface of T cells is concurrent with cytokine inhibition.
  • the downregulation of PD-1 expression on the surface of T cells occurs as early as 4 hours after the contact with the antibody or antigen-binding fragment thereof, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 6 hours after the contact with the antibody or antigen-binding fragment thereof, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 8 hours after the contact with the antibody or antigen-binding fragment thereof, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 10 hours after the contact with the antibody or antigen-binding fragment thereof, and is concurrent with cytokine inhibition. In one embodiment, the downregulation occurs as early as 12 hours after the contact with the antibody or antigen-binding fragment thereof, and is concurrent with cytokine inhibition. In another embodiment, the downregulation occurs as early as 14 hours after the contact with the antibody or antigen-binding fragment thereof, and is concurrent with cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 16 hours after the contact with the antibody or antigen-binding fragment thereof, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 18 hours after the contact with the antibody or antigen-binding fragment thereof, and is concurrent with cytokine inhibition. In one embodiment, the downregulation occurs as early as 20 hours after the contact with the antibody or antigen-binding fragment thereof, and is concurrent with cytokine inhibition. In another embodiment, the downregulation occurs as early as 22 hours after the contact with the antibody or antigen-binding fragment thereof, and is concurrent with cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 24 hours after the contact with the antibody or antigen-binding fragment thereof, and is concurrent with cytokine inhibition.
  • the downregulation of PD-1 expression on the surface of T cells is after cytokine inhibition.
  • the downregulation of PD-1 expression on the surface of T cells occurs as early as 4 hours after the contact with the antibody or antigen- binding fragment thereof, and is after cytokine inhibition.
  • the downregulation occurs as early as 6 hours after the contact with the antibody or antigen-binding fragment thereof, and is after cytokine inhibition.
  • downregulation occurs as early as 8 hours after the contact with the antibody or antigen-binding fragment thereof, and is after cytokine inhibition.
  • the antibody or antigen-binding fragment thereof is after cytokine inhibition.
  • downregulation occurs as early as 10 hours after the contact with the antibody or antigen-binding fragment thereof, and is after cytokine inhibition. In one embodiment, the downregulation occurs as early as 12 hours after the contact with the antibody or antigen-binding fragment thereof, and is after cytokine inhibition. In another embodiment, the downregulation occurs as early as 14 hours after the contact with the antibody or antigen-binding fragment thereof, and is after cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 16 hours after the contact with the antibody or antigen-binding fragment thereof, and is after cytokine inhibition. In still another embodiment, the downregulation occurs as early as 18 hours after the contact with the antibody or antigen-binding fragment thereof, and is after cytokine inhibition.
  • the downregulation occurs as early as 20 hours after the contact with the antibody or antigen-binding fragment thereof, and is after cytokine inhibition. In another embodiment, the downregulation occurs as early as 22 hours after the contact with the antibody or antigen-binding fragment thereof, and is after cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 24 hours after the contact with the antibody or antigen-binding fragment thereof, and is after cytokine inhibition.
  • the K D of the antibody or antigen-binding fragment thereof for binding to purified human PD-1 is from about 1 nM to about 100 nM. In another embodiment of the methods, the K D of the antibody or antigen-binding fragment thereof for binding to human PD-1 expressed on cell surface and monkey PD-1 expressed on cell surface is from about 100 pM to about 10 nM.
  • the EC 50 of the antibody or antigen-binding fragment thereof for attenuating T cell activity is from about 1 pM to about 10 pM, from about 10 pM to about 100 pM, from about 100 pM to about 1 nM, from about 1 nM to about 10 nM, or from about 10 nM to about 100 nM.
  • the maximal percent attenuation of T cell activity by the antibody or antigen-binding fragment thereof is at least about 10%, 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%.
  • the maximal percent downregulation of PD-1 expression by the antibody or antigen-binding fragment thereof is at least about 10%, 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%.
  • the antibody is a monoclonal antibody. In some embodiments, the antibody is a humanized, human, or chimeric antibody. In another embodiment, the humanized antibody is a deimmunized antibody or a composite human antibody. In certain embodiments, the antibody is a humanized antibody. In specific
  • the antibody is a humanized antibody that specifically binds human PD-1.
  • the antibody or antigen-binding fragment thereof is a Fab, a Fab', a F(ab') 2 , a Fv, a scFv, a dsFv, a diabody, a triabody, or a tetrabody.
  • the antibody or antigen-binding fragment thereof is a multispecific antibody formed from antibody fragments. In other embodiments, the antibody or antigen-binding fragment thereof is a bispecific antibody.
  • the antibody or antigen-binding fragment thereof is conjugated to an agent.
  • the agent is a radioisotope, a metal chelator, an enzyme, a fluorescent compound, a bioluminescent compound, or a
  • the antibody or antigen-binding fragment thereof attenuates T cell activity.
  • the maximal percent attenuation of T cell activity is at least about 10%, 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%), 90%), 95%), or 100%.
  • the attenuation of T cell activity is measured by inhibition of T cell proliferation.
  • the attenuation of T cell activity is measured by inhibition of cytokine production.
  • the cytokine is selected from the group consisting of IL-2, IL-17, IFN- ⁇ , or any combination thereof.
  • the cytokine is selected from the group consisting of IL-1, IL-2, IL-6, IL-12, IL- 17, IL-22, IL-23, GM-CSF, IFN- ⁇ , and TNF-a.
  • the cytokine is IL-1.
  • the cytokine is IL-2.
  • the cytokine is IL-6.
  • the cytokine is IL-12.
  • the cytokine is IL-17.
  • the cytokine is IL-22.
  • the cytokine is IL-23.
  • the cytokine is GM-CSF.
  • the cytokine is IFN- ⁇ . In yet other embodiments, the cytokine is TNF-a. In certain embodiments, the cytokine is IL-2 and IL-17. In some embodiments, the cytokine is IL-2 and IFN- ⁇ . In yet other embodiments, the cytokine is IL-17 and IFN- ⁇ . In still other embodiments, the cytokine is IL-2, IL-17, and IFN- ⁇ . Other combinations of two, three or more of the above-mentioned cytokines are also
  • the inhibition of cytokine production follows
  • the downregulation of PD-1 expression on the surface of the T cell occurs as early as 4 hours, 6 hours, 8 hours, 10 hours, 12 hours, 14 hours, 16 hours, 18 hours, 20 hours, 22 hours, or 24 hours after the contact with the antibody or antigen-binding fragment thereof.
  • the downregulation occurs as early as 4 hours after the contact, and precedes cytokine inhibition.
  • the downregulation occurs as early as 6 hours after the contact, and precedes cytokine inhibition.
  • the downregulation occurs as early as 8 hours after the contact, and precedes cytokine inhibition.
  • the downregulation occurs as early as 10 hours after the contact, and precedes cytokine inhibition.
  • the downregulation occurs as early as 12 hours after the contact, and precedes cytokine inhibition. In an embodiment, the downregulation occurs as early as 14 hours after the contact, and precedes cytokine inhibition. In other embodiments, the downregulation occurs as early as 16 hours after the contact, and precedes cytokine inhibition. In one embodiment, the downregulation occurs as early as 18 hours after the contact, and precedes cytokine inhibition. In another embodiment, the downregulation occurs as early as 20 hours after the contact, and precedes cytokine inhibition. In one embodiment, the downregulation occurs as early as 22 hours after the contact, and precedes cytokine inhibition. In some embodiments, the downregulation occurs as early as 24 hours after the contact, and precedes cytokine inhibition.
  • the inhibition of cytokine production is concurrent with downregulation of PD-1 expression on the surface of the T cell.
  • the downregulation occurs as early as 4 hours after the contact, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 6 hours after the contact, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 8 hours after the contact, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 10 hours after the contact, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 12 hours after the contact, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 14 hours after the contact, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 16 hours after the contact, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 4 hours after the contact, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 6 hours after the contact, and is concurrent with cytokine inhibition.
  • downregulation occurs as early as 18 hours after the contact, and is concurrent with cytokine inhibition. In another embodiment, the downregulation occurs as early as 20 hours after the contact, and is concurrent with cytokine inhibition. In one embodiment, the downregulation occurs as early as 22 hours after the contact, and is concurrent with cytokine inhibition. In some embodiments, the downregulation occurs as early as 24 hours after the contact, and is concurrent with cytokine inhibition. In some embodiments, the inhibition of cytokine production proceeds downregulation of PD-1 expression on the surface of the T cell. In one embodiment, the downregulation occurs as early as 4 hours after the contact, and is after cytokine inhibition. In one embodiment, the downregulation occurs as early as 6 hours after the contact, and is after cytokine inhibition.
  • the downregulation occurs as early as 8 hours after the contact, and is after cytokine inhibition. In one embodiment, the downregulation occurs as early as 10 hours after the contact, and is after cytokine inhibition. In another embodiment, the downregulation occurs as early as 12 hours after the contact, and is after cytokine inhibition. In an embodiment, the downregulation occurs as early as 14 hours after the contact, and is after cytokine inhibition. In other embodiments, the downregulation occurs as early as 16 hours after the contact, and is after cytokine inhibition. In one embodiment, the downregulation occurs as early as 18 hours after the contact, and is after cytokine inhibition. In another embodiment, the downregulation occurs as early as 20 hours after the contact, and is after cytokine inhibition. In one embodiment, the downregulation occurs as early as 22 hours after the contact, and is after cytokine inhibition. In some embodiments, the downregulation occurs as early as 24 hours after the contact, and is after cytokine inhibition.
  • the antibody or antigen-binding fragment thereof downregulates PD-1 expression on the surface of a T cell.
  • the maximal percent downregulation of PD-1 expression by the antibody or antigen-binding fragment thereof is at least about 10%, 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%.
  • the downregulation of PD-1 expression on the surface of the T cell occurs as early as 4 hours after the contact with the antibody or antigen-binding fragment thereof.
  • the downregulation of PD-1 expression on the surface of the T cell precedes cytokine inhibition.
  • the downregulation of PD-1 expression on the surface of the T cell is concurrent with cytokine inhibition. In one embodiment, the downregulation of PD-1 expression on the surface of the T cell follows cytokine inhibition.
  • the cytokine is IL-2, IL-17, IFN- ⁇ , or any combination thereof. In certain embodiments, the cytokine is selected from the group consisting of IL-1, IL-2, IL-6, IL-12, IL-17, IL-22, IL-23, GM-CSF, IFN- ⁇ , and TNF-a. In certain embodiments, the cytokine is IL-1. In some embodiments, the cytokine is IL-2. In other embodiments, the cytokine is IL-6.
  • the cytokine is IL-12. In other embodiments, the cytokine is IL-17. In yet other embodiments, the cytokine is IL-22. In still other embodiments, the cytokine is IL-23. In some embodiments, the cytokine is GM-CSF. In other embodiments, the cytokine is IFN- ⁇ . In yet other embodiments, the cytokine is TNF-a. In certain embodiments, the cytokine is IL-2 and IL-17. In some embodiments, the cytokine is IL-2 and IFN- ⁇ . In yet other embodiments, the cytokine is IL-17 and IFN- ⁇ . In still other embodiments, the cytokine is IL-12 and IL-17. In yet other embodiments, the cytokine is IL-22. In still other embodiments, the cytokine is IL-23. In some embodiments, the cytokine is GM-CSF. In other embodiments, the cytokine is IFN- ⁇ .
  • the cytokine is IL-2, IL-17, and IFN- ⁇ .
  • the antibody or antigen-binding fragment thereof attenuates T cell activity by inhibiting cytokine production.
  • the cytokine that is inhibited by the antibody or antigen-binding fragment thereof is selected from the group consisting of IL-2, IL-17, IFN- ⁇ , or any combination thereof.
  • the cytokine is selected from the group consisting of IL-1, IL-2, IL-6, IL-12, IL-17, IL-22, IL-23, GM-CSF, IFN- ⁇ , and TNF-a.
  • the cytokine is IL-1.
  • the cytokine is IL-2. In other embodiments, the cytokine is IL-6. In another embodiment, the cytokine is IL-12. In other embodiments, the cytokine is IL-17. In yet other embodiments, the cytokine is IL-22. In still other embodiments, the cytokine is IL-23. In some embodiments, the cytokine is GM-CSF. In other embodiments, the cytokine is IFN- ⁇ . In yet other embodiments, the cytokine is TNF-a. In certain embodiments, the cytokine is IL-2 and IL- 17. In some embodiments, the cytokine is IL-2 and IFN- ⁇ .
  • the cytokine is IL-17 and IFN- ⁇ . In still other embodiments, the cytokine is IL-2, IL-17, and IFN- ⁇ . Other combinations of two, three or more of the above-mentioned cytokines are also
  • composition comprising an antibody or antigen-binding fragment thereof described herein.
  • the composition further comprises a pharmaceutically acceptable carrier.
  • the present disclosure provides a method of managing, preventing, or treating an immune disorder in a subject, comprising administering to a subject a therapeutically effective amount of any antibody or antigen-binding fragment thereof described herein.
  • the immune disorder is an inflammatory disease.
  • the inflammatory disease is uveitis.
  • the immune disorder is a hypersensitivity disease.
  • the hypersensitivity disease is a T cell hypersensitivity disease.
  • the immune disorder is an autoimmune disease.
  • the hypersensitivity disease is allergy, atopic dermatitis, or hypersensitivity vasculitis.
  • the hypersensitivity disease is allergy.
  • the hypersensitivity disease is atopic dermatitis.
  • the hypersensitivity disease is hypersensitivity vasculitis.
  • the immune disorder is an autoimmune disease.
  • the autoimmune disease is selected from the group consisting of rheumatoid arthritis, Crohn's disease, psoriasis, psoriatic arthritis, multiple sclerosis, lupus, ankylosing spondylitis, type I diabetes, Sjogren's syndrome, ulcerative colitis, neuromyelitis optica, celiac disease, scleroderma, and temporal arteritis.
  • the lupus is systemic lupus erythematosus (SLE), cutaneous lupus erythematosus (CLE), or lupus nephritis.
  • the autoimmune disease is rheumatoid arthritis. In another embodiment, the autoimmune disease is Crohn's disease. In yet another embodiment, the autoimmune disease is psoriasis. In still another embodiment, the autoimmune disease is multiple sclerosis. In another embodiment, the autoimmune disease is ankylosing spondylitis. In yet another embodiment, the autoimmune disease is type I diabetes. In still another embodiment, the autoimmune disease is Sjogren's syndrome. In a further embodiment, the autoimmune disease is ulcerative colitis. In another embodiment, the autoimmune disease is neuromyelitis optica. In yet another embodiment, the autoimmune disease is celiac disease. In one embodiment, the autoimmune disease is temporal arteritis.
  • the autoimmune disease is scleroderma. In one embodiment, the autoimmune disease is lupus. In one embodiment, the autoimmune disease is SLE. In another embodiment, the autoimmune disease is CLE. In still another embodiment, the autoimmune disease is lupus nephritis.
  • the subject has the autoimmune disease, or is being treated for the autoimmune disease with an anti-inflammatory therapeutic.
  • the immune cells in the subject express PD-1.
  • FIGS. 1A-1B show that the T cell attenuating anti-PD-1 antibodies (PD1AB) do not compete with PD-L1 (PD-Ll-DyL650 denotes PD-L1 conjugated with the dye DyL650) binding to PD-1 : (A) PDlAB-1, PD1AB-2, and PDlAB-6; (B) PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, and PD1AB-5. MDX 4H1, an antagonist antibody, blocks PD-L1 binding to PD-1.
  • PD-Ll-DyL650 denotes PD-L1 conjugated with the dye DyL650
  • FIG. 2 depicts that the PD-1 :PD1 AB-6 Fab interaction site is at a distal side of PD-1 relative to the PD-1 :PD-L1 interaction site.
  • FIG. 3 depicts that PD1 AB-6 Fab binds against a PD-1 ⁇ sheet, with substantial interactions formed with a PD-1 loop composed of residues 100-105.
  • FIG. 4 shows the amino acid sequences of heavy chain (HC) and light chain (LC) of PDlAB-6-IgGl and HC of its variants PD1AB-6-K3 and PD1AB-6-4P.
  • FIGS. 5A-5B depict the PDlAB-6-IgGl affinity for cyno (A) or human (B) PD-1 expressed on CHO cells.
  • FIG. 6 depicts the binding of PDl AB-6-IgGl, isotype control, and human PD-L1 Fc fusion protein (hPD-Ll Fc) to activated human PBMC gated on CD4+ T cells.
  • FIG. 7 depicts the binding of PDl AB-6-IgGl, isotype control, and human PD-L1 Fc fusion protein (hPD-Ll Fc) to activated cyno PBMC gated on CD4+ T cells.
  • FIGS. 8A-8D show the PD1AB-6 variants binding to FcyRI (A), FcyRIIIa (V158)
  • FIGS. 9A-9C depict the PDl AB-6 variants binding to FcyRIIIa (V158) (A) or FcyRI
  • FIGS. 10A-10B depict the ADCC activity of the PDl AB-6 variants and a control human IgGl Fc among two representatives of four individual healthy donors: (A) Donor 7 and (B) Donor 8.
  • FIG. 11 depicts the CDC activity of the PDlAB-6 variants. Data are representative of 3 independent experiments: (i) CDC activity of PDlAB-6-IgGl and anti-human CD20 IgGl;
  • FIG. 12 depicts the potent attenuating activity of PDl AB-6 variants in human PBMC assay, measured by IL-2 levels in culture supernatants at 24 hours post-stimulation.
  • FIG. 13 depicts the activity of PDl AB-6-K3 in human whole blood assay.
  • the graph shows a representative curve from donor 4 used to calculate EC 50 of IFN- ⁇ inhibition.
  • the table shows EC 50 values of IFN- ⁇ inhibition for 4 healthy donors with PDlAB-6 variants and
  • FIGS. 14A-14C depict downregulation of PD-1 expression by PDl AB-6-IgGl as determined by (A) isotype vs. PD-1 staining on CD3+ T cells in human PBMC activated with anti-CD3 + anti-CD28 for 48 hours, (B) PD-1 expression in isotype IgGl vs.
  • FIGS. 15A-15C show (A) PDlAB-6-IgGl, (B) PD1AB-6-4P, and (C) PD1AB-6-K3 binding to PD-1 antigen on Biacore ® T200.
  • FIG. 16 shows that PD1 AB-6-IgGl inhibited CD4+ T cell tetanus recall response with similar IC 50 values in PBMCs from three different donors.
  • FIGS. 17A-17B show that PD1AB-6-K3 blocked secretion of IFN- ⁇ (A) and IL-17 (B) in whole blood samples from autoimmune disease patients.
  • FIG. 18 shows that PD1 AB-6-K3 reduced unexhausted IL-7R M CD8+ T cells.
  • FIGS. 19A-19B show that PD1 AB-6-K3 inhibited proliferation of (A) isolated CD4+ T cells and (B) isolated CD8+ T cells.
  • FIG. 20 shows that PD1 AB-6-IgGl increased CD25+Foxp3+ induced regulatory T cells at various concentrations of transforming growth factor beta (TGF- ⁇ ).
  • TGF- ⁇ transforming growth factor beta
  • FIG. 21 shows strong PD-1 expression in lymphocytes in follicular formation (left panel) and low PD-Ll expression in lymphoid aggregates (right panel) in synovium of RA patient 5.
  • FIG. 22 shows rare PD-1+ lymphocytes in lymphoid aggregate in connective tissue in joint (left panel) and rare PD-Ll + antigen-presenting cells in similar location (right panel) of RA patient 1.
  • FIG. 23 shows that PD-1+ cells predominate in follicles and are rare in the deep lamina limbal (left panel), and that PD-Ll are widely expressed in follicles and in macrophages and lymphocytes in lamina limbal (right panel) in the intestines of Crohn's patient.
  • FIG. 24 shows rare PD-1+ lymphocytes along lamina limbal near ulcerated region (left panel) and numerous PD-Ll + macrophages in the same region (right panel) of Crohn's disease intestinal sample (40X).
  • FIGS. 25A-25C show PD-1 and PD-Ll expression scores in pilot study of (A)
  • FIGS. 26A-26B show that PD1 AB-6-K3, with reduced Clq binding, has similar inibitory activity as PD1 AB-6-IgGl molecule in PBMC transfer xeno-GvHD model, as determined by (A) hGM-CSF levels and (B) number of human CD45+ cells in the spleen.
  • FIGS. 27A-27B show that PD1 AB-6-K3 inhibited human CD45+ lymphocyte engraftment in blood (A) and spleen (B) in CD4+ T cell transfer xeno-GvHD model.
  • FIGS. 28A-28C show that PD1 AB-6-K3 inhibited secretion of GM-CSF (A), T F-a (B), and IL-17 (C) in CD4+ T cell transfer xeno-GvHD model.
  • FIGS. 29A-29B show that PD1 AB-6-K3 induced downregulation of PD-1 expression (A) precedes inhibition of cytokine GM-CSF secretion (B).
  • FIGS. 30A-30B show correlation between PD1AB-6 variants-induced
  • FIG. 31 shows that a murine surrogate of PD1 AB-6-K3 inhibited disease score in an experimental autoimmune encephalomyelitis (EAE) model.
  • FIGS. 32A-32B show that a murine surrogate of PD1 AB-6-K3 inhibited IFN- ⁇ secretion (A) and IL-17 secretion (B) in a recall assay with spleens on day 23 in the EAE model.
  • FIG. 33 shows differentiation of CD20+CD38- activated B-lymphocytes into CD20- CD38+ plasmablasts in in vitro T cell/B cell co-culture system using purified CD3+ T cells and total B cells from four exemplary donors.
  • FIGS. 34A-34C show percentage of reduction of plasmablast numbers (A), IgG secretion (B), and IgM surface expression (C) induced by PD1 AB-6-K3 in T cell receptor activated CD3+ T Cell/total B Cell co-cultures.
  • FIGS. 35A-35C show percentage of reduction of plasmablast numbers (A), IgG secretion (B), and IgM surface expression (C) induced by PD-L1 Fc fusion protein in T cell receptor activated CD3+ T Cell/total B Cell co-cultures.
  • kits for managing, preventing, or treating an immune disorder in a subject comprising administering to a subject an effective amount of binding proteins, such as antibodies that bind to PD-1.
  • a method of managing an immune disorder in a subject comprising administering to a subject an effective amount of a PD-1 binding protein.
  • a method of preventing an immune disorder in a subject comprising administering to a subject an effective amount of a PD-1 binding protein.
  • a method of treating an immune disorder in a subject comprising administering to a subject an effective amount of a PD-1 binding protein.
  • the PD-1 binding protein is an antibody that binds to PD-1.
  • Exemplary PD-1 antibodies useful in these methods are provided herein.
  • the antibodies bind to human and/or cyno PD-1.
  • the binding proteins such as antibodies that bind to human and/or cyno PD-1, do not bind to rodent PD-1.
  • the PD-1 binding proteins, including antibodies disclosed herein are agonists (e.g., can mimic the effect of PD-1 ligand and induce PD-1 signaling).
  • the binding proteins such as antibodies to PD-1 provided herein (i) bind to human and/or cyno PD-1, (ii) do not compete for binding with PD-1 ligand (e.g., PD-L1 and/or PD-L2), and/or (iii) induce PD-1 signaling.
  • the PD-1 antibodies bind to human PD-1.
  • the PD-1 antibodies bind to cyno PD-1.
  • the PD-1 antibodies bind to both human PD-1 and cyno PD-1.
  • the PD-1 antibodies do not compete with PD-L1 for binding to PD-1.
  • the PD-1 antibodies do not compete with PD-L2 for binding to PD-1. In yet other embodiments, the PD-1 antibodies do not compete with either PD-L1 or PD- L2 for binding to PD-1. In other embodiments, the PD-1 antibodies induce PD-1 signaling. In specific embodiments, the PD-1 antibodies provided herein bind to both human PD-1 and cyno PD-1, do not compete for binding to PD-1 with either PD-L1 or PD-L2, and induce PD-1 signaling. In some embodiments, the binding, competition, and/or signaling is assayed in vitro, e.g., in a cell-based assay.
  • the binding, competition, and/or signaling is assayed ex vivo, e.g., in a T cell function assay. In other embodiments, the binding, competition, and/or signaling is assayed using a sample from a subject (e.g., a human subject).
  • assays and measurements include (1) a human or cyno PBMC assay (see, e.g., Examples 5.2.1 and 5.2.2); (2) a human whole blood sample assay (see, e.g., Examples 5.2.1 and 5.4.2); (3) a Tetanus Toxoid Antigen (TTX) recall assay (see, e.g., Example 5.4.1); (4) measuring expression of a T cell inhibitory receptor (see, e.g., Example 5.4.3 and 5.4.6); (5) measuring T cell proliferation (see, e.g., Example 5.4.4); and (6) measuring numbers of regulatory T cells (see, e.g., Example 5.4.5).
  • a human or cyno PBMC assay see, e.g., Examples 5.2.1 and 5.2.2
  • a human whole blood sample assay see, e.g., Examples 5.2.1 and 5.4.2
  • TTX Tetanus Toxoid Antigen recall assay
  • TX Tetanus Toxoid Antigen recall
  • binding proteins such as anti-PD-1 antibodies, as described herein, exhibit activities that are consistent with the natural biological function of PD-L1 and/or PD-L2. In some embodiments, the activities are exhibited in vitro. In other embodiments, the activities are exhibited ex vivo.
  • the binding, competition and/or signaling is assayed in vivo, e.g., in a xeno-graft versus host disease (xeno-GvHD) model for human diseases.
  • the binding, competition and/or signaling is assayed using an animal disease model (e.g., a mouse disease model).
  • the binding, competition and/or signaling is assayed using a sample from a disease model subject (e.g., a mouse disease model subject).
  • animal disease models and assays include (1) a xeno-GvHD model (see, e.g., Example 5.5.1); and (2) an experimental autoimmune encephalomyelitis (EAE) model in human PD-1 knock-in (KI) mice (see, e.g., Example 5.5.2).
  • binding proteins such as anti-PD-1 antibodies, as described herein, exhibit activities that are consistent with the natural biological function of PD-L1 and/or PD-L2. In other embodiments, the activities are exhibited in vivo.
  • the immune disorder is an inflammatory disease.
  • the inflammatory disease is uveitis.
  • the immune disorder is a hypersensitivity disease.
  • the hypersensitivity disease is a T cell hypersensitivity disease.
  • the hypersensitivity disease is allergy.
  • the hypersensitivity disease is atopic dermatitis.
  • the hypersensitivity disease is hypersensitivity vasculitis.
  • the immune disorders is an autoimmune disease. In one embodiment, the autoimmune disease is rheumatoid arthritis.
  • the autoimmune disease is Crohn's disease. In yet another embodiment, the autoimmune disease is psoriasis. In still another embodiment, the autoimmune disease is multiple sclerosis. In another embodiment, the autoimmune disease is ankylosing spondylitis. In yet another embodiment, the autoimmune disease is type I diabetes. In still another embodiment, the autoimmune disease is Sjogren's syndrome. In a further embodiment, the autoimmune disease is ulcerative colitis. In another embodiment, the autoimmune disease is neuromyelitis optica. In yet another embodiment, the autoimmune disease is celiac disease. In one
  • the autoimmune disease is temporal arteritis. In another embodiment, the autoimmune disease is scleroderma. In one embodiment, the autoimmune disease is lupus. In one embodiment, the autoimmune disease is SLE. In another embodiment, the autoimmune disease is CLE. In still another embodiment, the autoimmune disease is lupus nephritis.
  • This discovery can also make the disclosed binding proteins, including anti-PD-1 antibodies, viable therapeutics broadly for the treatment of any disease, disorder, or condition in which it is desirable to mimic or augment PD-1 signaling (e.g., in vivo or in vitro).
  • the binding proteins such as antibodies that bind to PD-1, described herein share the common feature of competing with each other for the binding of PD-1. This competitive inhibition can indicate that each antibody binds to the same region of PD-1 (e.g., the same epitope), thereby asserting similar effects.
  • anti-PD-1 antibodies provided herein include humanized anti- PD-1 antibodies, such as those derived from or based on antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, and/or PD1AB-6.
  • anti-PD-1 antibodies provided herein compete for binding with an antibody derived from or based on PDlAB-1, PD1AB-2, PD1 AB-3, PD1 AB-4, PD1 AB-5, and/or PD1 AB-6.
  • the anti- PD-1 antibodies have CDR sequences as described in Tables 1-2.
  • the anti-PD-1 antibodies bind to a specific domain or epitope of human PD-1 (e.g., residues 100- 105; see Example 5.1.4).
  • binding can be largely attributed to particular amino acid residues within the region (e.g., G103 and R104; see Example 5.1.4), which comprise the epitope recognized by the anti-PD-1 antibodies provided herein.
  • region e.g., G103 and R104; see Example 5.1.4
  • the results described herein demonstrate that the effects observed for an anti-PD-1 antibody that is derived from or based on PD1 AB-6, including an antibody having one or more CDRs described in
  • Tables 1-2 can be extrapolated to other anti-PD-1 antibodies provided herein having the same or similar epitope specificity (e.g., the same or similar CDRs).
  • the activities of antibodies as shown in Examples 5.1.2-3, 5.1.7-10, 5.2.1-3, 5.3.1, 5.4.1-4, 5.5.1-3, for an exemplary humanized anti-PD-1 antibody are representative of the activities and effects of the anti-PD-1 antibodies provided herein.
  • the binding proteins such as anti-PD-1 antibodies may comprise immunoglobulin variable regions which comprise one or more CDRs as described in Tables 1-2.
  • the CDRs may be joined with one or more scaffold regions or framework regions (FRs), which orient(s) the CDR(s) such that the proper antigen binding properties of the CDR(s) is achieved.
  • FRs framework regions
  • the terms "Programmed Death 1,” “Programmed Cell Death 1,” “Protein PD-1,” “PD-1,” “PD-1 polypeptide,” or “PD1” encompasses a polypeptide ("polypeptide” and “protein” are used interchangeably herein), including any native polypeptide, from any vertebrate source, including mammals such as primates ⁇ e.g., humans and cynomolgus monkeys (cynos)), dogs, and rodents ⁇ e.g., mice and rats), unless otherwise indicated.
  • the terms include "related PD-1 polypeptides,” including S P variants thereof.
  • PD-1 also encompasses "full-length,” unprocessed PD-1 as well as any form of PD-1 that results from processing in the cell.
  • the PD1 has an amino acid sequence of SEQ ID NO:43.
  • GenBankTM accession number U64863 provides another exemplary human PD-1 nucleic acid sequence.
  • Related PD-1 polypeptides include allelic variants ⁇ e.g., SNP variants); splice variants; fragments; derivatives; substitution, deletion, and insertion variants; fusion
  • an anti-PD-1 antibody provided herein can bind to a PD-1 polypeptide, a PD- 1 polypeptide fragment, a PD-1 antigen, and/or a PD-1 epitope.
  • An "epitope" may be part of a larger PD-1 antigen, which may be part of a larger PD-1 polypeptide fragment, which, in turn, may be part of a larger PD-1 polypeptide.
  • PD-1 may exist in a native or denatured form.
  • PD-1 polypeptides described herein may be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods. Orthologs to the PD-1 polypeptide are also well known in the art.
  • the terms "PD1 AB-6-IgGl,” “PD1 AB-6 IgGl,” “PDlAB-6_IgGl,” “IgGl PDlAB- 6,” and “IgGl -PD1 AB-6” are used interchangeably, and refer to the antibody PD1 AB-6 having an IgGl Fc region.
  • the antibody PDlAB-6 comprises a light chain amino acid sequence of LC_PDlAB-6-IgGl (SEQ ID NO:31) and a heavy chain amino acid sequence of HC_PDlAB-6-IgGl (SEQ ID NO:32), e.g., as shown in FIG. 4.
  • PD1 AB-6-K3 The terms "PD1 AB-6-IgGl-K322A,” “PD1 AB-6-K322A,”
  • the PD1 AB-6 variant has a heavy chain amino acid sequence of HC_PDlAB-6-IgGl-K322A (SEQ ID NO:33), e.g., as shown in FIG. 4
  • the terms "PD1AB-6-4P,” “IgG4P_PDlAB-6,” “IgG4P-PDlAB-6,” “PDIAB- 6_IgG4P,” and “PDlAB-6-IgG4P” are used interchangeably and refer to the PDlAB-6 variant having an IgG4P Fc region.
  • the PD-1 antibody variant has a heavy chain amino acid sequence of HC_PDlAB-6-IgG4P (SEQ ID NO:34), e.g., as shown in FIG. 4.
  • PD1AB-6-4PE "IgG4PE_PDlAB-6,” “IgG4PE-PDlAB-6,” and “PDlAB-6_IgG4PE,” and “PDlAB-6-IgG4PE” are used interchangeably and refer to the PDlAB-6 variant having an IgG4PE heavy chain amino acid sequence as HC PDlAB-6- IgG4PE (SEQ ID NO:35).
  • PD-1 ligand refers to a molecule that binds to PD-1, e.g., in vivo or in vitro.
  • Non-limiting examples of PD-1 ligand include naturally occurring ligands, e.g., PD-1 ligand 1 (PD-L1, also known as B7-H1 or CD274) and PD-1 ligand 2 (PD-L2, also known as B7-DC or CD273), and artificially generated ligands.
  • PD-L1 and “PDL-1” are used interchangeably herein and refer to PD-1 ligand 1 (also known as B7-H1 or CD274).
  • PD-1 activity when applied to a binding protein such as an antibody that binds to PD-1 of the present disclosure, means that the binding protein (e.g., antibody) mimics or modulates a biological effect induced by the binding of PD-1 ligand, and induces a biological response that otherwise would result from PD-1 ligand binding to PD-1, e.g., in vivo or in vitro.
  • a binding protein such as an antibody that binds to PD-1 of the present disclosure
  • anti-PD-1 antibody for example, an antibody or fragment thereof that binds to PD-1 ⁇ e.g., human PD-1
  • the antibody is deemed to induce a biological response when the response is equal to or greater than 5%, such as equal to or greater than 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 125%, 150%, 175%, or 200%) of the activity of a wild type PD-1 ligand standard.
  • the anti-PD-1 antibody or the PD-1 ligand is immobilized (for example, on a plastic surface or bead).
  • the antibody has the following properties: exhibits an efficacy level of equal to or more than 5% of a PD-1 ligand standard, with an EC 50 of equal to or less than 100 nM, e.g., 90 nM, 80 nM, 70 nM, 60 nM, 50 nM, 40 nM, 30 nM, 20 nM, 10 nM, 5 nM, 2 nM, 1 nM, 0.5 nM, 0.2 nM, or 0.1 nM in, for example, (1) a human or cyno PBMC assay ⁇ see, e.g., Examples 5.2.1 and 5.2.2); (2) a human whole blood sample assay ⁇ see, e.g., Examples 5.2.1 and 5.4.2); (3) a TTX recall assay ⁇ see, e.g., Example 5.4.1); (4) a T cell inhibitory receptor expression assay ⁇ see, e.g., Example 5.4.3 and 5.4.6); (5)
  • binding protein refers to a protein comprising a portion ⁇ e.g., one or more binding regions such as CDRs) that binds to PD-1, including human and/or cyno PD-1 and, optionally, a scaffold or framework portion ⁇ e.g., one or more scaffold or framework regions) that allows the binding portion to adopt a conformation that promotes binding of the binding protein to a PD-1 polypeptide, fragment, or epitope.
  • a portion ⁇ e.g., one or more binding regions such as CDRs
  • a scaffold or framework portion ⁇ e.g., one or more scaffold or framework regions
  • binding proteins examples include antibodies, such as a human antibody, a humanized antibody, a chimeric antibody, a recombinant antibody, a single chain antibody, a diabody, a triabody, a tetrabody, a Fab fragment, a F(ab') 2 fragment, an IgD antibody, an IgE antibody, an IgM antibody, an IgGl antibody, an IgG2 antibody, an IgG3 antibody, or an IgG4 antibody, and fragments thereof.
  • the binding protein can comprise, for example, an alternative protein scaffold or artificial scaffold with grafted CDRs or CDR derivatives.
  • Such scaffolds include, but are not limited to, antibody-derived scaffolds comprising mutations introduced to, for example, stabilize the three-dimensional structure of the binding protein as well as wholly synthetic scaffolds comprising, for example, a biocompatible polymer. See, e.g., Korndorfer et al, 2003, Proteins: Structure, Function, and Bioinformatics 53(1): 121-29; and Roque et al. , 2004, Biotechnol. Prog. 20:639-54.
  • PAMs peptide antibody mimetics
  • scaffolds based on antibody mimetics utilizing fibronectin components as a scaffold.
  • a binding protein is said to specifically bind or selectively bind to PD-1, for example, when the dissociation constant (K D ) is ⁇ 10 "7 M.
  • the binding proteins e.g. , antibodies
  • the binding proteins may specifically bind to PD-1 with a K D of from about 10 "7 M to about 10 "12 M.
  • the binding protein e.g. , antibody
  • the binding proteins may specifically bind to PD-1 with high affinity when the K D is ⁇ 10 "8 M or K D is ⁇ 10 "9 M.
  • the binding proteins e.g.
  • antibodies may specifically bind to purified human PD-1 with a K D of from 1 x 10 "9 M to 10 x 10 "9 M as measured by Biacore®.
  • the binding proteins e.g., antibodies
  • the binding proteins may specifically bind to purified human PD-1 with a K D of from 0.1 x 10 "9 M to 1 x 10 "9 M as measured by KinExATM (Sapidyne, Boise, ID).
  • the binding proteins (e.g., antibodies) specifically bind to human PD-1 expressed on cells with a K D of from 0.1 x 10 "9 M to 10 x 10 "9 M.
  • the binding proteins specifically bind to human PD-1 expressed on cells with a K D of from 0.1 x 10 "9 M to 1 x 10 "9 M. In some embodiments, the binding proteins (e.g., antibodies) specifically bind to human PD-1 expressed on cells with a KD of 1 x 10 "9 M to 10 x 10 "9 M. In certain embodiments, the binding proteins (e.g. , antibodies) specifically bind to human PD-1 expressed on cells with a K D of about 0.1 x 10 "9 M , about 0.5 x 10 "9 M, about 1 x 10 "9 M, about 5 x 10 "9 M, about 10 x 10 "9 M, or any range or interval thereof.
  • the binding proteins may specifically bind to cyno PD-1 expressed on cells with a K D of 0.1 x 10 "9 M to 10 x 10 "9 M. In certain embodiments, the binding proteins (e.g. , antibodies) specifically bind to cyno PD-1 expressed on cells with a K D of from 0.1 x 10 "9 M to 1 x 10 "9 M. In some
  • the binding proteins specifically bind to cyno PD-1 expressed on cells with a K D of 1 x 10 "9 M to 10 x 10 "9 M.
  • the binding proteins specifically bind to cyno PD-1 expressed on cells with a K D of about 0.1 x 10 "9 M , about 0.5 x 10 "9 M, about 1 x 10 "9 M, about 5 x 10 "9 M, about 10 x 10 "9 M, or any range or interval thereof.
  • antibody immunoglobulin
  • Ig immunoglobulin
  • individual anti-PD-1 monoclonal antibodies including agonist, antagonist, neutralizing antibodies, full length or intact monoclonal antibodies
  • anti-PD-1 antibody compositions with polyepitopic or monoepitopic specificity polyclonal or monovalent antibodies
  • multivalent antibodies multispecific antibodies (e.g., bispecific antibodies so long as they exhibit the desired biological activity), formed from at least two intact antibodies, single chain anti-PD-1 antibodies, and fragments of anti-PD-1 antibodies, as provided below.
  • an antibody can be human, humanized, chimeric and/or affinity matured, as well as an antibody from other species, for example, mouse and rabbit, etc.
  • the term "antibody” is intended to include a polypeptide product of B cells within the immunoglobulin class of polypeptides that is able to bind to a specific molecular antigen and is composed of two identical pairs of polypeptide chains, wherein each pair has one heavy chain (about 50-70 kDa) and one light chain (about 25 kDa), each amino-terminal portion of each chain includes a variable region of about 100 to about 130 or more amino acids, and each carboxy-terminal portion of each chain includes a constant region. See, e.g., Antibody
  • the specific molecular antigen can be bound by an antibody provided herein, including a PD-1 polypeptide, a PD-1 fragment, or a PD-1 epitope.
  • Antibodies also include, but are not limited to, synthetic antibodies, recombinantly produced antibodies, camelized antibodies, intrabodies, anti-idiotypic (anti-Id) antibodies, and functional fragments (e.g., antigen-binding fragments such as PD-l-binding fragments) of any of the above, which refers to a portion of an antibody heavy or light chain polypeptide that retains some or all of the binding activity of the antibody from which the fragment was derived.
  • Non-limiting examples of functional fragments include single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), Fab fragments, F(ab') fragments, F(ab) 2 fragments, F(ab') 2 fragments, disulfide-linked Fvs (dsFv), Fd fragments, Fv fragments, diabody, triabody, tetrabody, and minibody.
  • scFv single-chain Fvs
  • Fab fragments F(ab') fragments, F(ab) 2 fragments, F(ab') 2 fragments
  • dsFv disulfide-linked Fvs
  • antibodies provided herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, for example, antigen-binding domains or molecules that contain an antigen-binding site that binds to a PD-1 antigen (e.g., one or more CDRs of an anti-PD-1 antibody).
  • a PD-1 antigen e.g., one or more CDRs of an anti-PD-1 antibody.
  • Such antibody fragments can be found in, for example, Harlow and Lane, Antibodies: A Laboratory Manual (1989); Mol. Biology and Biotechnology: A Comprehensive Desk Reference (Myers ed., 1995); Huston et al, 1993, Cell Biophysics 22: 189-224; Pluckthun and Skerra, 1989, Meth. Enzymol. 178:497-515; and Day, Advanced Immunochemistry (2d ed. 1990).
  • the antibodies provided herein can be of any class (e.g., IgG, IgE, IgM, IgD, and IgA) or any subclass (e.g., IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2) of immunoglobulin molecule.
  • Anti-PD-1 antibodies may be agonistic antibodies or antagonistic antibodies.
  • agonistic antibodies to PD-1 including antibodies that induce PD-1 signaling.
  • agonistic antibodies to PD-1 do not compete for the binding of PD-L1 and/or PD-L2 to PD-1.
  • An "antigen" is a predetermined antigen to which an antibody can selectively bind.
  • a target antigen may be a polypeptide, carbohydrate, nucleic acid, lipid, hapten, or other naturally occurring or synthetic compound. In some embodiments, the target antigen is a polypeptide.
  • antigen-binding fragment refers to that portion of an antibody, which comprises the amino acid residues that interact with an antigen and confer on the binding agent its specificity and affinity for the antigen (e.g., the CDRs).
  • binding refers to an interaction between molecules including, for example, to form a complex. Interactions can be, for example, non-covalent interactions including hydrogen bonds, ionic bonds, hydrophobic interactions, and/or van der Waals interactions. A complex can also include the binding of two or more molecules held together by covalent or non-covalent bonds, interactions, or forces. The strength of the total non-covalent interactions between a single antigen-binding site on an antibody and a single epitope of a target molecule, such as PD-1, is the affinity of the antibody or functional fragment for that epitope.
  • the ratio of dissociation rate (k off ) to association rate (k on ) of an antibody to a monovalent antigen (k 0ff /k on ) is the dissociation constant K D , which is inversely related to affinity.
  • K D the dissociation constant
  • the value of K D varies for different complexes of antibody and antigen and depends on both k on and k off .
  • the dissociation constant K D for an antibody provided herein can be determined using any method provided herein or any other method well known to those skilled in the art.
  • the affinity at one binding site does not always reflect the true strength of the interaction between an antibody and an antigen.
  • the avidity of an antibody can be a better measure of its binding capacity than is the affinity of its individual binding sites. For example, high avidity can compensate for low affinity as is sometimes found for pentameric IgM antibodies, which can have a lower affinity than IgG, but the high avidity of IgM, resulting from its multivalence, enables it to bind antigen effectively.
  • antibodies that specifically bind to PD-1 refer to antibodies that specifically bind to a PD-1 polypeptide, such as a PD-1 antigen, or fragment, or epitope (e.g., human PD-1 such as a human PD-1 polypeptide, antigen, or epitope).
  • An antibody that specifically binds to PD-1 may bind to the extracellular domain or peptide derived from the extracellular domain of PD-1.
  • An antibody that specifically binds to a PD-1 antigen may be cross-reactive with related antigens (e.g., cyno PD-1). In certain embodiments, an antibody that specifically binds to a PD-1 antigen does not cross- react with other antigens.
  • An antibody that specifically binds to a PD-1 antigen can be identified, for example, by immunoassays, Biacore®, or other techniques known to those of skill in the art.
  • An antibody binds specifically to a PD-1 antigen when it binds to a PD-1 antigen with higher affinity than to any cross-reactive antigen as determined using experimental techniques, such as radioimmunoassays (RIA) and enzyme linked immunosorbent assays (ELISAs).
  • RIA radioimmunoassays
  • ELISAs enzyme linked immunosorbent assays
  • a specific or selective reaction will be at least twice background signal or noise and may be more than 10 times background. See, e.g., Fundamental Immunology 332-36 (Paul ed., 2d ed. 1989) for a discussion regarding antibody specificity.
  • An antibody which "binds an antigen of interest" e.g., a target antigen such as PD-1) is one that binds the antigen with sufficient affinity such that the antibody is useful as a therapeutic agent in targeting a cell or tissue expressing the antigen, and does not significantly cross-react with other proteins.
  • the extent of binding of the antibody to a "non-target" protein will be less than about 10% of the binding of the antibody to its particular target protein, for example, as determined by fluorescence activated cell sorting (FACS) analysis or RIA.
  • FACS fluorescence activated cell sorting
  • the term "specific binding,” “specifically binds to,” or “is specific for” a particular polypeptide or an epitope on a particular polypeptide target means binding that is measurably different from a non-specific interaction. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule, which generally is a molecule of similar structure that does not have binding activity.
  • specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target.
  • anti-PD-1 antibody or "an antibody that binds to PD-1” includes an antibody that is capable of binding PD-1 with sufficient affinity such that the antibody is useful, for example, as a diagnostic agent in targeting PD-1.
  • binding refers to binding where a molecule binds to a particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.
  • an antibody that binds to PD-1 has a dissociation constant (K D ) of less than or equal to 10 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, or 0.1 nM.
  • K D dissociation constant
  • anti-PD-1 antibody binds to an epitope of PD-1 that is conserved among PD-1 from different species (e.g., between human and cyno PD-1).
  • the term "compete" when used in the context of anti-PD-1 antibodies means competition as determined by an assay in which the antibody (or binding fragment) thereof under study prevents or inhibits the specific binding of a reference molecule (e.g., a reference ligand or reference antigen-binding protein, such as a reference antibody) to a common antigen (e.g., PD-1 or a fragment thereof).
  • a reference molecule e.g., a reference ligand or reference antigen-binding protein, such as a reference antibody
  • a common antigen e.g., PD-1 or a fragment thereof.
  • Numerous types of competitive binding assays can be used to determine if a test antibody competes with a reference antibody for binding to PD-1 (e.g., human PD-1).
  • assays examples include solid phase direct or indirect RIA, solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see, e.g., Stahli et al., 1983, Methods in Enzymology 9:242-53), solid phase direct biotin- avidin EIA (see, e.g., Kirkland et al., 1986, J. Immunol. 137:3614-19), solid phase direct labeled assay, solid phase direct labeled sandwich assay (see, e.g., Harlow and Lane, Antibodies, A Laboratory Manual (1988)), solid phase direct label RIA using 1-125 label (see, e.g., Morel et al, 1988, Mol. Immunol.
  • such an assay involves the use of a purified antigen (e.g., PD-1 such as human PD-1) bound to a solid surface, or cells bearing either of an unlabelled test antigen-binding protein (e.g., test anti-PD-1 antibody) or a labeled reference antigen-binding protein (e.g., reference anti-PD-1 antibody).
  • a purified antigen e.g., PD-1 such as human PD-1
  • test antigen-binding protein e.g., test anti-PD-1 antibody
  • a labeled reference antigen-binding protein e.g., reference anti-PD-1 antibody
  • Competitive inhibition may be measured by determining the amount of label bound to the solid surface or cells in the presence of the test antigen-binding protein.
  • the test antigen-binding protein is present in excess.
  • Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibody and/or antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference for antibodies steric hindrance to occur. Additional details regarding methods for determining competitive binding are described herein. Usually, when a competing antibody protein is present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 30%, for example 40%, 45%, 50%, 55%, 60%, 65%, 70%, or 75%. In some instance, binding is inhibited by at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more.
  • an “isolated” antibody is substantially free of cellular material or other contaminating proteins from the cell or tissue source and/or other contaminant components from which the antibody is derived, or substantially free of chemical precursors or other chemicals when chemically synthesized.
  • the language “substantially free of cellular material” includes preparations of an antibody in which the antibody is separated from cellular components of the cells from which it is isolated or recombinantly produced.
  • an antibody that is substantially free of cellular material includes preparations of antibody having less than about 30%, 25%, 20%), 15%,10%, 5%), or 1% (by dry weight) of heterologous protein (also referred to herein as a "contaminating protein").
  • the antibody when the antibody is recombinantly produced, it is substantially free of culture medium, e.g., culture medium represents less than about 20%), 15%), 10%, 5%, or 1% of the volume of the protein preparation.
  • culture medium e.g., culture medium represents less than about 20%), 15%), 10%, 5%, or 1% of the volume of the protein preparation.
  • when the antibody is produced by chemical synthesis it is substantially free of chemical precursors or other chemicals, for example, it is separated from chemical precursors or other chemicals that are involved in the synthesis of the protein. Accordingly such preparations of the antibody have less than about 30%, 25%, 20%, 15%, 10%, 5%, or 1% (by dry weight) of chemical precursors or compounds other than the antibody of interest.
  • Contaminant components can also include, but are not limited to, materials that would interfere with therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
  • the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method (Lowry et al., 1951, J. Bio. Chem. 193 : 265-75), such as 96%), 97%, 98%, or 99%, (2) to a degree sufficient to obtain at least 15 residues of N- terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or silver stain.
  • Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step. In specific embodiments, antibodies provided herein are isolated.
  • a 4-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains. In the case of IgGs, the 4-chain unit is generally about 150,000 daltons. Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype. Each H and L chain also has regularly spaced intrachain disulfide bridges. Each H chain has at the N-terminus, a variable domain (VH) followed by three constant domains (CH) for each of the a and ⁇ chains and four CH domains for ⁇ and ⁇ isotypes.
  • VH variable domain
  • CH constant domains
  • Each L chain has at the N-terminus, a variable domain (VL) followed by a constant domain (CL) at its other end.
  • VL variable domain
  • CL constant domain
  • the VL is aligned with the VH
  • the CL is aligned with the first constant domain of the heavy chain (CHI).
  • Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
  • the pairing of a VH and VL together forms a single antigen-binding site.
  • Basic and Clinical Immunology 71 see, for example, Basic and Clinical Immunology 71 (Stites et al. eds., 8th ed. 1994).
  • variable region refers to a portion of the light or heavy chains of an antibody that is generally located at the amino-terminal of the light or heavy chain and has a length of about 120 to 130 amino acids in the heavy chain and about 100 to 110 amino acids in the light chain, and are used in the binding and specificity of each particular antibody for its particular antigen.
  • the variable region of the heavy chain may be referred to as "VH.”
  • the variable region of the light chain may be referred to as "VL.”
  • variable refers to the fact that certain segments of the variable regions differ extensively in sequence among antibodies. The V region mediates antigen binding and defines specificity of a particular antibody for its particular antigen.
  • variable regions consist of less variable (e.g., relatively invariant) stretches called framework regions (FRs) of about 15-30 amino acids separated by shorter regions of greater variability (e.g., extreme variability) called "hypervariable regions" that are each about 9-12 amino acids long.
  • FRs framework regions
  • hypervariable regions regions of heavy and light chains each comprise four FRs, largely adopting a ⁇ sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases form part of, the ⁇ sheet structure.
  • the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen -binding site of antibodies (see, e.g., Kabat et al, Sequences of Proteins of Immunological Interest (5th ed. 1991)).
  • the constant regions are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
  • the variable regions differ extensively in sequence between different antibodies.
  • the variable region is a human variable region.
  • variable region residue numbering as in Kabat or "amino acid position numbering as in Kabat”, and variations thereof, refer to the numbering system used for heavy chain variable regions or light chain variable regions of the compilation of antibodies in Kabat et al, supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, an FR or CDR of the variable domain.
  • a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 and three inserted residues ⁇ e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
  • the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) ⁇ e.g., Kabat et al, supra).
  • the "EU numbering system” or "EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region ⁇ e.g., the EU index reported in Kabat et al, supra).
  • the "EU index as in Kabat” refers to the residue numbering of the human IgG 1 EU antibody. Other numbering systems have been described, for example, by AbM, Chothia, Contact, EVIGT, and AHon.
  • an "intact" antibody is one comprising an antigen-binding site as well as a CL and at least heavy chain constant regions, CHI, CH2 and CH3.
  • the constant regions may include human constant regions or amino acid sequence variants thereof.
  • an intact antibody has one or more effector functions.
  • Antibody fragments comprise a portion of an intact antibody, such as the antigen- binding or variable region of the intact antibody.
  • antibody fragments include, without limitation, Fab, Fab', F(ab') 2 , and Fv fragments; diabodies and di-diabodies (see, e.g., Holliger et al, 1993, Proc. Natl. Acad. Sci. 90:6444-48; Lu et al, 2005, J. Biol. Chem.
  • single-chain antibody molecules ⁇ see, e.g., U.S. Pat. Nos. 4,946,778; 5,260,203; 5,482,858; and 5,476,786); dual variable domain antibodies ⁇ see, e.g., U.S. Pat. No. 7,612,181); single variable domain antibodies (sdAbs) (see, e.g., Woolven et al, 1999,
  • a "functional fragment,” “binding fragment,” or “antigen-binding fragment” of a therapeutic antibody will exhibit at least one if not some or all of the biological functions attributed to the intact antibody, the function comprising at least binding to the target antigen (e.g., a PD-1 binding fragment or fragment that binds to PD-1).
  • the target antigen e.g., a PD-1 binding fragment or fragment that binds to PD-1).
  • fusion protein refers to a polypeptide that comprises an amino acid sequence of an antibody and an amino acid sequence of a heterologous polypeptide or protein (e.g., a polypeptide or protein not normally a part of the antibody (e.g., a non-anti-PD- 1 antigen-binding antibody)).
  • a heterologous polypeptide or protein e.g., a polypeptide or protein not normally a part of the antibody (e.g., a non-anti-PD- 1 antigen-binding antibody)
  • fusion when used in relation to PD-1 or to an anti-PD- 1 antibody refers to the joining of a peptide or polypeptide, or fragment, variant, and/or derivative thereof, with a heterologous peptide or polypeptide.
  • the fusion protein retains the biological activity of the PD-1 or anti-PD-1 antibody.
  • the fusion protein comprises a PD-1 antibody VH region, VL region, VH CDR (one, two, or three VH CDRs), and/or VL CDR (one, two, or three VL CDRs), wherein the fusion protein binds to a PD-1 epitope, a PD-1 fragment, and/or a PD-1 polypeptide.
  • the term "heavy chain” when used in reference to an antibody refers to a polypeptide chain of about 50-70 kDa, wherein the amino-terminal portion includes a variable region of about 120 to 130 or more amino acids, and a carboxy-terminal portion includes a constant region.
  • the constant region can be one of five distinct types, (e.g., isotypes) referred to as alpha (a), delta ( ⁇ ), epsilon ( ⁇ ), gamma ( ⁇ ), and mu ( ⁇ ), based on the amino acid sequence of the heavy chain constant region.
  • the distinct heavy chains differ in size: ⁇ , ⁇ , and ⁇ contain approximately 450 amino acids, while ⁇ and ⁇ contain approximately 550 amino acids.
  • heavy chains When combined with a light chain, these distinct types of heavy chains give rise to five well known classes (e.g., isotypes) of antibodies, IgA, IgD, IgE, IgG, and IgM, respectively, including four subclasses of IgG, namely IgGl, IgG2, IgG3, and IgG4.
  • a heavy chain can be a human heavy chain.
  • the term "light chain” when used in reference to an antibody refers to a polypeptide chain of about 25 kDa, wherein the amino-terminal portion includes a variable region of about 100 to about 110 or more amino acids, and a carboxy-terminal portion includes a constant region.
  • the approximate length of a light chain is 211 to 217 amino acids.
  • Light chain amino acid sequences are well known in the art.
  • a light chain can be a human light chain.
  • the term "host” as used herein refers to an animal, such as a mammal (e.g., a human).
  • the term "host cell” as used herein refers to a particular subject cell that may be transfected with a nucleic acid molecule and the progeny or potential progeny of such a cell. Progeny of such a cell may not be identical to the parent cell transfected with the nucleic acid molecule due to mutations or environmental influences that may occur in succeeding generations or integration of the nucleic acid molecule into the host cell genome.
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, e.g., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts, and each monoclonal antibody will typically recognize a single epitope on the antigen.
  • a "monoclonal antibody,” as used herein is an antibody produced by a single hybridoma or other cell, wherein the antibody binds to only a PD-1 epitope as determined, for example, by ELIS A or other antigen-binding or competitive binding assay known in the art.
  • the term “monoclonal” is not limited to any particular method for making the antibody.
  • the monoclonal antibodies useful in the present disclosure may be prepared by the hybridoma methodology first described by Kohler et al, 1975, Nature 256:495, or may be made using recombinant DNA methods in bacterial or eukaryotic animal or plant cells (see, e.g., U.S. Pat. No. 4,816,567).
  • the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al, 1991, Nature 352:624- 28 and Marks et al, 1991, J. Mol. Biol. 222:581-97, for example.
  • Other methods for the preparation of clonal cell lines and of monoclonal antibodies expressed thereby are well known in the art. See, e.g., Short Protocols in Molecular Biology (Ausubel et al. eds., 5th ed. 2002). Exemplary methods of producing monoclonal antibodies are provided in the Examples herein.
  • nucleic acid molecules refers to those which are found in nature and not manipulated, modified, and/or changed ⁇ e.g., isolated, purified, selected) by a human being.
  • the antibodies provided herein can include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity ⁇ see U.S. Pat. No. 4,816,567; and Morrison et al, 1984, Proc. Natl. Acad. Sci. USA 81 :6851-55).
  • Humanized forms of nonhuman ⁇ e.g., murine antibodies are chimeric antibodies that include human immunoglobulins ⁇ e.g., recipient antibody) in which the native CDR residues are replaced by residues from the corresponding CDR of a nonhuman species ⁇ e.g., donor antibody) such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and capacity.
  • a nonhuman species e.g., donor antibody
  • one or more FR region residues of the human immunoglobulin are replaced by corresponding nonhuman residues.
  • humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • a humanized antibody heavy or light chain can comprise substantially all of at least one or more variable regions, in which all or substantially all of the CDRs correspond to those of a nonhuman immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • the humanized antibody will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • a "human antibody” is one that possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • Human antibodies can be produced using various techniques known in the art, including phage-display libraries (Hoogenboom and Winter, 1991, J. Mol. Biol. 227:381; Marks et al., 1991, J. Mol. Biol. 222:581) and yeast display libraries (Chao et al, 2006, Nature Protocols 1 : 755-68).
  • Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., mice ⁇ see, e.g., Jakobovits, 1995, Curr. Opin. Biotechnol.
  • a "CDR” refers to one of three hypervariable regions (HI, H2 or H3) within the non- framework region of the immunoglobulin (Ig or antibody) VH ⁇ -sheet framework, or one of three hypervariable regions (LI, L2 or L3) within the non-framework region of the antibody VL ⁇ -sheet framework. Accordingly, CDRs are variable region sequences interspersed within the framework region sequences. CDR regions are well known to those skilled in the art and have been defined by, for example, Kabat as the regions of most hypervariability within the antibody variable (V) domains (Kabat et al, 1997, J. Biol. Chem. 252:6609-16; Kabat, 1978, Adv. Prot. Chem.
  • CDR region sequences also have been defined structurally by Chothia as those residues that are not part of the conserved ⁇ -sheet framework, and thus are able to adapt different conformations (Chothia and Lesk, 1987, J. Mol. Biol. 196:901-17). Both terminologies are well recognized in the art. CDR region sequences have also been defined by AbM, Contact, and IMGT. The positions of CDRs within a canonical antibody variable region have been determined by comparison of numerous structures (Al-Lazikani et al., 1997, J. Mol. Biol.
  • hypervariable region when used herein refers to the regions of an antibody variable region that are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six hypervariable regions, three in the VH (HI, H2, H3) and three in the VL (LI, L2, L3).
  • a number of hypervariable region delineations are in use and are encompassed herein.
  • the Kabat Complementarity Determining Regions are based on sequence variability and are the most commonly used ⁇ see, e.g., Kabat et al, supra).
  • Chothia refers instead to the location of the structural loops ⁇ see, e.g., Chothia and Lesk, 1987, J. Mol. Biol. 196:901-17).
  • the end of the Chothia CDR-Hl loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35 A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
  • the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular' s AbM antibody modeling software ⁇ see, e.g., Antibody Engineering Vol. 2
  • the "contact" hypervariable regions are based on an analysis of the available complex crystal structures. The residues from each of these hypervariable regions or CDRs are noted below.
  • IMGT ImMunoGeneTics
  • IG immunoglobulins
  • TCR T cell receptors
  • MHC major histocompatibility complex
  • the CDRs are as defined by the IMGT numbering system. In other embodiments, the CDRs are as defined by the Kabat numbering system. In certain embodiments, the CDRs are as defined by the AbM numbering system. In other embodiments, the CDRs are as defined by the Chothia system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
  • Hypervariable regions may comprise "extended hypervariable regions” as follows: 24-36 or 24-34 (LI), 46-56 or 50-56 (L2), and 89-97 or 89-96 (L3) in the VL, and 26-35 or 26- 35A (HI), 50-65 or 49-65 (H2), and 93-102, 94-102, or 95-102 (H3) in the VH.
  • HVR extended hypervariable regions
  • CDR 95-102
  • variable region refers to a carboxy terminal portion of the light and heavy chain which is not directly involved in binding of the antibody to antigen but exhibits various effector function, such as interaction with the Fc receptor.
  • the term refers to the portion of an immunoglobulin molecule having a more conserved amino acid sequence relative to the other portion of the immunoglobulin, the variable region, which contains the antigen binding site.
  • the constant region may contain the CHI, CH2, and CH3 regions of the heavy chain and the CL region of the light chain.
  • framework or "FR” refers to those variable region residues flanking the CDRs. FR residues are present, for example, in chimeric, humanized, human, domain antibodies, diabodies, linear antibodies, and bispecific antibodies. FR residues are those variable domain residues other than the hypervariable region residues or CDR residues.
  • An "affinity matured" antibody is one with one or more alterations (e.g., amino acid sequence variations, including changes, additions, and/or deletions) in one or more HVRs thereof which result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s).
  • Affinity matured antibodies can have nanomolar or even picomolar affinities for the target antigen. Affinity matured antibodies are produced by procedures known in the art. For review, see Hudson and Souriau, 2003, Nature Medicine 9: 129-34; Hoogenboom, 2005, Nature Biotechnol. 23 : 1 105-16; Quiroz and Sinclair, 2010, Revista Ingeneria Biomedia 4:39-51.
  • blocking antibody or an “antagonist” antibody is one which inhibits or reduces biological activity of the antigen it binds.
  • blocking antibodies or antagonist antibodies may substantially or completely inhibit the biological activity of the antigen.
  • An "agonist” antibody is an antibody that triggers a response, e.g., one that mimics at least one of the functional activities of a polypeptide of interest (e.g., PD-L1).
  • An agonist antibody includes an antibody that is a ligand mimetic, for example, wherein a ligand binds to a cell surface receptor and the binding induces cell signaling or activities via an intercellular cell signaling pathway and wherein the antibody induces a similar cell signaling or activation.
  • An "agonist" of PD-1 refers to a molecule that is capable of activating or otherwise increasing one or more of the biological activities of PD-1, such as in a cell expressing PD-1.
  • an agonist of PD-1 may, for example, act by activating or otherwise increasing the activation and/or cell signaling pathways of a cell expressing a PD-1 protein, thereby increasing a PD-1 -mediated biological activity of the cell relative to the PD-1 -mediated biological activity in the absence of agonist.
  • the antibodies provided herein are agonistic anti-PD-1 antibodies, including antibodies that induce PD-1 signaling.
  • Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., a binding protein such as an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a binding molecule X for its binding partner Y can generally be represented by the dissociation constant (K D ). Affinity can be measured by common methods known in the art, including those described herein.
  • the "K D " or "K D value" may be measured by assays known in the art, for example by a binding assay.
  • the K D may be measured in a RIA, for example, performed with the Fab version of an antibody of interest and its antigen (Chen et al, 1999, J. Mol Biol 293 :865- 81).
  • the K D or K D value may also be measured by using surface plasmon resonance assays by Biacore ® , using, for example, a Biacore ® TM-2000 or a Biacore ® TM-3000, or by biolayer interferometry using, for example, the Octet ® QK384 system.
  • An "on-rate” or “rate of association” or “association rate” or “k on” may also be determined with the same surface plasmon resonance or biolayer interferometry techniques described above using, for example, a Biacore ® TM-2000 or a Biacore ® TM-3000, or the Octet ® QK384 system.
  • the phrase "substantially similar” or “substantially the same” denotes a sufficiently high degree of similarity between two numeric values ⁇ e.g., one associated with an antibody of the present disclosure and the other associated with a reference antibody) such that one of skill in the art would consider the difference between the two values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by the values ⁇ e.g., K D values).
  • the difference between the two values may be less than about 50%, less than about 40%, less than about 30%, less than about 20%, less than about 10%, or less than about 5%, as a function of the value for the reference antibody.
  • the phrase “substantially increased,” “substantially reduced,” or “substantially different,” as used herein, denotes a sufficiently high degree of difference between two numeric values ⁇ e.g., one associated with an antibody of the present disclosure and the other associated with a reference antibody) such that one of skill in the art would consider the difference between the two values to be of statistical significance within the context of the biological characteristic measured by the values. For example, the difference between said two values can be greater than about 10%, greater than about 20%, greater than about 30%, greater than about 40%, or greater than about 50%, as a function of the value for the reference antibody.
  • inhibitor refers to partial (such as, 1%, 2%, 5%, 10%, 20%, 25%, 50%, 75%, 90%, 95%, 99%) or complete (i.e., 100%) inhibition.
  • Antibody effector functions refer to the biological activities attributable to the Fc region (e.g., a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include but are not limited to: Clq binding; CDC; Fc receptor binding; ADCC; phagocytosis;
  • cell surface receptors e.g., B cell receptor
  • B cell activation downregulation of cell surface receptors (e.g., B cell receptor); and B cell activation.
  • T cell effector functions refer to the biological activities attributable to various types of T cells, including but not limited to cytotoxic T cells, T helper cells, regulatory T cells, and memory T cells. Examples of T cell effector functions include: increasing T cell proliferation, secreting cytokines, releasing cytotoxins, expressing membrane-associated molecules, killing target cells, activating macrophages, and activating B cells.
  • T cell exhaustion refers to a state of T cell dysfunction that arises during chronic infections, cancer, and other diseases, disorders, or conditions.
  • the T cell exhaustion includes, but is not limited to, poor T cell effector functions (e.g., reduced T cell proliferation or reduced cytokine production), sustained expression of inhibitory receptors (e.g., PD-1), and a
  • Fc region herein is used to define a C-terminal region of an
  • immunoglobulin heavy chain including, for example, native sequence Fc regions, recombinant Fc regions, and variant Fc regions.
  • the human IgG heavy chain Fc region is often defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl- terminus thereof.
  • the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody.
  • a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
  • a "functional Fc region” possesses an "effector function" of a native sequence Fc region.
  • exemplary “effector functions” include Clq binding; CDC; Fc receptor binding; ADCC; phagocytosis; downregulation of cell surface receptors (e.g., B cell receptor), etc.
  • effector functions generally require the Fc region to be combined with a binding region or binding domain ⁇ e.g., an antibody variable region or domain) and can be assessed using various assays as disclosed.
  • a “native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature, and not manipulated, modified, and/or changed ⁇ e.g., isolated, purified, selected, including or combining with other sequences such as variable region sequences) by a human.
  • Native sequence human IgGl Fc regions include a native sequence human IgGl Fc region (non-A and A allotypes); native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
  • a native human IgGl Fc region amino acid sequence is provided below:
  • a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification (e.g., substituting, addition, or deletion).
  • the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, for example, from about one to about ten amino acid substitutions, or from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of a parent polypeptide.
  • the variant Fc region herein can possess at least about 80% homology with a native sequence Fc region and/or with an Fc region of a parent polypeptide, or at least about 90% homology therewith, for example, at least about 95% homology therewith.
  • a variant with one amino acid K change to A at 322 position in the human IgGl Fc amino acid sequence, IgGl-K322A Fc region is provided below:
  • IgG4P Fc region An exemplary variant with one amino acid S change to P at 228 position in the human IgG4 Fc amino acid sequence, IgG4P Fc region, is provided below:
  • IgG4PE Fc region An exemplary variant with two amino acid changes at 228 and 235 positions in the human IgG4 Fc amino acid sequence, IgG4PE Fc region, is provided below:
  • variants when used in relation to PD-1 or to an anti-PD-1 antibody may refer to a peptide or polypeptide comprising one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) amino acid sequence substitutions, deletions, and/or additions as compared to a native or unmodified sequence.
  • a PD-1 variant may result from one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) changes to an amino acid sequence of a native PD-1.
  • a variant of an anti-PD-1 antibody may result from one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) changes to an amino acid sequence of a native or previously unmodified anti-PD-1 antibody.
  • Variants may be naturally occurring, such as allelic or splice variants, or may be artificially constructed.
  • Polypeptide variants may be prepared from the corresponding nucleic acid molecules encoding the variants.
  • the PD-1 variant or anti-PD-1 antibody variant at least retains PD-1 or anti-PD-1 antibody functional activity, respectively.
  • an anti-PD-1 antibody variant binds PD-1 and/or is antagonistic to PD-1 activity.
  • an anti-PD-1 antibody variant binds PD-1 and/or is agonistic to PD-1 activity.
  • the variant is encoded by a single nucleotide polymorphism (S P) variant of a nucleic acid molecule that encodes PD-1 or anti-PD-1 antibody VH or VL regions or subregions, such as one or more CDRs.
  • S P single nucleotide polymorphism
  • vector refers to a substance that is used to carry or include a nucleic acid sequence, including for example, a nucleic acid sequence encoding an anti-PD-1 antibody as described herein, in order to introduce a nucleic acid sequence into a host cell.
  • Vectors applicable for use include, for example, expression vectors, plasmids, phage vectors, viral vectors, episomes, and artificial chromosomes, which can include selection sequences or markers operable for stable integration into a host cell' s chromosome. Additionally, the vectors can include one or more selectable marker genes and appropriate expression control sequences.
  • Selection control sequences can include constitutive and inducible promoters, transcription enhancers, transcription terminators, and the like, which are well known in the art.
  • both nucleic acid molecules can be inserted, for example, into a single expression vector or in separate expression vectors.
  • the encoding nucleic acids can be operationally linked to one common expression control sequence or linked to different expression control sequences, such as one inducible promoter and one constitutive promoter.
  • nucleic acid molecules into a host cell can be confirmed using methods well known in the art. Such methods include, for example, nucleic acid analysis such as Northern blots or polymerase chain reaction (PCR) amplification of mRNA, immunoblotting for expression of gene products, or other suitable analytical methods to test the expression of an introduced nucleic acid sequence or its corresponding gene product. It is understood by those skilled in the art that the nucleic acid molecules are expressed in a sufficient amount to produce a desired product (e.g., an anti-PD-1 antibody as described herein), and it is further understood that expression levels can be optimized to obtain sufficient expression using methods well known in the art.
  • a desired product e.g., an anti-PD-1 antibody as described herein
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • FcRs Fc receptors
  • cytotoxic cells e.g., Natural Killer (NK) cells, neutrophils, and macrophages
  • NK cells the primary cells for mediating ADCC, express FcyRIII only, whereas monocytes express FcyRI, FcyRII, and FcyRIII. FcR expression on hematopoietic cells is known (see, e.g., Ravetch and Kinet, 1991, Annu. Rev. Immunol. 9:457- 92).
  • an in vitro ADCC assay see, e.g., US Pat. Nos. 5,500,362 and 5,821,337) can be performed.
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • ADCC activity of the molecule of interest may be assessed in vivo, for example, in an animal model (see, e.g., Clynes et al, 1998, Proc. Natl. Acad. Sci. USA 95:652-56). Antibodies with little or no ADCC activity may be selected for use.
  • ADCP antibody-dependent cellular phagocytosis
  • FcRs Fc receptors
  • phagocytotic cells e.g., neutrophils, monocytes, and macrophages
  • FcRs Fc receptors
  • an in vitro ADCP assay ⁇ see, e.g., Bracher et al, 2007, J. Immunol. Methods 323 : 160-71) can be performed.
  • phagocytotic cells for such assays include peripheral blood mononuclear cells (PBMC), purified monocytes from PBMC, or U937 cells differentiated to the mononuclear type.
  • PBMC peripheral blood mononuclear cells
  • ADCP activity of the molecule of interest may be assessed in vivo, for example, in an animal model ⁇ see, e.g., Wallace et al., 2001, J. Immunol. Methods 248: 167- 82).
  • Antibodies with little or no ADCP activity may be selected for use.
  • Fc receptor or "FcR” describes a receptor that binds to the Fc region of an antibody.
  • An exemplary FcR is a native sequence human FcR.
  • an exemplary FcR is one that binds an IgG antibody ⁇ e.g., a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • FcyRII receptors include FcyRIIA (an “activating receptor") and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof ⁇ see, e.g., Daeron, 1997, Annu. Rev. Immunol. 15:203-34).
  • FcRs are known ⁇ see, e.g., Ravetch and Kinet, 1991, Annu. Rev. Immunol. 9:457-92; Capel et al., 1994, Immunomethods 4:25-34; and de Haas et al, 1995, J. Lab. Clin. Med. 126:330-41).
  • FcR FcR
  • the term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus ⁇ see, e.g., Guyer et al, 1976, J. Immunol. 117:587-93; and Kim et al, 1994, Eu. J. Immunol. 24:2429-34).
  • Antibody variants with improved or diminished binding to FcRs have been described ⁇ see, e.g., WO 2000/42072; U.S. Pat. Nos. 7, 183,387; 7,332,581; and 7.335,742; Shields et al. 2001, J. Biol. Chem. 9(2):6591-604).
  • CDC complement dependent cytotoxicity
  • Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (Clq) to antibodies (of the appropriate subclass) which are bound to their cognate antigen.
  • Clq first component of the complement system
  • a CDC assay ⁇ see, e.g., Gazzano-Santoro et al, 1996, J. Immunol. Methods 202: 163) may be performed.
  • Polypeptide variants with altered Fc region amino acid sequences polypeptides with a variant Fc region
  • increased or decreased Clq binding capability have been described ⁇ see, e.g., US Pat. No. 6,194,551; WO 1999/51642; Idusogie et al, 2000, J. Immunol. 164: 4178-84).
  • a PD-1 polypeptide "extracellular domain” or “ECD” refers to a form of the
  • PD-1 polypeptide that is essentially free of the transmembrane and cytoplasmic domains.
  • a PD-1 polypeptide ECD may have less than 1% of such transmembrane and/or cytoplasmic domains and can have less than 0.5% of such domains.
  • identity refers to a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences.
  • Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
  • Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, or MEGALIGN (DNAStar, Inc.) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • a "modification" of an amino acid residue/position refers to a change of a primary amino acid sequence as compared to a starting amino acid sequence, wherein the change results from a sequence alteration involving said amino acid residue/position.
  • typical modifications include substitution of the residue with another amino acid (e.g., a conservative or non-conservative substitution), insertion of one or more (e.g., generally fewer than 5, 4, or 3) amino acids adjacent to said residue/position, and/or deletion of said residue/position.
  • An "epitope" is the site on the surface of an antigen molecule to which a single antibody molecule binds, such as a localized region on the surface of an antigen, such as a PD-1 polypeptide, a PD-1 polypeptide fragment, that is capable of being bound to one or more antigen binding regions of an antibody, and that has antigenic or immunogenic activity in an animal, such as a mammal (e.g., a human), that is capable of eliciting an immune response.
  • An epitope having immunogenic activity is a portion of a polypeptide that elicits an antibody response in an animal.
  • An epitope having antigenic activity is a portion of a polypeptide to which an antibody binds as determined by any method well known in the art, including, for example, by an immunoassay.
  • Antigenic epitopes need not necessarily be immunogenic. Epitopes often consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and have specific three dimensional structural characteristics as well as specific charge
  • Antibody epitopes may be linear epitopes or conformational epitopes.
  • Linear epitopes are formed by a continuous sequence of amino acids in a protein.
  • Conformational epitopes are formed of amino acids that are discontinuous in the protein sequence, but which are brought together upon folding of the protein into its three-dimensional structure.
  • Induced epitopes are formed when the three dimensional structure of the protein is in an altered conformation, such as following activation or binding of another protein or ligand.
  • a PD-1 epitope is a three-dimensional surface feature of a PD-1 polypeptide.
  • a PD-1 epitope is linear feature of a PD-1 polypeptide.
  • an antigen has several or many different epitopes and may react with many different antibodies.
  • An antibody binds "an epitope,” “essentially the same epitope,” or “the same epitope” as a reference antibody, when the two antibodies recognize identical, overlapping, or adjacent epitopes in a three-dimensional space.
  • the most widely used and rapid methods for determining whether two antibodies bind to identical, overlapping, or adjacent epitopes in a three- dimensional space are competition assays, which can be configured in a number of different formats, for example, using either labeled antigen or labeled antibody.
  • the antigen is immobilized on a 96-well plate, or expressed on a cell surface, and the ability of unlabeled antibodies to block the binding of labeled antibodies is measured using radioactive, fluorescent, or enzyme labels.
  • Epitope mapping is the process of identifying the binding sites, or epitopes, of antibodies on their target antigens.
  • Epitope binning is the process of grouping antibodies based on the epitopes they recognize. More particularly, epitope binning comprises methods and systems for discriminating the epitope recognition properties of different antibodies, using competition assays combined with computational processes for clustering antibodies based on their epitope recognition properties and identifying antibodies having distinct binding specificities.
  • a "PD-1 -mediated disease,” “PD-1 -mediated disorder,” and “PD-1 -mediated condition” are used interchangeably and refer to any disease, disorder, or condition that is completely or partially caused by or is the result of PD-1 signaling and/or alternatively any disease, disorder, or condition in which it is desirable to mimic or augment PD-1 signaling (e.g., in vitro or in vivo effects).
  • an "effective amount” is generally an amount sufficient to reduce the severity and/or frequency of symptoms, eliminate the symptoms and/or underlying cause, prevent the occurrence of symptoms and/or their underlying cause, and/or improve or remediate the damage that results from or is associated with a disease, disorder, or condition, including, for example, rheumatoid arthritis, psoriasis, Crohn's disease, multiple sclerosis, atopic dermatitis, lupus, or Sjogren's syndrome.
  • the effective amount is a therapeutically effective amount or a prophylactically effective amount.
  • terapéuticaally effective amount refers to the amount of an agent (e.g., an antibody provided herein or any other agent described herein) that is sufficient to reduce and/or ameliorate the severity and/or duration of a given disease, disorder, or condition, and/or a symptom related thereto (e.g., rheumatoid arthritis, psoriasis, Crohn's disease, multiple sclerosis, atopic dermatitis, lupus, or Sjogren's syndrome).
  • an agent e.g., an antibody provided herein or any other agent described herein
  • a “therapeutically effective amount” of a substance/molecule/agent of the present disclosure may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the substance/molecule/agent to elicit a desired response in the individual.
  • a therapeutically effective amount encompasses an amount in which any toxic or detrimental effects of the substance/molecule/agent are outweighed by the therapeutically beneficial effects.
  • the term "therapeutically effective amount” refers to an amount of an antibody or other agent (e.g., drug) effective to "treat" a disease, disorder, or condition, in a subject or mammal.
  • a "prophylactically effective amount” is an amount of a pharmaceutical composition that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing, delaying, or reducing the likelihood of the onset (or reoccurrence) of a disease, disorder, condition, or associated symptom(s) (e.g., rheumatoid arthritis, psoriasis, Crohn's disease, multiple sclerosis, lupus, or Sjogren's syndrome).
  • a prophylactically effective amount may be less than a therapeutically effective amount.
  • the full therapeutic or prophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses. Thus, a therapeutically or prophylactically effective amount may be administered in one or more administrations.
  • Chronic administration refers to administration of the agent(s) in a continuous mode (e.g., for a period of time such as days, weeks, months, or years) as opposed to an acute mode, so as to maintain the initial therapeutic effect (activity) for an extended period of time.
  • Intermittent administration is treatment that is not consecutively done without interruption, but rather is cyclic in nature.
  • Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
  • physiologically acceptable carriers include buffers, such as phosphate, citrate, and other organic acids; antioxidants, including ascorbic acid; low molecular weight (e.g., fewer than about 10 amino acid residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers, such as polyvinylpyrrolidone; amino acids, such as glycine, glutamine, asparagine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates, including glucose, mannose, or dextrins; chelating agents, such as EDTA; sugar alcohols, such as mannitol or sorbitol; salt-forming counterions, such as sodium; and/or nonionic surfactants, such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM.
  • buffers such as phosphate, citrate, and other organic acids
  • antioxidants including ascorbic acid
  • carrier can also refer to a diluent, adjuvant (e.g., Freund's adjuvant (complete or incomplete)), excipient, or vehicle.
  • adjuvant e.g., Freund's adjuvant (complete or incomplete)
  • excipient or vehicle.
  • Such carriers, including pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil, and the like. Water is an exemplary carrier when a composition (e.g., a pharmaceutical composition) is administered intravenously.
  • Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • Suitable excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol, and the like.
  • the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
  • compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations, and the like.
  • Oral compositions, including formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in Remington and Gennaro, Remington's Pharmaceutical Sciences (18th ed. 1990).
  • Compositions, including pharmaceutical compounds may contain an anti-PD-1 antibody, for example, in isolated or purified form, together with a suitable amount of carriers.
  • pharmaceutically acceptable means being approved by a regulatory agency of the Federal or a state government, or listed in United States Pharmacopeia, European Pharmacopeia, or other generally recognized Pharmacopeia for use in animals, and more particularly in humans.
  • Polyclonal antibodies refer to an antibody population generated in an immunogenic response to a protein having many epitopes and thus includes a variety of different antibodies directed to the same or different epitopes within the protein. Methods for producing polyclonal antibodies are known in the art ⁇ See, e.g., Short Protocols in Molecular Biology
  • an "isolated nucleic acid” is a nucleic acid, for example, an RNA, DNA, or a mixed nucleic acids, which is substantially separated from other genome DNA sequences as well as proteins or complexes such as ribosomes and polymerases, which naturally accompany a native sequence.
  • An "isolated" nucleic acid molecule is one which is separated from other nucleic acid molecules which are present in the natural source of the nucleic acid molecule.
  • an "isolated" nucleic acid molecule, such as a cDNA molecule can be substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized.
  • nucleic acid molecules encoding an antibody as described herein are isolated or purified.
  • the term embraces nucleic acid sequences that have been removed from their naturally occurring environment, and includes recombinant or cloned DNA isolates and chemically synthesized analogues or analogues biologically synthesized by heterologous systems.
  • a substantially pure molecule may include isolated forms of the molecule.
  • Polynucleotide or “nucleic acid,” as used interchangeably herein, refers to polymers of nucleotides of any length and includes DNA and RNA.
  • the nucleotides can be
  • a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs.
  • Oligonucleotide refers to short, generally single-stranded, synthetic polynucleotides that are generally, but not necessarily, fewer than about 200 nucleotides in length.
  • oligonucleotide and “polynucleotide” are not mutually exclusive.
  • a cell that produces an anti-PD-1 antibody of the present disclosure may include a parent hybridoma cell, as well as bacterial and eukaryotic host cells into which nucleic acids encoding the antibodies have been introduced. Suitable host cells are disclosed below.
  • the left-hand end of any single-stranded polynucleotide sequence disclosed herein is the 5' end; the left-hand direction of double-stranded polynucleotide sequences is referred to as the 5' direction.
  • the direction of 5' to 3 ' addition of nascent RNA transcripts is referred to as the transcription direction; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 5 ' to the 5' end of the RNA transcript are referred to as "upstream sequences"; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 3 ' to the 3 ' end of the RNA transcript are referred to as "downstream sequences.”
  • prevent refers to reducing the likelihood of the onset (or recurrence) of a disease, disorder, condition, or associated symptom(s) (e.g., rheumatoid arthritis, psoriasis, Crohn's disease, multiple sclerosis, lupus, or Sjogren' s syndrome).
  • a disease, disorder, condition, or associated symptom(s) e.g., rheumatoid arthritis, psoriasis, Crohn's disease, multiple sclerosis, lupus, or Sjogren' s syndrome.
  • prophylactic agent refers to any agent that can totally or partially inhibit the development, recurrence, onset, or spread of a PD-l-mediated disease and/or symptom related thereto in a subject.
  • prophylactic agent refers to an anti-PD-1 antibody as described herein.
  • a "prophylactically effective serum titer” is the serum titer of a PD-1 antibody, e.g., a PD-1 antibody as described herein, in a subject (e.g., a human), that totally or partially inhibits the development, recurrence, onset, or spread of a PD-l -mediated disease, disorder, or condition, and/or symptom related thereto in the subject.
  • a "therapeutically effective serum titer” is the serum titer of a PD-1 antibody, e.g., a PD-1 antibody as described herein, in a subject (e.g., a human), that reduces the severity, the duration, and/or the symptoms associated with a PD-l-mediated disease, disorder, or condition, in the subject.
  • recombinant antibody refers to an antibody that is prepared, expressed, created, or isolated by recombinant means.
  • Recombinant antibodies can be antibodies expressed using a recombinant expression vector transfected into a host cell, antibodies isolated from a recombinant, combinatorial antibody library, antibodies isolated from an animal (e.g., a mouse or cow) that is transgenic and/or transchromosomal for human immunoglobulin genes (see, e.g., Taylor et al, 1992, Nucl. Acids Res. 20:6287-95), or antibodies prepared, expressed, created, or isolated by any other means that involves splicing of immunoglobulin gene sequences to other DNA sequences.
  • Such recombinant antibodies can have variable and constant regions, including those derived from human germline immunoglobulin sequences (See Kabat et al, supra). In certain embodiments, however, such recombinant antibodies may be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis), thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
  • serum titer refers to an average serum titer in a subject from multiple samples (e.g., at multiple time points) or in a population of at least 10, at least 20, at least 40 subjects, up to about 100, 1000, or more.
  • side effects encompasses unwanted and/or adverse effects of a therapy (e.g., a prophylactic or therapeutic agent). Unwanted effects are not necessarily adverse. An adverse effect from a therapy (e.g., a prophylactic or therapeutic agent) might be harmful, uncomfortable, or risky.
  • a therapy e.g., a prophylactic or therapeutic agent
  • side effects include, diarrhea, cough, gastroenteritis, wheezing, nausea, vomiting, anorexia, abdominal cramping, fever, pain, loss of body weight, dehydration, alopecia, dyspenea, insomnia, dizziness, mucositis, nerve and muscle effects, fatigue, dry mouth, loss of appetite, rashes or swellings at the site of administration, flu-like symptoms such as fever, chills, and fatigue, digestive tract problems, and allergic reactions. Additional undesired effects experienced by patients are numerous and known in the art. Many are described in Physician's Desk Reference (68th ed. 2014).
  • a subject is a mammal, such as a non-primate (e.g., cow, pig, horse, cat, dog, rat, etc.) or a primate ⁇ e.g., monkey and human).
  • the subject is a human.
  • the subject is a mammal ⁇ e.g., a human) having a PD-l-mediated disease, disorder, or condition.
  • the subject is a mammal ⁇ e.g., a human) at risk of developing a PD-l-mediated disease, disorder, or condition.
  • substantially all refers to at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or about 100%.
  • a therapeutic agent refers to any agent that can be used in treating, preventing, or alleviating a disease, disorder, or condition, including in the treatment, prevention, or alleviation of one or more symptoms of a PD-l-mediated disease, disorder, or condition and/or a symptom related thereto.
  • a therapeutic agent refers to an anti- PD-1 antibody as described herein.
  • the term "therapy” refers to any protocol, method, and/or agent that can be used in the prevention, management, treatment, and/or amelioration of a PD-l-mediated disease, disorder, or condition.
  • the terms “therapies” and “therapy” refer to a biological therapy, supportive therapy, and/or other therapies useful in the prevention, management, treatment, and/or amelioration of a PD-l-mediated disease, disorder, or condition, known to one of skill in the art such as medical personnel.
  • detectable probe refers to a composition that provides a detectable signal.
  • the term includes, without limitation, any fluorophore, chromophore, radiolabel, enzyme, antibody or antibody fragment, and the like, that provide a detectable signal via its activity.
  • detectable agent refers to a substance that can be used to ascertain the existence or presence of a desired molecule, such as an anti-PD-1 antibody as described herein, in a sample or subject.
  • a detectable agent can be a substance that is capable of being visualized or a substance that is otherwise able to be determined and/or measured ⁇ e.g., by quantitation).
  • a diagnostic agent refers to a substance administered to a subject that aids in the diagnosis of a disease, disorder, or condition. Such substances can be used to reveal, pinpoint, and/or define the localization of a disease causing process.
  • a diagnostic agent includes a substance that is conjugated to an anti-PD-1 antibody as described herein, that when administered to a subject or contacted with a sample from a subject aids in the diagnosis of a PD-l-mediated disease.
  • nucleic acid or grammatical equivalents thereof as it is used in reference to nucleic acid molecule refers to a nucleic acid molecule in its native state or when manipulated by methods well known to those skilled in the art that can be transcribed to produce mRNA, which is then translated into a polypeptide and/or a fragment thereof.
  • the antisense strand is the complement of such a nucleic acid molecule, and the encoding sequence can be deduced therefrom.
  • excipient refers to an inert substance which is commonly used as a diluent, vehicle, preservative, binder, or stabilizing agent, and includes, but is not limited to, proteins (e.g., serum albumin, etc.), amino acids (e.g., aspartic acid, glutamic acid, lysine, arginine, glycine, histidine, etc.), fatty acids and phospholipids (e.g., alkyl sulfonates, caprylate, etc.), surfactants (e.g., SDS, polysorbate, nonionic surfactant, etc.), saccharides (e.g., sucrose, maltose, trehalose, etc.), and polyols (e.g., mannitol, sorbitol, etc.). See, also, Remington and Gennaro, Remington's Pharmaceutical Sciences (18th ed. 1990), which is hereby incorporated by reference in its entirety.
  • proteins e.g
  • fragment refers to a peptide or polypeptide that comprises less than the full length amino acid sequence. Such a fragment may arise, for example, from a truncation at the amino terminus, a truncation at the carboxy terminus, and/or an internal deletion of a residue(s) from the amino acid sequence. Fragments may, for example, result from alternative RNA splicing or from in vivo protease activity.
  • PD-1 fragments or anti-PD-1 antibody fragments include polypeptides comprising an amino acid sequence of at least 5 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 30 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least 80 contiguous amino acid residues, at least 90 contiguous amino acid residues, at least contiguous 100 amino acid residues, at least 125 contiguous amino acid residues, at least 150 contiguous amino acid residues, at least 175 contiguous amino acid residues, at least 200 contiguous amino acid residues, at least 250, at least 300, at least 350, at least 400, at least 450, at least 500, at least 550, at least 600, at least
  • a subject derives from a therapy (e.g., a prophylactic or therapeutic agent), which does not result in a cure of the disease.
  • a subject is administered one or more therapies (e.g., prophylactic or therapeutic agents, such as an antibody provided herein) to "manage” a PD-1 -mediated disease, one or more symptoms thereof, so as to prevent the progression or worsening of the disease.
  • therapies e.g., prophylactic or therapeutic agents, such as an antibody provided herein
  • administering refers to the act of injecting or otherwise physically delivering a substance as it exists outside the body (e.g., an anti-PD-1 antibody as described herein) into a patient, such as by mucosal, intradermal, intravenous, intramuscular delivery, and/or any other method of physical delivery described herein or known in the art.
  • a disease, disorder, condition, or a symptom thereof is being treated, administration of the substance typically occurs after the onset of the disease, disorder, condition, or symptoms thereof.
  • administration of the substance typically occurs before the onset of the disease, disorder, condition, or symptoms thereof.
  • analog refers to a polypeptide that possesses a similar or identical function as a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody but does not necessarily comprise a similar or identical amino acid sequence of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody, or possess a similar or identical structure of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody.
  • a polypeptide that has a similar amino acid sequence refers to a polypeptide that satisfies at least one of the followings: (a) a polypeptide having an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%), at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody provided herein; (b) a polypeptide encoded by a nucleotide sequence that hybridizes under stringent conditions to a nucleotide sequence encoding a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody (or VH or VL region thereof) described herein at least 5 amino acid residues, at least 10 amino acid residues
  • a polypeptide with similar structure to a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody provided herein refers to a polypeptide that has a similar secondary, tertiary, or quaternary structure of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody provided herein.
  • the structure of a polypeptide can be determined by methods known to those skilled in the art, including but not limited to, X-ray crystallography, nuclear magnetic resonance, and crystallographic electron microscopy.
  • the term “derivative” as used herein refers to a polypeptide that comprises an amino acid sequence of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an antibody that binds to a PD-1 polypeptide which has been altered by the introduction of amino acid residue substitutions, deletions, or additions.
  • the term “derivative” as used herein also refers to a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an antibody that binds to a PD-1 polypeptide which has been chemically modified, e.g., by the covalent attachment of any type of molecule to the polypeptide.
  • a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody may be chemically modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, chemical cleavage, formulation, metabolic synthesis of tunicamycin, linkage to a cellular ligand or other protein, etc.
  • the derivatives are modified in a manner that is different from naturally occurring or starting peptide or polypeptides, either in the type or location of the molecules attached.
  • Derivatives further include deletion of one or more chemical groups which are naturally present on the peptide or polypeptide.
  • a derivative of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody may contain one or more non-classical amino acids.
  • a polypeptide derivative possesses a similar or identical function as a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody provided herein.
  • composition is intended to encompass a product containing the specified ingredients ⁇ e.g., an antibody provided herein) in, optionally, the specified amounts.
  • kits for managing, preventing, or treating an immune disorder in a subject comprising administering to a subject a therapeutically effective amount of an antibody that binds to a PD-1 polypeptide, a PD-1 polypeptide fragment, a PD-1 peptide, or a PD-1 epitope.
  • the antibodies provided herein bind to human and/or cyno PD-1. In one embodiment, the PD-1 antibodies bind to human PD-1. In one embodiment, the PD-1 antibodies bind to cyno PD-1. In one embodiment, the PD-1 antibodies bind to both human PD-1 and cyno PD-1. In other embodiments, the antibodies provided herein do not bind to rodent PD-1.
  • the anti-PD-1 antibodies bind to the extracellular domain (ECD) of PD-1. In certain embodiments, the anti-PD-1 antibodies bind to an epitope in the ECD of PD-1, which is distinct from the PD-L1 binding site. In certain embodiments, the anti-PD-1 antibodies bind to an epitope in the ECD of PD-1, which is distinct from the PD-L2 biding site. In certain embodiments, the anti-PD-1 antibodies bind to an epitope in the ECD of PD-1, which is distinct from both the PD-L1 and PD-L2 -binding site.
  • ECD extracellular domain
  • the antibodies competitively block an anti- PD-1 antibody provided herein from binding to a PD-1 polypeptide.
  • the antibodies compete for binding to a PD-1 polypeptide with an anti-PD-1 antibody provided herein.
  • the anti-PD-1 antibodies do not block the binding of PD-L1 to a PD-1 polypeptide.
  • the anti-PD-1 antibodies do not block the binding of PD-L2 to a PD-1 polypeptide.
  • the anti-PD-1 antibodies do not block the binding of PD-L1 or PD-L2 to a PD-1 polypeptide.
  • the anti-PD-1 antibodies do not compete with PD-L1 for binding to a PD-1 polypeptide. In some embodiments, the anti-PD-1 antibodies do not compete with PD-L2 for binding to a PD-1 polypeptide. In some embodiments, the anti-PD-1 antibodies do not compete with PD-L1 or PD-L2 for binding to a PD-1 polypeptide.
  • binding of PD-L1 to PD-1 is not inhibited by the antibody. In other embodiments, binding of PD-L2 to PD-1 is not inhibited by the antibody. In specific embodiments, neither binding of PD-L1 to PD-1 nor binding of PD-L2 to PD-1 is inhibited by the antibody.
  • anti-PD-1 antibodies provided herein can also be conjugated or recombinantly fused, e.g., to a diagnostic agent or detectable agent. Further provided are compositions comprising an anti-PD-1 antibody.
  • the present disclosure provides anti-PD-1 antibodies that may find use herein as therapeutic agents.
  • the present disclosure provides anti-PD-1 antibodies that may find use herein as diagnostic agents.
  • Exemplary antibodies include polyclonal, monoclonal, humanized, human, bispecific, and heteroconjugate antibodies, as well as variants thereof having improved affinity or other properties.
  • antibodies that bind to PD-1 including a PD-1 polypeptide, a PD-1 polypeptide fragment, a PD-1 peptide, or a PD-1 epitope.
  • the antibodies provided herein bind to human and/or cyno PD-1.
  • the antibodies provided herein do not bind to rodent PD-1 (e.g., a mouse PD-1).
  • rodent PD-1 e.g., a mouse PD-1
  • an antibody provided herein binds to human PD-1.
  • an antibody provided herein binds to cyno PD-1.
  • an antibody provided herein binds to human PD-1 and cyno PD-1.
  • an antibody provided herein binds to human PD-1 and does not bind to a rodent PD-1 (e.g., a mouse PD-1). In some embodiments, an antibody provided herein binds to cyno PD-1 and does not bind to a rodent PD- 1 (e.g., a mouse PD-1). In some embodiments, an antibody provided herein binds to human PD- 1, binds to a cyno PD-1, and does not bind to a rodent PD-1 (e.g., a mouse PD-1). In some embodiments, the anti-PD-1 antibodies do not block the binding of PD-L1 to a PD-1
  • the anti-PD-1 antibodies do not block the binding of PD-L2 to a PD-1 polypeptide. In some embodiments, the anti-PD-1 antibodies do not block the binding of PD-L1 or PD-L2 to a PD-1 polypeptide. In other embodiments, the anti-PD-1 antibodies are humanized antibodies (e.g., comprising human constant regions) that bind PD-1, including a PD- 1 polypeptide, a PD-1 polypeptide fragment, a PD-1 peptide, or a PD-1 epitope.
  • the anti-PD-1 antibody comprises a VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 of any one of the murine monoclonal antibodies provided herein.
  • the VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 is as defined by the EVIGT numbering system.
  • the VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 is as defined by the Kabat numbering system.
  • the VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 is as defined by the AbM numbering system. In other embodiments, the VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 is as defined by the Chothia system. In yet other embodiments, the VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 is as defined by the Contact numbering system.
  • the isolated antibody or functional fragment thereof provided herein comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from: (a) the antibody PDl AB-1, (b) the antibody PDl AB-2, (c) the antibody PDl AB-3, (d) the antibody PDl AB-4, (e) the antibody PDl AB-5, or (f) the antibody PDlAB-6, as shown in Tables 1-2.
  • an antibody provided herein comprises or consists of six CDRs, for example, VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 identified in Tables 1-2.
  • an antibody provided herein can comprise fewer than six CDRs.
  • the antibody comprises or consists of one, two, three, four, or five CDRs selected from the group consisting of VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 identified in Tables 1-2.
  • the antibody comprises or consists of one, two, three, four, or five CDRs selected from the group consisting of VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 of the monoclonal antibody selected from the group consisting of: (a) the antibody PD1 AB-1, (b) the antibody PD1 AB-2, (c) the antibody PD1 AB-3, (d) the antibody PD1 AB-4, (e) the antibody PD1AB-5, and (f) the antibody PD1AB-6, described herein. Accordingly, in some embodiments, VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 of the monoclonal antibody selected from the group consisting of: (a) the antibody PD1 AB-1, (b) the antibody PD1 AB-2, (c) the antibody PD1 AB-3, (d) the antibody PD1
  • the antibody comprises or consists of one, two, three, four, or five CDRs of anyone of the VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 identified in Tables 1-2.
  • the antibodies provided herein comprise one or more (e.g., one, two, or three) VH CDRs listed in Table 2. In other embodiments, the antibodies provided herein comprise one or more (e.g., one, two, or three) VL CDRs listed in Table 1. In yet other embodiments, the antibodies provided herein comprise one or more (e.g., one, two, or three) VH CDRs listed in Table 2 and one or more VL CDRs listed in Table 1. Accordingly, in some embodiments, the antibodies comprise a VH CDRl having an amino acid sequence of SEQ ID NO:4. In some embodiments, the antibodies comprise a VH CDR2 having an amino acid sequence of SEQ ID NO:5.
  • the antibodies comprise a VH CDR3 having an amino acid sequence of SEQ ID NO:6. In some embodiments, the antibodies comprise a VH CDRl and/or a VH CDR2 and/or a VH CDR3 independently selected from any one of the VH CDRl, VH CDR2, VH CDR3 amino acid sequence(s) as depicted in Table 2. In some embodiments, the antibodies comprise a VL CDRl having an amino acid sequence of any one of SEQ ID NOS: 1 and 7. In another embodiment, the antibodies comprise a VL CDR2 having an amino acid sequence of SEQ ID NO:2. In some embodiments, the antibodies comprise a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • the antibodies comprise a VL CDRl and/or a VL CDR2 and/or a VL CDR3 independently selected from any one of the VL CDRl, VL CDR2, VL CDR3 amino acid sequences as depicted in Table 1.
  • the antibodies provided herein comprise a VH region comprising: (1) a VH CDRl having an amino acid sequence of SEQ ID NO:4; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO:5; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO:6; and a VL region comprising: (1) a VL CDRl having an amino acid sequence of SEQ ID NO: 1; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • the antibodies provided herein comprise a VH region comprising: (1) a VH CDRl having an amino acid sequence of SEQ ID NO:4; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO:5; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO:6; and a VL region comprising: (1) a VL CDRl having an amino acid of SEQ ID NOS:7; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • the antibodies provided herein comprise a VH region comprising: (1) a VH CDRl having an amino acid sequence of SEQ ID NO:4; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO:5; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO:6.
  • the antibodies provided herein comprise a VL region comprising: (1) a VL CDRl having an amino acid sequence of SEQ ID NO: 1; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • the antibodies provided herein comprise a VL region comprising: (1) a VL CDRl having an amino acid sequence of SEQ ID NOS: 7; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • antibodies comprising one or more (e.g., one, two, or three) VH CDRs and one or more (e.g., one, two, or three) VL CDRs listed in Tables 1-2.
  • an antibody comprising a VH CDRl (SEQ ID NO:4) and a VL CDRl (SEQ ID NOS: 1 or 7).
  • the antibody comprises a VH CDRl (SEQ ID NO:4) and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDRl (SEQ ID NO:4) and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5) and a VL CDRl (SEQ ID NOS: 1 or 7). In some embodiments, the antibody comprises a VH CDR2 (SEQ ID NO:5) and a VL CDR2 (SEQ ID NO:2). In one embodiment, the antibody comprises a VH CDR2 (SEQ ID NO:5) and a VL CDR3 (SEQ ID NO:3). In another embodiment, the antibody comprises a VH CDR3 (SEQ ID NO:6) and a VL CDRl (SEQ ID NOS: 1 or 7). In other embodiments, the antibody comprises a VH CDR3 (SEQ ID NO:6) and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDR3 (SEQ ID NO:6) and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), and a VL CDRl (SEQ ID NOS: 1 or 7).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), and a VL CDR3 (SEQ ID NOS:3).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDRl (SEQ ID NOS: 1 or 7).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), and a VL CDRl (SEQ ID NOS: 1 or 7).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDR3 (SEQ ID NO:6), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDRl (SEQ ID NOS: 1 or 7).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: l or 7), and a VL CDR3 (SEQ ID NO:3).
  • VH CDRl SEQ ID NO:4
  • VH CDR2 SEQ ID NO:5
  • VL CDRl SEQ ID NOS: l or 7
  • VL CDR3 SEQ ID NO:3
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: 1 or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDRl (SEQ ID NO:4), a VL CDRl (SEQ ID NOS: 1 or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: 1 or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • the antibody comprises any combination thereof of the VH CDRs and VL CDRs listed in Tables 1-2.
  • the CDRs disclosed herein include consensus sequences derived from groups of related antibodies (see, e.g., Tables 1-2).
  • a "consensus sequence” refers to amino acid sequences having conserved amino acids common among a number of sequences and variable amino acids that vary within a given amino acid sequences.
  • the isolated antibody or functional fragment thereof provided herein further comprises one, two, three, and/or four heavy chain FRs and/or one, two, three, and/or four light chain FRs from: (a) the antibody PDlAB-1, (b) the antibody PDl AB-2, (c) the antibody PDl AB-3, (d) the antibody PDl AB-4, (e) the antibody PDl AB-5, or (f) the antibody PDlAB-6, as shown in Tables 3-4.
  • VH FR1 VH FR2 VH FR3 VH FR4 (SEQ ID NO:) (SEQ ID NO:) (SEQ ID NO:) (SEQ ID NO:)
  • the isolated antibody or functional fragment thereof provided herein further comprises one, two, three, and/or four heavy chain FRs from: (a) the antibody PDlAB-1, (b) the antibody PDl AB-2, (c) the antibody PDl AB-3, (d) the antibody PDl AB-4, (e) the antibody PDl AB-5, or (f) the antibody PDl AB-6, as shown in Table 4.
  • the antibody PDlAB-1 the antibody PDlAB-2
  • the antibody PDl AB-3 the antibody PDl AB-3
  • the antibody PDl AB-4 the antibody PDl AB-5
  • the antibody PDl AB-6 as shown in Table 4.
  • the antibody heavy chain FR(s) is from the antibody PDlAB-1. In some embodiments, the antibody heavy chain FR(s) is from the antibody PDl AB-2. In other embodiments, the antibody heavy chain FR(s) is from the antibody PD1AB-3. In certain embodiments, the antibody heavy chain FR(s) is from the antibody PDl AB-4. In other embodiments, the antibody heavy chain FR(s) is from the antibody PDl AB-5. In another embodiment, the antibody heavy chain FR(s) is from the antibody PDl AB-6.
  • the isolated antibody or functional fragment thereof provided herein further comprises one, two, three, and/or four light chain FRs from: (a) the antibody PDl AB-1, (b) the antibody PDl AB-2, (c) the antibody PDl AB-3, (d) the antibody PDl AB-4, (e) the antibody PDl AB-5, or (f) the antibody PDl AB-6, as shown in Table 3.
  • the antibody PDl AB-1 the antibody PDl AB-1
  • the antibody PDl AB-2 the antibody PDl AB-2
  • the antibody PDl AB-3 the antibody PDl AB-3
  • the antibody PDl AB-4 the antibody PDl AB-5
  • the antibody PDl AB-6 as shown in Table 3.
  • the antibody light chain FR(s) is from the antibody PDl AB-1. In some embodiments, the antibody light chain FR(s) is from the antibody PDlAB-2. In other embodiments, the antibody light chain FR(s) is from the antibody PDlAB-3. In certain embodiments, the antibody light chain FR(s) is from the antibody PDlAB-4. In other embodiments, the antibody light chain FR(s) is from the antibody PD1AB-5. In another embodiment, the antibody light chain FR(s) is from the antibody PD1 AB-6.
  • an antibody of fragment thereof described herein comprises a VH region that comprises: (1) a VH FRl having an amino acid sequence selected from the group consisting of SEQ ID NOS: 19 and 24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS:21 and 23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22.
  • an antibody of fragment thereof described herein comprises a VH region that comprises: (1) a VH FRl having an amino acid of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22.
  • an antibody of fragment thereof described herein comprises a VH region that comprises: (1) a VH FRl having an amino acid sequence of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO: 23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22.
  • an antibody of fragment thereof described herein comprises a VH region that comprises: (1) a VH FRl having an amino acid sequence of SEQ ID NO: 24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22.
  • an antibody of fragment thereof described herein comprises a VH region that comprises: (1) a VH FRl having an amino acid sequence of SEQ ID NO:24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO: 23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22.
  • the antibody comprises a VH region comprising all four of the above- referenced VH FRl, VH FR2, VH FR3, and VH FR4.
  • the humanized antibody comprises a VH region that includes a VH FRl having an amino acid sequence selected from the group consisting of SEQ ID NOS: 19 and 24. In one embodiment, the humanized antibody comprises a VH region that includes a VH FRl having an amino acid sequence of SEQ ID NO: 19. In one embodiment, the humanized antibody comprises a VH region that includes a VH FRl having an amino acid sequence of SEQ ID NO:24. In some embodiments, the humanized antibody comprises a VH region that includes a VH FR2 having an amino acid sequence of SEQ ID NO: 20.
  • the humanized antibody comprises a VH region that includes a VH FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS:21 and 23. In one embodiment, the humanized antibody comprises a VH region that includes a VH FR3 having an amino acid sequence of SEQ ID NO:21. In one embodiment, the humanized antibody comprises a VH region that includes a VH FR3 having an amino acid sequence of SEQ ID NO:23. In other embodiments, the humanized antibody comprises a VH region that includes a VH FR4 having an amino acid sequence of SEQ ID NO:22.
  • an antibody of fragment thereof described herein comprises a VL region that comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS: 16 and 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NOS: 16; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the VL region that comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the humanized antibody comprises a VL region that includes a VL FR1 having an amino acid sequence of SEQ ID NO: 14.
  • the humanized antibody comprises a VL region that includes a VL FR2 having an amino acid sequence of SEQ ID NO: 15. In other embodiments, the humanized antibody comprises a VL region that includes a VL FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS: 16 and 18. In one embodiment, the humanized antibody comprises a VL region that includes a VL FR3 having an amino acid sequence of SEQ ID NOS: 16. In other embodiments, the humanized antibody comprises a VL region that includes a VL FR3 having an amino acid sequence of SEQ ID NO: 18. In yet other embodiments, the humanized antibody comprises a VL region that includes a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • an antibody of fragment thereof described herein comprises a VH region and a VL region, wherein the VH region comprises: (1) a VH FR1 having an amino acid sequence selected from the group consisting of SEQ ID NOS: 19 and 24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS:21 and 23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS: 16 and 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody of fragment thereof comprises a VH region and a VL region
  • the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 16; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody of fragment thereof comprises a VH region and a VL region
  • the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody of fragment thereof comprises a VH region and a VL region
  • the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 16; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody of fragment thereof comprises a VH region and a VL region
  • the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody of fragment thereof comprises a VH region and a VL region
  • the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO:24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 16; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody of fragment thereof comprises a VH region and a VL region
  • the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO:24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3 and VH FR4. In other embodiments, the antibody comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3 and VL FR4. In yet other embodiments, the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody of fragment thereof comprises a VH region and a VL region
  • the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO:24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 16; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody of fragment thereof comprises a VH region and a VL region
  • the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO:24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody comprises a VH region comprising all four of the above-referenced VH FRl, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FRl, VL FR2, VL FR3, and VL FR4.
  • antibodies comprising one or more (e.g., one, two, three, or four) VH FRs and one or more (e.g., one, two, three, or four) VL FRs listed in Tables 3-4.
  • an antibody comprising a VH FRl (SEQ ID NOS: 19 or 24) and a VL FRl (SEQ ID NO: 14).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24) and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24) and a VL FR3 (SEQ ID NOS: 16 or 18). In another embodiment, the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24) and a VL FR4 (SEQ ID NO: 17). In other embodiments, the antibody comprises a VH FR2 (SEQ ID NO:20) and a VL FRl (SEQ ID NO: 14). In one embodiment, the antibody comprises a VH FR2 (SEQ ID NO:20) and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR2 (SEQ ID NO:20) and a VL FR3 (SEQ ID NOS: 16 or 18). In another embodiment, the antibody comprises a VH FR2 (SEQ ID NO:20) and a VL FR4 (SEQ ID NO: 17). In one embodiment, the antibody comprises a VH FR3 (SEQ ID NO:21) and a VL FRl (SEQ ID NO: 14). In other embodiments, the antibody comprises a VH FR3 (SEQ ID NO:21) and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR3 (SEQ ID NO:21) and a VL FR3 (SEQ ID NOS: 16 or 18). In some embodiments, the antibody comprises a VH FR3 (SEQ ID NO:21) and a VL FR4 (SEQ ID NO: 17). In one embodiment, the antibody comprises a VH FR4 (SEQ ID NO:22) and a VL FRl (SEQ ID NO: 14). In another embodiment, the antibody comprises a VH FR4 (SEQ ID NO:22) and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR4 (SEQ ID NO:22) and a VL FR3 (SEQ ID NOS: 16 or 18). In some embodiments, the antibody comprises a VH FR4 (SEQ ID NO:22) and a VL FR4 (SEQ ID NO: 17). In another embodiment, the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), and a VL FRl (SEQ ID NO: 14).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), and a VL FRl (SEQ ID NO: 14).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FR2 (SEQ ID NO: 15) and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FR2 (SEQ ID NO: 15) and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NO: 19 or 24), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15) and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15) and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15) and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15) and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15) and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15) and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), and a VL FRl (SEQ ID NO: 14).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), and a VL FRl (SEQ ID NO: 14).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FRl (SEQ ID NO: 14).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FRl (SEQ ID NO: 14).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • VH FR4 SEQ ID NO:22
  • VL FR3 SEQ ID NOS: 16 or 18
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR3 (SEQ
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO:
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO:
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • VH FR3 SEQ ID NOS:21 or 23
  • VH FR4 SEQ ID NO:22
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VL FR1 (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VL FR1 (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FRl (SEQ ID NO: 14).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21 or 23), a VL
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO:
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO:20), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO:20), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO:
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • VH FRl SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • a VH FR4 SEQ ID NO:22
  • VL FRl SEQ ID NO: 14
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • VH FRl SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • a VH FR4 SEQ ID NO:22
  • VL FRl SEQ ID NO: 14
  • VL FR2 SEQ ID NO: 15
  • VL FR4 SEQ ID NO: 17
  • the antibody comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • VH FRl SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • a VH FR4 SEQ ID NO:22
  • VL FR1 SEQ ID NO: 14
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • VH FR1 SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • a VH FR4 SEQ ID NO:22
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • VH FR1 SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • VL FR1 SEQ ID NO: 14
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • VH FR1 SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR4 SEQ ID NO:22
  • VL FR1 SEQ ID NO: 14
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the antibody comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • VH FR1 SEQ ID NOS: 19 or 24
  • VH FR3 SEQ ID NOS:21 or 23
  • a VH FR4 SEQ ID NO:22
  • VL FR1 SEQ ID NO: 14
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the antibody comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the antibody comprises any combination thereof of the VH FRs (SEQ ID NOS: 19- 24) and the VL FRs (SEQ ID NOS: 14-18) listed in Tables 3-4.
  • the antibodies provided herein comprise a VH region or VH domain. In other embodiments, the antibodies provided herein comprise a VL region or VL domain. In certain embodiments, the antibodies provided herein have a combination of (i) a VH domain or VH region; and/or (ii) a VL domain or VL region. In yet other embodiments, the antibodies provided herein have a combination of (i) a VH domain or VH region; and/or (ii) a VL domain or VL region selected from the group consisting of SEQ ID NOS: 8-13 as set forth in Tables 5-6.
  • the antibodies provided herein have a combination of (i) a VH domain or VH region; and/or (ii) a VL domain or VL region of any one of antibodies PDlAB-1, PD1 AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6, as set forth in Tables 5-6.
  • the antibodies provided herein comprise a VH region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO:4; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO:5; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO:6; and a VL region selected from the group consisting of SEQ ID NOS:8-10 as set forth in Table 5.
  • the VL region has an amino acid sequence of SEQ ID NO: 8.
  • the VL region has an amino acid sequence of SEQ ID NO:9.
  • the VL region has an amino acid sequence of SEQ ID NO: 10.
  • the antibodies provided herein comprise a VH region selected from the group consisting of SEQ ID NOS: 11-13 as set forth in Table 6; and a VL region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOS: 1 and 7; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • the antibodies provided herein comprise a VH region selected from the group consisting of SEQ ID NOS: 11-13 as set forth in Table 6; and a VL region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 1; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • the antibodies provided herein comprise a VH region selected from the group consisting of SEQ ID NOS: 11-13 as set forth in Table 6; and a VL region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO:7; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 3.
  • the VH region has an amino acid sequence of SEQ ID NO: 11.
  • the VH region has an amino acid sequence of SEQ ID NO: 12.
  • the VH region has an amino acid sequence of SEQ ID NO: 13.
  • PD1AB-2 EVQLVQSGAEVKKPGATVKISCKVSGFNIKDTYMHWVQQAPGKGLEWMGRIDPANGDRKYDPKFQGRV
  • PD1AB-4 EVQLVQSGAEVKKPGATVKISCKVSGFNIKDTYMHWVQQAPGKGLEWMGRIDPANGDRKYDPKFQGRV
  • PD1AB-6 EVQLVQSGAEVKKPGATVKISCKASGFNIKDTYMHWVQQAPGKGLEWMGRIDPANGDRKYDPKFQGRV
  • the exemplary nucleic acid sequences for the VL region and the VH region of any one of antibodies PD1 AB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, and PD1AB-6 are shown in Tables 7-8.
  • PD1AB-2 GACATCGTGATGACCCAGTCTCCAGACTCCCTGGCTGTGTCTCTGGGCGAGAGGGCCACCATCAA
  • PD1AB-3 GACATCGTGATGACCCAGTCTCCAGACTCCCTGGCTGTGTCTCTGGGCGAGAGGGCCACCATCAA
  • PD1AB-4 CTGCAAGTCCAGCCAGAGTGTTTTTTATACAGCTCCAACAATAAGAACTACTTAGCTTGGTACCAGC
  • PD1AB-6 CTGCAAGTCCGGTCAAAGTGTTTTATACAGTTCAAATCAGAAGAACTTCTTGGCCTGGTACCAGC
  • PD1AB-2 GAGGTCCAGCTGGTACAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCTACAGTGAAAATCTCCTG
  • PD1AB-4 GAGGTCCAGCTGGTACAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCTACAGTGAAAATCTCCTG
  • PD1AB-6 GAGGTCCAGCTGGTACAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCTACAGTGAAAATCTCCTG
  • an antibody provided herein has a VH and a VL amino acid of PDlAB-1.
  • an antibody comprises a VH amino acid of SEQ ID NO: 11, and a VL amino acid sequence of SEQ ID NO: 8.
  • an antibody provided herein has a VH and a VL amino acid of PDlAB-2.
  • an antibody comprises a VH amino acid of SEQ ID NO: 11, and a VL amino acid sequence of SEQ ID NO:9.
  • an antibody provided herein has a VH and a VL amino acid of PDlAB-3.
  • an antibody comprises a VH amino acid of SEQ ID NO: 12, and a VL amino acid sequence of SEQ ID NO: 10.
  • an antibody provided herein has a VH and a VL amino acid of PD1AB-4. In some embodiments, an antibody comprises a VH amino acid of SEQ ID NO: 12, and a VL amino acid sequence of SEQ ID NO:9. [0291] In some embodiments, an antibody provided herein has a VH and a VL amino acid sequence of PD1AB-5. In some embodiments, an antibody comprises a VH amino acid sequence of SEQ ID NO: 13, and a VL amino acid sequence of SEQ ID NO:9.
  • an antibody provided herein has a VH and a VL amino acid sequence of PD1AB-6.
  • an antibody comprises a VH amino acid sequence of SEQ ID NO: 13, and a VL amino acid sequence of SEQ ID NO: 8.
  • an antibody or antigen-binding fragment thereof described herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the light chain comprises a constant region having an amino acid sequence of:
  • an antibody or antigen-binding fragment thereof described herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the heavy chain comprises a human IgGl Fc region having an amino acid sequence of:
  • an antibody or antigen-binding fragment thereof described herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the heavy chain does not comprise a human IgGl Fc region having an amino acid sequence of SEQ ID NO:36.
  • an antibody or antigen-binding fragment thereof described herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the heavy chain comprises a human IgGl-K322A Fc region having an amino acid sequence of:
  • an antibody or antigen-binding fragment thereof described herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the heavy chain comprises a human IgG4 Fc region having an amino acid sequence of:
  • an antibody or antigen-binding fragment thereof described herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the heavy chain comprises a human IgG4P Fc region having an amino acid sequence of:
  • an antibody or antigen-binding fragment thereof described herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the heavy chain comprises a human IgG4PE Fc region having an amino acid sequence of:
  • an antibody or antigen-binding fragment thereof described herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the heavy chain does not comprise a human IgG4PE Fc region having an amino acid sequence of SEQ ID NO:40.
  • an antibody or antigen-binding fragment thereof described herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the light chain comprises a constant region having an amino acid sequence of SEQ ID NO:41 ; and the heavy chain comprises an Fc region having an amino acid sequence selected from the group consisting of SEQ ID NOS:36-40.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • an antibody provided herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the light chain comprises an amino acid sequence as follows:
  • an antibody provided herein which specifically binds to a PD- 1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the heavy chain comprises an amino acid sequence as follows:
  • an antibody provided herein which specifically binds to a PD- 1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the heavy chain comprises an amino acid sequence as follows:
  • an antibody provided herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the heavy chain comprises an amino acid sequence as follows:
  • an antibody provided herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein the heavy chain comprises an amino acid sequence as follows:
  • an antibody provided herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein (i) the light chain comprises an amino acid sequence of SEQ ID NO:31; and (ii) the heavy chain comprises an amino acid sequence of SEQ ID NO:32.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the light chain comprises an amino acid sequence of SEQ ID NO:31
  • the heavy chain comprises an amino acid sequence of SEQ ID NO:32.
  • an antibody provided herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein (i) the light chain comprises an amino acid sequence of SEQ ID NO:31; and (ii) the heavy chain comprises an amino acid sequence of SEQ ID NO:33.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the light chain comprises an amino acid sequence of SEQ ID NO:31
  • the heavy chain comprises an amino acid sequence of SEQ ID NO:33.
  • an antibody provided herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein (i) the light chain comprises an amino acid sequence of SEQ ID NO:31; and (ii) the heavy chain comprises an amino acid sequence of SEQ ID NO:34.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the light chain comprises an amino acid sequence of SEQ ID NO:31
  • the heavy chain comprises an amino acid sequence of SEQ ID NO:34.
  • an antibody provided herein which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), comprises a light chain and a heavy chain, wherein (i) the light chain comprises an amino acid sequence of SEQ ID NO:31; and (ii) the heavy chain comprises an amino acid sequence of SEQ ID NO:35.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the light chain comprises an amino acid sequence of SEQ ID NO:31
  • the heavy chain comprises an amino acid sequence of SEQ ID NO:35.
  • antibodies are provided that compete with one of the exemplified antibodies or functional fragments for binding to PD-1. Such antibodies may also bind to the same epitope as one of the herein exemplified antibodies, or an overlapping epitope. Antibodies and fragments that compete with or bind to the same epitope as the exemplified antibodies are expected to show similar functional properties.
  • the exemplified antigen-binding proteins and fragments include those with the VH and VL regions, and CDRs provided herein, including those in Tables 1-6.
  • the antibodies that are provided include those that compete with an antibody comprising: (a) 1, 2, 3, 4, 5, or all 6 of the CDRs listed for an antibody listed in Tables 1-2; (b) a VH and a VL selected from the VH and the VL regions listed for an antibody listed in Tables 5-6; or (c) two light chains and two heavy chains comprising a VH and a VL as specified for an antibody listed in Tables 5-6.
  • the antibody is PDlAB-1.
  • the antibody is PD1AB-2.
  • the antibody is PDlAB-3.
  • the antibody is PDlAB-4.
  • the antibody is PD1AB-5.
  • the antibody is
  • antibodies or antigen-binding fragments thereof provided herein bind to a region, including an epitope, of human PD-1 or cyno PD-1.
  • an antibody provided herein binds to a region of human PD-1 (SEQ ID NO:42) comprising amino acid residues 33 to 109 of human PD-1.
  • antibodies provided herein bind to a specific epitope of human PD-1.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to at least one of residues 100-109 (SEQ ID NO:43) within an amino acid sequence of SEQ ID NO:42. In some embodiments, the antibody or antigen-binding fragment thereof, when bound to PD-1, binds to at least one of residues 100-105 (SEQ ID NO:44) within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to at least one residue selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42. In some embodiments, the antibody or antigen-binding fragment thereof, when bound to PD-1, binds to at least one residue selected from the group consisting of L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to two or more residues selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to three or more residues selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to four or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to five or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to six or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to seven or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to eight or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to nine or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof when bound to PD-1, binds to all ten residues from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof, when bound to PD-1 binds to N33 within an amino acid sequence of SEQ ID NO:42. In another embodiment, the antibody or antigen-binding fragment thereof, when bound to PD-1, binds to T51 within an amino acid sequence of SEQ ID NO:42. In a particular embodiment, the antibody or antigen-binding fragment thereof, when bound to PD-1, binds to S57 within an amino acid sequence of SEQ ID NO:42. In one specific embodiment, the antibody or antigen-binding fragment thereof, when bound to PD-1, binds to LlOO within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof, when bound to PD-1 binds to N102 within an amino acid sequence of SEQ ID NO:42. In other embodiments, the antibody or antigen-binding fragment thereof, when bound to PD-1, binds to G103 within an amino acid sequence of SEQ ID NO:42. In another embodiment, the antibody or antigen- binding fragment thereof, when bound to PD-1, binds to R104 within an amino acid sequence of SEQ ID NO:42. In yet another embodiment, the antibody or antigen-binding fragment thereof, when bound to PD-1, binds to G103 and R104 within an amino acid sequence of SEQ ID NO:42.
  • the antibody or antigen-binding fragment thereof, when bound to PD-1 binds to D105 within an amino acid sequence of SEQ ID NO:42. In some embodiments, the antibody or antigen-binding fragment thereof, when bound to PD-1, binds to H107 within an amino acid sequence of SEQ ID NO:42. In certain embodiments, the antibody or antigen- binding fragment thereof, when bound to PD-1, binds to S I 09 within an amino acid sequence of SEQ ID NO:42. Any combination of two, three, four, five, six, seven, eight, nine, ten or more of the above-referenced amino acid PD-1 binding sites is also contemplated.
  • a PD-1 agonist is provided herein that is an antibody provided herein that specifically binds to an ECD of human PD-1, and activates (e.g., partially activates) at least one PD-1 activity (e.g., inhibiting cytokine production).
  • a PD-1 agonist provided herein is an antibody provided herein that specifically binds to an ECD of human PD-1, and downregulates PD-1 expression.
  • described herein are antibodies that specifically bind to PD-1 and that (a) attenuate T cell activity, e.g., as determined by inhibition of cytokine production; and/or (b) downregulate PD-1 expression in a cell.
  • antibodies that specifically bind to PD-1 and that (a) attenuate T cell activity, e.g., as determined by inhibition of cytokine production; (b) downregulate PD-1 expression in a cell; and/or (c) do not inhibit PD-L1 and/or PD-L2 binding to PD-1.
  • the antibodies that specifically bind to PD-1 bind to an ECD of human PD-1, or an epitope of an ECD of human PD-1 thereof.
  • the antibodies specifically bind to an epitope of an ECD of human PD-1 that is distinct from the PD-L1 binding site.
  • the antibodies specifically bind to an epitope of an ECD of human PD-1 that is distinct from the PD-L2 binding site. In certain embodiments, the antibodies specifically bind to an epitope of an ECD of human PD-1 that is distinct from both the PD-Ll and PD-L2 binding sites. In certain embodiments, binding of PD- Ll to PD-1 is not inhibited by the antibody. In other embodiments, binding of PD-L2 to PD-1 is not inhibited by the antibody. In specific embodiments, neither binding of PD-Ll to PD-1 nor binding of PD-L2 to PD-1 is inhibited by the antibody.
  • PD-1 activity can relate to any activity of PD-1 such as those known or described in the art.
  • PD-1 activity and PD-1 signaling are used interchangeably herein.
  • PD-1 activity is induced by PD-1 ligand (e.g., PD-Ll) binding to PD-1.
  • PD-1 ligand e.g., PD-Ll
  • Expression levels of PD-1 can be assessed by methods described herein or known to one of skill in the art (e.g., Western blotting, ELISA, immunohistochemistry, or flow cytometry).
  • described herein are antibodies that specifically bind to PD-1 and decrease PD-1 expression.
  • described herein are antibodies that specifically bind to PD-1 and attenuate T cell activity.
  • antibodies that specifically bind to PD-1 and inhibit cytokine production are antibodies that specifically bind to PD-1 and activate (e.g., partially activate) PD-1 signaling.
  • the antibodies that specifically bind to PD-1 bind to an ECD of human PD-1, or an epitope of an ECD of human PD-1 thereof.
  • the antibodies specifically bind to an epitope of an ECD of human PD-1 that is distinct from the PD-Ll binding site.
  • the antibodies specifically bind to an epitope of an ECD of human PD-1 that is distinct from both the PD-Ll and PD-L2 binding sites. In certain embodiments, binding of PD-Ll to PD-1 is not inhibited by the antibody. In other embodiments, binding of PD-L2 to PD-1 is not inhibited by the antibody. In specific embodiments, neither binding of PD-Ll to PD-1 nor binding of PD-L2 to PD-1 is inhibited by the antibody.
  • an anti-PD-1 antibody provided herein attenuates (e.g., partially attenuate) T cell activity. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 10%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 15%. In some embodiments, an anti- PD-1 antibody provided herein attenuates T cell activity by at least about 20%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 25%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 30%.
  • an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 35%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 40%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 45%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 50%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 55%). In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 60%.
  • an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 65%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 70%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 75%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 80%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 85%). In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 90%.
  • an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 95%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 98%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 99%. In some embodiments, an anti-PD-1 antibody provided herein attenuates T cell activity by at least about 100%. In certain embodiments, an anti-PD-1 antibody provided herein can attenuate (e.g., partially attenuate) T cell activity by at least about 25% to about 65%. In specific embodiments, the T cell activity attenuation is assessed by methods described herein.
  • the T cell activity attenuation is assessed by methods known to one of skill in the art. In certain embodiments, the T cell activity attenuation is relative to T cell activity in the presence of stimulation without any anti-PD-1 antibody. In certain embodiments, the T cell activity attenuation is relative to T cell activity in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an unrelated antibody e.g., an antibody that does not specifically bind to PD-1).
  • Attenuation of T cell activity is indicated by inhibition of T cell proliferation.
  • the T cell proliferation is CD4+ T cell proliferation.
  • the T cell proliferation is CD8+ T cell proliferation.
  • an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 10%.
  • an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 15%.
  • an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 20%.
  • an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 25%.
  • an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 30%.
  • an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 35%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 40%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 45%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 50%). In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 55%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 60%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 65%.
  • an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 70%). In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 75%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 80%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 85%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 90%). In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 95%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 98%.
  • an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 99%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell proliferation by at least about 100%). In certain embodiments, an anti-PD-1 antibody provided herein can inhibit (e.g., partially inhibit) T cell proliferation by at least about 25% to about 65%. In specific embodiments, the T cell proliferation is assessed by methods described herein. In some embodiments, the T cell proliferation is assessed by methods known to one of skill in the art. In certain embodiments, the T cell proliferation is relative to T cell proliferation in the presence of stimulation without any anti-PD-1 antibody. In certain embodiments, the T cell proliferation is relative to T cell proliferation in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an unrelated antibody e.g., an antibody that does not specifically bind to PD-1).
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PDlAB-3, PDl AB-4, PDlAB-5, or PDl AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDl AB-1, PDl AB- 2, PDl AB-3, PDl AB-4, PDl AB-5, or PDl AB-6) specifically bind to PD-1 and inhibit CD4+ T cell proliferation.
  • an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 15%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 20%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 30%).
  • an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 35%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 40%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 45%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 50%). In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 60%). In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 70%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 75%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 80%.
  • an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 85%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 90%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 95%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 98%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD4+ T cell proliferation by at least about 99%.
  • antibodies provided herein specifically bind to PD-1 and inhibits CD4+ T cell proliferation by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of CD4+ T cell proliferation is assessed by methods described herein.
  • the inhibition of CD4+ T cell proliferation is assessed by methods known to one of skill in the art (e.g., thymidine incorporation assay, MTT assay, or cell proliferation biomarker assay).
  • methods known to one of skill in the art e.g., thymidine incorporation assay, MTT assay, or cell proliferation biomarker assay.
  • the inhibition of CD4+ T cell proliferation is assessed by thymidine incorporation assay. In another embodiment, the inhibition of CD4+ T cell proliferation is assessed by MTT assay. In yet another embodiment, the inhibition of CD4+ T cell proliferation is assessed by cell proliferation biomarker assay. In a specific embodiment, CD4+ T cell proliferation is inhibited relative to CD4+ T cell proliferation in the presence of stimulation without any anti-PD-1 antibody. In other embodiments, the CD4+ T cell proliferation is inhibited relative to CD4+ T cell proliferation in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an unrelated antibody e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD lAB-2, PDl AB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDl AB-1, PDl AB-2, PDl AB-3, PDl AB-4, PDl AB-5, or PDl AB-6) inhibits CD4+ T cell proliferation.
  • an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 40 nM.
  • an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 1 nM.
  • an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 0.5 nM. In another
  • an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 0.05 nM. In some
  • an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD4+ T cell proliferation with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., thymidine incorporation assay, MTT assay, or cell proliferation biomarker assay). In a specific embodiment, the EC 50 is assessed by thymidine incorporation assay. In another embodiment, the EC 50 is assessed by MTT assay. In yet another embodiment, the EC 50 is assessed by cell proliferation biomarker assay.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PDlAB-3, PDl AB-4, PDlAB-5, or PDl AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDl AB-1, PDl AB- 2, PDl AB-3, PDl AB-4, PDl AB-5, or PDl AB-6) specifically bind to PD-1 and inhibit CD8+ T cell proliferation.
  • an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 15%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 20%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 30%).
  • an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 35%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 40%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 45%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 50%). In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 60%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 70%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 75%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 80%).
  • an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 85%>. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 90%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 95%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 98%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits CD8+ T cell proliferation by at least about 99%.
  • antibodies provided herein specifically bind to PD-1 and inhibits CD8+ T cell proliferation by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of CD8+ T cell proliferation is assessed by methods described herein.
  • the inhibition of CD8+ T cell proliferation is assessed by methods known to one of skill in the art (e.g., thymidine incorporation assay, MTT assay, or cell proliferation biomarker assay).
  • methods known to one of skill in the art e.g., thymidine incorporation assay, MTT assay, or cell proliferation biomarker assay.
  • the inhibition of CD8+ T cell proliferation is assessed by thymidine incorporation assay. In another embodiment, the inhibition of CD8+ T cell proliferation is assessed by MTT assay. In yet another embodiment, the inhibition of CD8+ T cell proliferation is assessed by cell proliferation biomarker assay. In a specific embodiment, CD8+ T cell proliferation is inhibited relative to CD8+ T cell proliferation in the presence of stimulation without any anti-PD-1 antibody. In other embodiments, the CD8+ T cell proliferation is inhibited relative to CD8+ T cell proliferation in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an unrelated antibody e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD lAB-2, PDl AB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDl AB-1, PDl AB-2, PDl AB-3, PDl AB-4, PDl AB-5, or PDl AB-6) inhibits CD8+ T cell proliferation.
  • an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 40 nM.
  • an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 1 nM.
  • an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 0.5 nM. In another
  • an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 0.05 nM. In some
  • an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits CD8+ T cell proliferation with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., thymidine incorporation assay, MTT assay, or cell proliferation biomarker assay). In a specific embodiment, the EC 50 is assessed by thymidine incorporation assay. In another embodiment, the EC 50 is assessed by MTT assay. In yet another embodiment, the EC 50 is assessed by cell proliferation biomarker assay.
  • Attenuation of T cell activity is indicated by upregulation of expression of an inhibitory receptor on the surface of T cells that is not the PD-1 receptor (e.g., LAG-3, CTLA-4, or TEVI-3).
  • the inhibitory receptor is selected from the group consisting of LAG-3, CTLA-4, or TEVI-3, or any combination thereof.
  • the inhibitory receptor is LAG-3. In another embodiment, the inhibitory receptor is CTLA-4. In yet another embodiment, the inhibitory receptor is TEVI-3. In certain embodiments, the inhibitory receptor is LAG-3 and CTLA-4. In some embodiments, the inhibitory receptor is LAG-3 and TEVI-3. In yet other embodiments, the inhibitory receptor is CTLA-4 and TEVI-3. In still other embodiments, the inhibitory receptor is LAG-3, CTLA-4, or TIM-3.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PD1 AB- 2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6) specifically bind to PD-1 and upregulate the expression of the LAG-3 receptor.
  • an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 15%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 20%). In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 30%).
  • an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 35%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 40%). In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 45%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 50%. In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 60%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 70%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 75%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 80%.
  • an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 85%). In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 90%. In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 95%). In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 98%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates LAG-3 expression by at least about 99%).
  • antibodies provided herein specifically bind to PD-1 and upregulate LAG-3 expression by at least about 25% or 35%, optionally to about 75%.
  • the upregulation of LAG-3 expression is assessed by methods described herein.
  • the upregulation of LAG-3 expression is assessed by methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR).
  • the upregulation of LAG-3 expression is assessed by flow cytometry.
  • the upregulation of LAG-3 expression is assessed by Western blotting.
  • the upregulation of LAG-3 expression is assessed by Northern blotting.
  • the upregulation of LAG-3 expression is assessed by RT-PCR.
  • LAG-3 expression is upregulated relative to LAG-3 expression in the presence of stimulation without any anti-PD-1 antibody.
  • the LAG-3 expression is upregulated relative to LAG-3 expression in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD lAB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PD1 AB-2, PD1 AB-3, PD1 AB-4, PD1 AB-5, or PD1 AB-6) upregulates LAG-3 expression.
  • an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 0.1 nM. In one
  • an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 0.05 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 50 nM.
  • an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 40 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 5 nM.
  • an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 0.05 nM.
  • an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates LAG-3 expression with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR).
  • the EC 50 is assessed by flow cytometry. In another embodiment, the EC 50 is assessed by Western blotting. In yet another embodiment, the EC 50 is assessed by Northern blotting. In still another embodiment, the EC 50 is assessed by RT-PCR.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PD1 AB- 2, PDlAB-3, PDl AB-4, PDl AB-5, or PDl AB-6) specifically bind to PD-1 and upregulate the expression of the CTLA-4 receptor.
  • an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 15%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 20%. In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 30%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 35%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about
  • an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 40%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 45%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 50%. In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 55%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 60%.
  • an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 70%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 75%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 80%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 85%.
  • an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 90%. In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 95%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 98%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates CTLA-4 expression by at least about 99%. In specific embodiments, antibodies provided herein specifically bind to PD-1 and upregulates CTLA-4 expression by at least about 25% or 35%, optionally to about 75%.
  • the upregulation of CTLA-4 expression is assessed by methods described herein. In other embodiments, the upregulation of CTLA-4 expression is assessed by methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the upregulation of CTLA-4 expression is assessed by flow cytometry. In another embodiment, the upregulation of CTLA-4 expression is assessed by Western blotting. In yet another embodiment, the upregulation of CTLA-4 expression is assessed by Northern blotting. In still another embodiment, the upregulation of CTLA-4 expression is assessed by RT- PCR. In a specific embodiment, CTLA-4 expression is upregulated relative to CTLA-4 expression in the presence of stimulation without any anti-PD-1 antibody. In other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the upregulation of CTLA-4 expression is assessed by flow cytometry. In another embodiment, the upregulation of CT
  • the CTLA-4 expression is upregulated relative to CTLA-4 expression in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an unrelated antibody e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD lAB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PD1 AB-2, PD1 AB-3, PD1 AB-4, PD1 AB-5, or PD1 AB-6) upregulates CTLA-4 expression.
  • an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates CTLA- 4 expression with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at most about 0.001 nM. In another embodiment,
  • an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 40 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 10 nM.
  • an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 0.1 nM.
  • an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates CTLA-4 expression with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates CTLA- 4 expression with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein.
  • the EC 50 is assessed by other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the EC 50 is assessed by flow cytometry. In another embodiment, the EC 50 is assessed by Western blotting. In yet another embodiment, the EC 50 is assessed by Northern blotting. In still another embodiment, the EC 50 is assessed by RT- PCR.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1 AB-4, PD1AB-5, or PD1 AB-6) specifically bind to PD-1 and upregulate the expression of the TIM-3 receptor.
  • an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 15%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 20%. In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 30%).
  • an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 35%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 40%). In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 45%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 50%. In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 60%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 70%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 75%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates TIM-3 expression by at least about 80%.
  • an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 85%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 90%. In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 95%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 98%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates TEVI-3 expression by at least about 99%.
  • antibodies provided herein specifically bind to PD-1 and upregulate TEVI-3 expression by at least about 25% or 35%, optionally to about 75%.
  • the upregulation of TEVI-3 expression is assessed by methods described herein.
  • the upregulation of TEVI-3 expression is assessed by methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR).
  • the upregulation of TEVI-3 expression is assessed by flow cytometry.
  • the upregulation of TEVI-3 expression is assessed by Western blotting.
  • the upregulation of TEVI-3 expression is assessed by Northern blotting.
  • the upregulation of TEVI-3 expression is assessed by RT-PCR.
  • TIM-3 expression is upregulated relative to TEVI-3 expression in the presence of stimulation without any anti-PD-1 antibody.
  • the TEVI-3 expression is upregulated relative to TEVI-3 expression in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD lAB-2, PDl AB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDl AB-1, PDl AB-2, PDl AB-3, PDl AB-4, PDl AB-5, or PDl AB-6) upregulates TIM-3 expression.
  • an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates TIM-3 expression with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 50 nM. In other
  • an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 40 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein
  • an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates TEVI-3 expression with an EC 50 of at least about 0.01 nM.
  • an anti-PD-1 antibody provided herein upregulates TIM-3 expression with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates TIM-3 expression with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the EC 50 is assessed by flow cytometry. In another embodiment, the EC 50 is assessed by Western blotting. In yet another embodiment, the EC 50 is assessed by Northern blotting. In still another embodiment, the EC 50 is assessed by RT-PCR.
  • Attenuation of T cell activity is indicated by inhibition of T cell recall response.
  • the T cell recall response is measured by CD4+ T cell proliferation. In other embodiments, the T cell recall response is measured by CD25
  • an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 10%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 15%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 20%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 25%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 30%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 35%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 40%.
  • an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 45%). In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 50%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 55%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 60%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 65%). In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 70%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 75%.
  • an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 80%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 85%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 90%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 95%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 98%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 99%. In some embodiments, an anti-PD-1 antibody provided herein inhibits T cell recall response by at least about 100%.
  • an anti-PD-1 antibody provided herein can inhibit (e.g., partially inhibit) T cell recall response by at least about 25% to about 65%.
  • the T cell recall response is assessed by methods described herein.
  • the T cell recall response is assessed by methods known to one of skill in the art (e.g., CD4+ T cell proliferation assay or CD25 upregulation assay).
  • the T cell recall response is relative to T cell recall response in the presence of stimulation without any anti-PD-1 antibody.
  • the T cell recall response is relative to T cell recall response in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • Attenuation of T cell activity is indicated by downregulation of T cell activation biomarkers.
  • the T cell activation biomarker is CD25. In another embodiment, the T cell activation biomarker is CD69.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) specifically bind to PD-1 and downregulate the expression of CD25.
  • an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 15%. In some embodiments, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 20%). In other embodiments, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 30%. In one embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 35%.
  • an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 40%. In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 45%. In one embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 50%). In other embodiments, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 55%. In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 60%).
  • an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 65%>. In one embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 70%). In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 75%. In one embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 80%). In some embodiments, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 85%>.
  • an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 90%). In other embodiments, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 95%. In one embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 98%). In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD25 expression by at least about 99%. In specific embodiments, antibodies provided herein specifically bind to PD-1 and downregulate CD25 expression by at least about 25%o or 35%), optionally to about 75%. In some embodiments, the downregulation of CD25 expression is assessed by methods described herein.
  • the downregulation of CD25 expression is assessed by methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the downregulation of CD25 expression is assessed by flow cytometry. In another embodiment, the downregulation of CD25 expression is assessed by Western blotting. In yet another embodiment, the
  • CD25 expression is assessed by Northern blotting. In still another embodiment, the downregulation of CD25 expression is assessed by RT-PCR. In a specific embodiment, CD25 expression is downregulated relative to CD25 expression in the presence of stimulation without any anti-PD-1 antibody. In other embodiments, the CD25 expression is downregulated relative to CD25 expression in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an unrelated antibody e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PDlAB-2, PD1AB-3, PDlAB-4, PDlAB-5, or PDlAB-6) downregulates CD25 expression.
  • an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at most about 0.001 nM. In another embodiment,
  • an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 40 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 10 nM.
  • an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 0.1 nM.
  • an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein downregulates CD25 expression with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein.
  • the EC 50 is assessed by other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the EC 50 is assessed by flow cytometry. In another embodiment, the EC 50 is assessed by Western blotting. In yet another embodiment, the EC 50 is assessed by Northern blotting. In still another embodiment, the EC 50 is assessed by RT- PCR.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1 AB-4, PD1AB-5, or PD1 AB-6) specifically bind to PD-1 and downregulate the expression of CD69.
  • an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 15%. In some embodiments, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 20%). In other embodiments, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 30%). In one embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 35%.
  • an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 40%). In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 45%. In one embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 50%). In other embodiments, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 55%. In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 60%). In some embodiments, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 65%.
  • an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 70%). In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 75%. In one embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 80%). In some embodiments, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 85%. In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 90%. In other embodiments, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 95%.
  • an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 98%). In another embodiment, an antibody provided herein specifically binds to PD-1 and downregulates CD69 expression by at least about 99%. In specific embodiments, antibodies provided herein specifically bind to PD-1 and downregulate CD69 expression by at least about 25%o or 35%), optionally to about 75%. In some embodiments, the downregulation of CD69 expression is assessed by methods described herein. In other embodiments, the downregulation of CD69 expression is assessed by methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the downregulation of CD69 expression is assessed by flow cytometry. In another embodiment, the downregulation of CD69 expression is assessed by Western blotting. In yet another embodiment, the
  • the downregulation of CD69 expression is assessed by RT-PCR.
  • CD69 expression is downregulated relative to CD69 expression in the presence of stimulation without any anti-PD-1 antibody.
  • the CD69 expression is downregulated relative to CD69 expression in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PDlAB-2, PD1AB-3, PDlAB-4, PDlAB-5, or PDlAB-6) downregulates CD69 expression.
  • an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at most about 0.001 nM. In another embodiment,
  • an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 40 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 10 nM.
  • an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 0.1 nM.
  • an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein downregulates CD69 expression with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein.
  • the EC 50 is assessed by other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the EC 50 is assessed by flow cytometry. In another embodiment, the EC 50 is assessed by Western blotting. In yet another embodiment, the EC 50 is assessed by Northern blotting. In still another embodiment, the EC 50 is assessed by RT- PCR. [0344] In some embodiments, attenuation of T cell activity is indicated by upregulation of regulatory T cell biomarkers. In one embodiment, the regulatory T cell biomarker is Foxp3.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PDlAB-3, PDl AB-4, PDlAB-5, or PDl AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDl AB-1, PDl AB- 2, PDl AB-3, PDl AB-4, PDl AB-5, or PDl AB-6) specifically bind to PD-1 and upregulate the expression of Foxp3.
  • an antibody provided herein specifically binds to PD- 1 and upregulates Foxp3 expression by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 15%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 20%. In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 30%).
  • an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 35%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 40%). In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 45%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 50%. In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 60%. In some embodiments, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 70%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 75%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 80%.
  • an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 85%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 90%. In other embodiments, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 95%. In one embodiment, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 98%. In another embodiment, an antibody provided herein specifically binds to PD-1 and upregulates Foxp3 expression by at least about 99%.
  • antibodies provided herein specifically bind to PD-1 and upregulate Foxp3 expression by at least about 25% or 35%, optionally to about 75%.
  • the upregulation of Foxp3 expression is assessed by methods described herein.
  • the upregulation of Foxp3 expression is assessed by methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR).
  • the upregulation of Foxp3 expression is assessed by flow cytometry.
  • the upregulation of Foxp3 expression is assessed by Western blotting.
  • the upregulation of Foxp3 expression is assessed by Northern blotting.
  • the upregulation of Foxp3 expression is assessed by RT-PCR.
  • Foxp3 expression is upregulated relative to Foxp3 expression in the presence of stimulation without any anti-PD-1 antibody.
  • the Foxp3 expression is upregulated relative to FOXP3 expression in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD lAB-2, PDl AB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDl AB-1, PDl AB-2, PDl AB-3, PDl AB-4, PDl AB-5, or PDl AB-6) upregulates Foxp3 expression.
  • an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 50 nM. In other
  • an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 40 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein
  • an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 0.01 nM.
  • an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein upregulates Foxp3 expression with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the EC 50 is assessed by flow cytometry. In another embodiment, the EC 50 is assessed by Western blotting. In yet another embodiment, the EC 50 is assessed by Northern blotting. In still another embodiment, the EC 50 is assessed by RT-PCR.
  • Attenuation of T cell activity is indicated by increase of T cell exhaustion.
  • the increase of T cell exhaustion is measured by reduction of IL-7R bi T cells.
  • the increase of T cell exhaustion is measured by increase of IL-7R 10 T cells.
  • the increase of T cell exhaustion is measured by increase of LAG-3 expression.
  • the increase of T cell exhaustion is measured by increase of CTLA-4 expression.
  • the increase of T cell exhaustion is measured by increase of TIM-3 expression.
  • an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 10%.
  • an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 15%). In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 20%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 25%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 30%>. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 35%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 40%). In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 45%.
  • an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 50%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 55%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 60%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 65%). In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 70%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 75%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 80%.
  • an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 85%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 90%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 95%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 98%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 99%. In some embodiments, an anti-PD-1 antibody provided herein increases T cell exhaustion by at least about 100%.
  • an anti-PD-1 antibody provided herein can inhibit (e.g., partially inhibit) T cell recall response by at least about 25% to about 65%.
  • the T cell exhaustion is assessed by methods described herein.
  • the T cell exhaustion is assessed by methods known to one of skill in the art (e.g., IL-7R M T cell flow cytometry; IL-7R 10 T cell flow cytometry; LAG-3 expression flow cytometry, western blot, northern blot, RT-PCR; CTLA-4 expression flow cytometry, western blot, northern blot, RT- PCR; or TIM-3 expression flow cytometry, western blot, northern blot, RT-PCR).
  • the T cell exhaustion is relative to T cell exhaustion in the presence of stimulation without any anti-PD-1 antibody. In certain embodiments, the T cell exhaustion is relative to T cell exhaustion in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • the T cells are CD4+ T cells. In other embodiments, the T cells are CD8+ T cells. In yet other embodiments, the T cells are CD4+ T cells and CD8+ T cells.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PD1 AB- 2, PD1 AB-3, PD1 AB-4, PD1 AB-5, or PD1 AB-6) specifically bind to PD-1 and reduces IL-7R M T cells.
  • an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and reduces IL-7R hi T cells by at least about 15%. In some embodiments, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 20%. In other embodiments, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and reduces IL-7R T cells by at least about 30%.
  • an antibody provided herein specifically binds to PD-1 and reduces JL-7R T cells by at least about 35%. In some embodiments, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 40%. In another embodiment, an antibody provided herein specifically binds to PD-1 and reduces IL-7R hi T cells by at least about 45%. In one embodiment, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 50%. In other embodiments, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 60%. In some embodiments, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 70%. In another embodiment, an antibody provided herein specifically binds to PD-1 and reduces IL-7R hi T cells by at least about 75%. In one embodiment, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 80%).
  • an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 85%. In another embodiment, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 90%. In other embodiments, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 95%. In one embodiment, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 98%. In another embodiment, an antibody provided herein specifically binds to PD-1 and reduces IL-7R M T cells by at least about 99%.
  • antibodies provided herein specifically bind to PD-1 and reduce IL-7R M T cells by at least about 25% or 35%, optionally to about 75%.
  • the reduction of IL-7R M T cells is assessed by methods described herein.
  • the reduction of IL-7R M T cells is assessed by methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR).
  • the reduction of IL-7R M T cells is assessed by flow cytometry.
  • the reduction of IL-7R hi T cells is assessed by Western blotting.
  • the reduction of IL-7R M T cells is assessed by Northern blotting.
  • the reduction of IL-7R M T cells is assessed by RT-PCR.
  • IL-7R M T cells are reduced relative to IL-7R T cells in the presence of stimulation without any anti-PD-1 antibody.
  • JL-7R T cells are reduced relative to JL-7R T cells in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • the T cells are CD4+ T cells.
  • the T cells are CD8+ T cells.
  • the T cells are CD4+ T cells and CD8+ T cells.
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PDlAB-2, PD1AB-3, PDlAB-4, PDlAB-5, or PDlAB-6) reduces IL-7R M T cells.
  • an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein reduces IL- 7R M T cells with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein reduces IL-7R M T cells with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein reduces IL-7R M T cells with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at most about 0.01 nM. In some embodiments, an anti- PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein reduces IL-7R M T cells with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at least about 50 nM. In other embodiments, an anti-PD- 1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at least about 40 nM.
  • an anti-PD-1 antibody provided herein reduces IL-7R M T cells with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein reduces IL-7R M T cells with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein reduces JL-7R T cells with an EC 50 of at least about 10 nM. In one
  • an anti-PD-1 antibody provided herein reduces rL-7R M T cells with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein reduces IL- 7R M T cells with an EC 50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein reduces JL-7R T cells with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein reduces rL-7R M T cells with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein reduces IL- 7R M T cells with an EC 50 of at least about 0.1 nM.
  • an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody provided herein reduces IL- 7R M T cells with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein reduces IL-7R hi T cells with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein.
  • the EC 50 is assessed by other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the EC 50 is assessed by flow cytometry. In another embodiment, the EC 50 is assessed by Western blotting. In yet another embodiment, the EC 50 is assessed by Northern blotting. In still another embodiment, the EC 50 is assessed by RT-PCR. In some embodiments, the T cells are CD4+ T cells. In other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the EC 50 is assessed by flow cytometry. In another embodiment, the EC 50 is assessed by Western blotting. In yet another embodiment, the EC 50 is assessed by Northern blotting. In still another embodiment, the EC 50 is assessed by RT-PCR. In some embodiments, the T cells are CD4+ T cells. In other methods known to one
  • the T cells are CD8+ T cells. In yet other embodiments, the T cells are CD4+ T cells and CD8+ T cells.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1 AB-4, PD1AB-5, or PD1 AB-6) specifically bind to PD-1 and increase IL-7R 10 T cells.
  • an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 15%. In some embodiments, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 20%. In other embodiments, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 25%). In another embodiment, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 30%>.
  • an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 35%. In some embodiments, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 40%. In another embodiment, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 45%. In one embodiment, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 50%. In other embodiments, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 60%. In some embodiments, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 70%. In another embodiment, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 75%. In one embodiment, an antibody provided herein specifically binds to PD-1 and increases IL- 7R l0 T cells by at least about 80%.
  • an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 85%. In another embodiment, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 90%. In other embodiments, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 95%. In one embodiment, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 98%). In another embodiment, an antibody provided herein specifically binds to PD-1 and increases IL-7R 10 T cells by at least about 99%.
  • antibodies provided herein specifically bind to PD-1 and increase IL-7R 10 T cells by at least about 25% or 35%, optionally to about 75%.
  • the increase of IL-7R 10 T cells is assessed by methods described herein.
  • the increase of IL-7R 10 T cells is assessed by methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR).
  • the increase of IL-7R 10 T cells is assessed by flow cytometry.
  • the increase of IL-7R 0 T cells is assessed by Western blotting.
  • the increase of IL-7R 10 T cells is assessed by Northern blotting.
  • the increase of IL-7R 10 T cells is assessed by RT-PCR.
  • IL-7R 10 T cells are increased relative to IL-7R 10 T cells in the presence of stimulation without any anti-PD-1 antibody.
  • IL-7R 10 T cells are increased relative to IL-7R 10 T cells in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • the T cells are CD4+ T cells.
  • the T cells are CD8+ T cells.
  • the T cells are CD4+ T cells and CD 8+ T cells.
  • an anti-PD-1 antibody provided herein e.g., any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PD1 AB-2, PD1 AB-3, PD1 AB-4, PD1 AB-5, or PD1 AB-6) increases IL-7R 10 T cells.
  • an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein increases IL- 7R l0 T cells with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 10 nM. In another embodiment, an anti- PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein increases IL-7R 0 T cells with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 40 nM.
  • an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 30 nM. In another embodiment, an anti- PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 1 nM.
  • an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein increases IL- 7R l0 T cells with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein increases IL- 7R l0 T cells with an EC 50 of at least about 0.01 nM.
  • an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein increases IL-7R 10 T cells with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the EC 50 is assessed by flow cytometry. In another embodiment, the EC 50 is assessed by Western blotting. In yet another embodiment, the EC 50 is assessed by Northern blotting.
  • the EC 50 is assessed by RT-PCR.
  • the T cells are CD4+ T cells.
  • the T cells are CD8+ T cells.
  • the T cells are CD4+ T cells and CD8+ T cells.
  • Attenuation of T cell activity is indicated by increase of regulatory T cells. In some embodiments, attenuation of T cell activity is indicated by increase of Foxp3+ regulatory T cells. In some embodiments, attenuation of T cell activity is indicated by increase of CD25+Foxp3+ regulatory T cells.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1 AB-4, PD1AB-5, or PD1 AB-6) specifically bind to PD-1 and increase CD25+Foxp3+ regulatory T cells.
  • an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and increases
  • CD25+Foxp3+ regulatory T cells by at least about 10%.
  • an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 15%.
  • an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 20%.
  • an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 25%.
  • an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 30%.
  • an antibody provided herein specifically binds to PD-1 and increases
  • CD25+Foxp3+ regulatory T cells by at least about 35%.
  • an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 40%.
  • an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 45%.
  • an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 50%.
  • an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and increases
  • CD25+Foxp3+ regulatory T cells by at least about 60%. In some embodiments, an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 70%. In another embodiment, an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 75%. In one embodiment, an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 80%.
  • an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 85%. In another embodiment, an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 90%. In other embodiments, an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 95%. In one embodiment, an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 98%. In another embodiment, an antibody provided herein specifically binds to PD-1 and increases CD25+Foxp3+ regulatory T cells by at least about 99%. In specific embodiments, antibodies provided herein specifically bind to PD-1 and increase CD25+Foxp3+ regulatory T cells by at least about 25% or 35%, optionally to about 75%. In some embodiments, antibodies provided herein specifically bind to PD-1 and increase CD25+F
  • the increase of CD25+Foxp3+ regulatory T cells is assessed by methods described herein. In other embodiments, the increase of CD25+Foxp3+ regulatory T cells is assessed by methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the increase of CD25+Foxp3+ regulatory T cells is assessed by flow cytometry. In another embodiment, the increase of CD25+Foxp3+ regulatory T cells is assessed by Western blotting. In yet another embodiment, the increase of CD25+Foxp3+ regulatory T cells is assessed by Northern blotting.
  • methods known to one of skill in the art e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR. In a specific embodiment, the increase of CD25+Foxp3+ regulatory T cells is assessed by flow cytometry. In another embodiment, the increase of CD25+Foxp3+ regulatory T cells is assessed
  • CD25+Foxp3+ regulatory T cells is assessed by RT-PCR.
  • CD25+Foxp3+ regulatory T cells are increased relative to CD25+Foxp3+ regulatory T cells in the presence of stimulation without any anti-PD-1 antibody.
  • CD25+Foxp3+ regulatory T cells are increased relative to CD25+Foxp3+ regulatory T cells in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein e.g., any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PDlAB-2, PD1AB-3, PDlAB-4, PDlAB-5, or PDlAB-6) increases CD25+Foxp3+ regulatory T cells.
  • an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 40 nM.
  • an anti-PD-1 antibody provided herein increases
  • CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 30 nM In some embodiments, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 5 nM. In one embodiment, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 1 nM.
  • an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 0.05 nM. In another
  • an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 50 nM.
  • an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 40 nM. In some embodiments, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein increases
  • an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 10 nM.
  • an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 5 nM.
  • an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 1 nM.
  • an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 0.75 nM.
  • an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 0.01 nM.
  • an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein increases CD25+Foxp3+ regulatory T cells with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the EC 50 is assessed by flow cytometry. In another embodiment, the EC 50 is assessed by Western blotting. In yet another embodiment, the EC 50 is assessed by Northern blotting. In still another embodiment, the EC 50 is assessed by RT-PCR.
  • the cytokine is selected from the group consisting of IL-2, IL-17, IFN- ⁇ , or any combination thereof. In certain embodiments, the cytokine is selected from the group consisting of IL-1, IL-2, IL-6, IL-12, IL-17, IL-22, IL-23, GM-CSF, IFN- ⁇ , and TNF-a. In certain embodiments, the cytokine is IL-1. In some embodiments, the cytokine is IL- 2. In other embodiments, the cytokine is IL-6. In another embodiment, the cytokine is IL-12.
  • the cytokine is IL-17. In yet other embodiments, the cytokine is IL-22. In still other embodiments, the cytokine is IL-23. In some embodiments, the cytokine is GM-CSF. In other embodiments, the cytokine is IFN- ⁇ . In yet other embodiments, the cytokine is TNF-a. In certain embodiments, the cytokine is IL-2 and IL-17. In some embodiments, the cytokine is IL-2 and IFN- ⁇ . In yet other embodiments, the cytokine is IL-17 and IFN- ⁇ . In still other embodiments, the cytokine is IL-2, IL-17, and IFN- ⁇ .
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) specifically bind to PD-1 and inhibit IL-2 secretion (e.g., from a cell, for example, T cells).
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 15%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 20%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 30%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 35%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 40%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 45%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 50%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 60%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 70%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 75%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 80%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 85%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 90%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 95%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 98%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 99%.
  • antibodies provided herein specifically bind to PD-1 and inhibit IL-2 secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of IL-2 secretion is assessed by methods described herein.
  • the inhibition of IL-2 secretion is assessed by methods known to one of skill in the art (e.g., MesoScaleTM Discovery (MSD) multiplex assay).
  • MSD MesoScaleTM Discovery
  • the IL-2 secretion is inhibited relative to IL-2 secretion in the absence of anti-PD-1 antibody.
  • the IL-2 secretion is inhibited relative to IL-2 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PD1 AB-2, PD1 AB-3, PD1 AB-4, PD1 AB-5, or PD1 AB-6) inhibits IL-2 secretion.
  • an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 0.01 nM. In some embodiments, an anti- PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 40 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 10 nM. In one
  • an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 0.1 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL- 2 secretion with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-2 secretion with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC 50 is assessed by MSD multiplex assay.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1 AB-4, PD1AB-5, or PD1 AB-6) specifically bind to PD-1 and inhibit IL-17 secretion (e.g., from a cell, for example, T cells).
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 10%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 15%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 20%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 25%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 30%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 35%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 40%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 45%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 50%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 60%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 65%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 70%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 75%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 80%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 85%). In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 90%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 95%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 98%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 99%.
  • antibodies provided herein specifically bind to PD-1 and inhibit IL-17 secretion by at least about 25% or 35%), optionally to about 75%.
  • the inhibition of IL-17 secretion is assessed by methods described herein.
  • the inhibition of IL-17 secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the IL-17 secretion is inhibited relative to IL-17 secretion in the absence of anti- PD-1 antibody.
  • the IL-17 secretion is inhibited relative to IL-17 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1 AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits IL-17 secretion.
  • an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein inhibits IL- 17 secretion with an EC 50 of at most about 40 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at most about 20 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL- 17 secretion with an EC 50 of at most about 10 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at most about 1 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at most about 0.75 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at most about 0.5 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at most about 0.1 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL- 17 secretion with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at most about 0.005 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at most about 0.001 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 50 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 40 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 20 nM. In one
  • an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 5 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL- 17 secretion with an EC 50 of at least about 0.5 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 0.05 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL- 17 secretion with an EC 50 of at least about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 0.005 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-17 secretion with an EC 50 of at least about 0.001 nM.
  • the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC 50 is assessed by MSD multiplex assay.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1 AB-4, PD1AB-5, or PD1 AB-6) specifically bind to PD-1 and inhibit IFN- ⁇ secretion (e.g., from a cell, for example, T cells).
  • an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 10%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 15%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 20%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 25%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 30%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 35%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 40%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 45%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 50%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 60%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 65%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 70%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 75%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 80%>.
  • an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 85%>. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 90%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 95%>. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 98%>. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 99%>. In specific embodiments, antibodies provided herein
  • the inhibition of IFN- ⁇ secretion is assessed by methods described herein. In other embodiments, the inhibition of IFN- ⁇ secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the IFN- ⁇ secretion is inhibited relative to IFN- ⁇ secretion in the absence of anti-PD-1 antibody. In other embodiments, the IFN- ⁇ secretion is inhibited relative to IFN- ⁇ secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an unrelated antibody e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PD1 AB-2, PD1 AB-3, PD1 AB-4, PD1 AB-5, or PD1 AB-6) inhibits IFN- ⁇ secretion.
  • an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 40 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 20 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 10 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 0.75 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 0.01 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 0.005 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at most about 0.001 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 50 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 40 nM.
  • an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 30 nM. In some embodiments, an anti- PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 20 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 10 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 5 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 1 nM.
  • an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 0.75 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 0.5 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 0.1 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 0.05 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 0.01 nM.
  • an anti- PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 0.005 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IFN- ⁇ secretion with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC 50 is assessed by MSD multiplex assay.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1 AB-4, PD1AB-5, or PD1 AB-6) specifically bind to PD-1 and inhibit IL-1 secretion (e.g., from a cell, for example, T cells).
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 15%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 20%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 30%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 35%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 40%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 45%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 50%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 60%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 70%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 75%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 80%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 85%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 90%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 95%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 98%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 99%.
  • antibodies provided herein specifically bind to PD-1 and inhibit IL-1 secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of IL-1 secretion is assessed by methods described herein.
  • the inhibition of IL-1 secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the IL-1 secretion is inhibited relative to IL-1 secretion in the absence of anti-PD-1 antibody.
  • the IL-1 secretion is inhibited relative to IL-1 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PDlAB-2, PD1AB-3, PDlAB-4, PDlAB-5, or PDlAB-6) inhibits IL-1 secretion.
  • an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 0.01 nM. In some embodiments, an anti- PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 40 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 10 nM. In one
  • an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 0.1 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL- 1 secretion with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-1 secretion with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC 50 is assessed by MSD multiplex assay.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1 AB-4, PD1AB-5, or PD1 AB-6) specifically bind to PD-1 and inhibit IL-6 secretion (e.g., from a cell, for example, T cells).
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 15%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 20%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 30%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 35%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 40%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 45%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 50%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 60%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 70%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 75%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 80%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 85%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 90%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 95%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 98%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 99%.
  • antibodies provided herein specifically bind to PD-1 and inhibit IL-6 secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of IL-6 secretion is assessed by methods described herein.
  • the inhibition of IL-6 secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the IL-6 secretion is inhibited relative to IL-6 secretion in the absence of anti-PD-1 antibody.
  • the IL-6 secretion is inhibited relative to IL-6 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD lAB-1, PD1 AB-2, PD1 AB-3, PD1 AB-4, PD1 AB-5, or PD1 AB-6) inhibits IL-6 secretion.
  • an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 5 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 0.01 nM. In some embodiments, an anti- PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 40 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 10 nM. In one
  • an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 0.1 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL- 6 secretion with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-6 secretion with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC 50 is assessed by MSD multiplex assay.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1 AB-4, PD1AB-5, or PD1 AB-6) specifically bind to PD-1 and inhibit IL-12 secretion (e.g., from a cell, for example, T cells).
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 15%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 20%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 30%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 35%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 40%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 45%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 50%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 60%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 70%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 75%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 80%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 85%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 90%. In one
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 95%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 98%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 99%. In specific embodiments, antibodies provided herein specifically bind to PD-1 and inhibit IL-12 secretion by at least about 25% or 35%, optionally to about 75%. In some embodiments, the inhibition of IL-12 secretion is assessed by methods described herein.
  • the inhibition of IL-12 secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the IL-12 secretion is inhibited relative to IL-12 secretion in the absence of anti-PD-1 antibody.
  • the IL-12 secretion is inhibited relative to IL-12 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody provided herein (e.g., any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen- binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PD1 AB-1, PD1 AB-2, PD1 AB-3, PD1 AB-4, PD1 AB-5, or PD1 AB-6) inhibits IL-12 secretion.
  • an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 50 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 5 nM. In one
  • an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 0.05 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 40 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 1 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody provided herein inhibits IL- 12 secretion with an EC 50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody provided herein inhibits IL- 12 secretion with an EC 50 of at least about 0.01 nM.
  • an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody provided herein inhibits IL-12 secretion with an EC 50 of at least about 0.001 nM. In specific embodiments, the EC 50 is assessed by methods described herein. In other embodiments, the EC 50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC 50 is assessed by MSD multiplex assay.
  • antibodies provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB- 2, PD1AB-3, PD1 AB-4, PD1AB-5, or PD1 AB-6) specifically bind to PD-1 and inhibit IL-22 secretion (e.g., from a cell, for example, a T cell).
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 5%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 10%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 15%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 20%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 25%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 30%).
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 35%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 40%. In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 45%. In other embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 50%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 55%.
  • an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 60%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 65%. In one embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 70%). In another embodiment, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 75%. In some embodiments, an antibody provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 80%.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Endocrinology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Pulmonology (AREA)
  • Dermatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
PCT/US2017/052021 2016-09-19 2017-09-18 Methods of treating immune disorders using pd-1 binding proteins Ceased WO2018053405A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
MX2019002867A MX2019002867A (es) 2016-09-19 2017-09-18 Metodos de tratamiento de trastornos inmunologicos usando proteinas de union a pd-1.
BR112019004733A BR112019004733A2 (pt) 2016-09-19 2017-09-18 métodos de tratamento de distúrbios imunes usando proteínas de ligação a pd-1
KR1020197007885A KR102257154B1 (ko) 2016-09-19 2017-09-18 Pd-1 결합 단백질을 사용하는 면역 질환의 치료 방법
JP2019513745A JP2019531284A (ja) 2016-09-19 2017-09-18 Pd−1結合タンパク質を使用して免疫障害を治療する方法
AU2017329024A AU2017329024A1 (en) 2016-09-19 2017-09-18 Methods of treating immune disorders using pd-1 binding proteins
EA201990747A EA201990747A1 (ru) 2016-09-19 2017-09-18 Способы лечения иммунных нарушений с применением белков, связывающих pd–1
CA3036701A CA3036701A1 (en) 2016-09-19 2017-09-18 Methods of treating immune disorders using pd-1 binding proteins
CN201780068836.7A CN109952317A (zh) 2016-09-19 2017-09-18 使用pd-1结合蛋白治疗免疫病症的方法
EP17851703.3A EP3515944A4 (en) 2016-09-19 2017-09-18 METHODS OF TREATING IMMUNE DISORDERS WITH PD-1 BINDING PROTEINS
SG11201901950TA SG11201901950TA (en) 2016-09-19 2017-09-18 Methods of treating immune disorders using pd-1 binding proteins
IL265197A IL265197A (en) 2016-09-19 2019-03-06 Methods of treating immune disorders using pd-1 binding proteins

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662396736P 2016-09-19 2016-09-19
US62/396,736 2016-09-19

Publications (1)

Publication Number Publication Date
WO2018053405A1 true WO2018053405A1 (en) 2018-03-22

Family

ID=61620166

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/052021 Ceased WO2018053405A1 (en) 2016-09-19 2017-09-18 Methods of treating immune disorders using pd-1 binding proteins

Country Status (14)

Country Link
US (2) US10751414B2 (enExample)
EP (1) EP3515944A4 (enExample)
JP (1) JP2019531284A (enExample)
KR (1) KR102257154B1 (enExample)
CN (1) CN109952317A (enExample)
AU (1) AU2017329024A1 (enExample)
BR (1) BR112019004733A2 (enExample)
CA (1) CA3036701A1 (enExample)
CL (1) CL2019000622A1 (enExample)
EA (1) EA201990747A1 (enExample)
IL (1) IL265197A (enExample)
MX (1) MX2019002867A (enExample)
SG (1) SG11201901950TA (enExample)
WO (1) WO2018053405A1 (enExample)

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3355920A4 (en) * 2015-09-29 2019-05-15 Celgene Corporation PD-1 BINDING PROTEINS AND METHOD OF USE THEREOF
WO2019213660A2 (en) 2018-05-04 2019-11-07 The Broad Institute, Inc. Compositions and methods for modulating cgrp signaling to regulate innate lymphoid cell inflammatory responses
WO2020186235A1 (en) 2019-03-14 2020-09-17 The Broad Institute, Inc. Compositions and methods for modulating cgrp signaling to regulate intestinal innate lymphoid cells
WO2020186101A1 (en) 2019-03-12 2020-09-17 The Broad Institute, Inc. Detection means, compositions and methods for modulating synovial sarcoma cells
EP3601338A4 (en) * 2017-03-29 2020-12-16 Celgene Corporation FORMULATIONS INCLUDING PROTEINS BINDING PD-1 AND THEIR PREPARATION METHODS
WO2021155132A1 (en) * 2020-01-29 2021-08-05 University Of Washington De novo stable, modular pd-1 binding proteins and oligomeric variants
US11155619B2 (en) 2015-11-18 2021-10-26 Merck Sharp & Dohme Corp. PD1 and/or LAG3 binders
US11732043B2 (en) 2017-07-06 2023-08-22 Merus N.V. Antibodies that modulate a biological activity expressed by a cell
US11746161B2 (en) 2017-06-05 2023-09-05 Janssen Biotech, Inc. Antibodies that specifically bind PD-1 and methods of use
US11993654B2 (en) 2021-03-31 2024-05-28 Merus N.V. PD-1 binding domains
US12312405B2 (en) 2020-05-26 2025-05-27 Boehringer Ingelheim International Gmbh Anti-PD-1 antibodies
US12398209B2 (en) 2018-01-22 2025-08-26 Janssen Biotech, Inc. Methods of treating cancers with antagonistic anti-PD-1 antibodies

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2019534859A (ja) 2016-09-19 2019-12-05 セルジーン コーポレイション Pd−1結合タンパク質を使用して白斑を治療する方法
JP7165717B2 (ja) 2017-03-15 2022-11-04 パンディオン・オペレーションズ・インコーポレイテッド 標的免疫寛容
MX2019013517A (es) 2017-05-24 2020-08-17 Pandion Operations Inc Inmunotolerancia dirigida.
US10174091B1 (en) 2017-12-06 2019-01-08 Pandion Therapeutics, Inc. IL-2 muteins
US10946068B2 (en) 2017-12-06 2021-03-16 Pandion Operations, Inc. IL-2 muteins and uses thereof
MX2021000239A (es) 2018-07-10 2021-03-25 Regeneron Pharma Modificacion de moleculas de union para minimizar interacciones preexistentes.
EP3972992A4 (en) 2019-05-20 2023-07-19 Pandion Operations, Inc. MADCAM TARGETED IMMUNOTLERANCE
WO2021168079A1 (en) 2020-02-21 2021-08-26 Pandion Operations, Inc. Tissue targeted immunotolerance with a cd39 effector
US20230183347A1 (en) * 2020-05-25 2023-06-15 Foundation For Biomedical Research And Innovation At Kobe PD-1 Agonist-Containing Pharmaceutical Composition for Treating or PReventing TH2-Mediated Disease

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090280116A1 (en) * 2007-11-13 2009-11-12 Cogenesys, Inc. Humanized antibodies against tl1a
US20120100139A1 (en) * 2008-10-02 2012-04-26 Emergent Product Development Seattle, Llc CD86 Antagonist Multi-Target Binding Proteins
US20140161794A1 (en) * 2010-04-16 2014-06-12 Biogen Idec Ma Inc. Anti-vla-4 antibodies
US20160068586A1 (en) * 2010-03-11 2016-03-10 Ucb Biopharma Sprl Pd-1 antibodies
US20170088618A1 (en) * 2015-09-29 2017-03-30 Celgene Corporation Pd-1 binding proteins and methods of use thereof

Family Cites Families (189)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
JPS6023084B2 (ja) 1979-07-11 1985-06-05 味の素株式会社 代用血液
US4640835A (en) 1981-10-30 1987-02-03 Nippon Chemiphar Company, Ltd. Plasminogen activator derivatives
ATE37983T1 (de) 1982-04-22 1988-11-15 Ici Plc Mittel mit verzoegerter freigabe.
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4496689A (en) 1983-12-27 1985-01-29 Miles Laboratories, Inc. Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer
US5128326A (en) 1984-12-06 1992-07-07 Biomatrix, Inc. Drug delivery systems based on hyaluronans derivatives thereof and their salts and methods of producing same
EP0206448B1 (en) 1985-06-19 1990-11-14 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
IL85035A0 (en) 1987-01-08 1988-06-30 Int Genetic Eng Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same
AU600575B2 (en) 1987-03-18 1990-08-16 Sb2, Inc. Altered antibodies
DE3853515T3 (de) 1987-05-21 2005-08-25 Micromet Ag Multifunktionelle proteine mit vorbestimmter zielsetzung.
US5258498A (en) 1987-05-21 1993-11-02 Creative Biomolecules, Inc. Polypeptide linkers for production of biosynthetic proteins
US5336603A (en) 1987-10-02 1994-08-09 Genentech, Inc. CD4 adheson variants
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
KR900005995A (ko) 1988-10-31 1990-05-07 우메모또 요시마사 변형 인터류킨-2 및 그의 제조방법
EP0394827A1 (en) 1989-04-26 1990-10-31 F. Hoffmann-La Roche Ag Chimaeric CD4-immunoglobulin polypeptides
US5112946A (en) 1989-07-06 1992-05-12 Repligen Corporation Modified pf4 compositions and methods of use
WO1991005548A1 (en) 1989-10-10 1991-05-02 Pitman-Moore, Inc. Sustained release composition for macromolecular proteins
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
WO1991006570A1 (en) 1989-10-25 1991-05-16 The University Of Melbourne HYBRID Fc RECEPTOR MOLECULES
AU642932B2 (en) 1989-11-06 1993-11-04 Alkermes Controlled Therapeutics, Inc. Protein microspheres and methods of using them
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5349053A (en) 1990-06-01 1994-09-20 Protein Design Labs, Inc. Chimeric ligand/immunoglobulin molecules and their uses
WO1992009690A2 (en) 1990-12-03 1992-06-11 Genentech, Inc. Enrichment method for variant proteins with altered binding properties
AU643109B2 (en) 1990-12-14 1993-11-04 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US6800738B1 (en) 1991-06-14 2004-10-05 Genentech, Inc. Method for making humanized antibodies
WO1994004679A1 (en) 1991-06-14 1994-03-03 Genentech, Inc. Method for making humanized antibodies
EP0590058B1 (en) 1991-06-14 2003-11-26 Genentech, Inc. HUMANIZED Heregulin ANTIBODy
US5844095A (en) 1991-06-27 1998-12-01 Bristol-Myers Squibb Company CTLA4 Ig fusion proteins
JP3540315B2 (ja) 1991-09-23 2004-07-07 メディカル リサーチ カウンシル キメラ抗体の製造−組合せアプローチ
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
FI941572L (fi) 1991-10-07 1994-05-27 Oncologix Inc Anti-erbB-2-monoklonaalisten vasta-aineiden yhdistelmä ja käyttömenetelmä
AU3178993A (en) 1991-11-25 1993-06-28 Enzon, Inc. Multivalent antigen-binding proteins
DE69233204T2 (de) 1991-12-13 2004-07-15 Xoma Corp., Berkeley Verfahren und materialien zur herstellung von modifizierten variablen antikörperdomänen und ihre therapeutische verwendung
US5869619A (en) 1991-12-13 1999-02-09 Xoma Corporation Modified antibody variable domains
US5622929A (en) 1992-01-23 1997-04-22 Bristol-Myers Squibb Company Thioether conjugates
ATE419355T1 (de) 1992-02-06 2009-01-15 Novartis Vaccines & Diagnostic Marker für krebs und biosynthetisches bindeprotein dafür
US5912015A (en) 1992-03-12 1999-06-15 Alkermes Controlled Therapeutics, Inc. Modulated release from biocompatible polymers
US5447851B1 (en) 1992-04-02 1999-07-06 Univ Texas System Board Of Dna encoding a chimeric polypeptide comprising the extracellular domain of tnf receptor fused to igg vectors and host cells
GB9225453D0 (en) 1992-12-04 1993-01-27 Medical Res Council Binding proteins
EP0672142B1 (en) 1992-12-04 2001-02-28 Medical Research Council Multivalent and multispecific binding proteins, their manufacture and use
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
US7435802B2 (en) 1994-01-25 2008-10-14 Elan Pharaceuticals, Inc. Humanized anti-VLA4 immunoglobulins
IL108501A (en) 1994-01-31 1998-10-30 Mor Research Applic Ltd Antibodies and pharmaceutical compositions containing them
US5837458A (en) 1994-02-17 1998-11-17 Maxygen, Inc. Methods and compositions for cellular and metabolic engineering
US5834252A (en) 1995-04-18 1998-11-10 Glaxo Group Limited End-complementary polymerase reaction
US5605793A (en) 1994-02-17 1997-02-25 Affymax Technologies N.V. Methods for in vitro recombination
CA2143491C (en) 1994-03-01 2011-02-22 Yasumasa Ishida A novel peptide related to human programmed cell death and dna encoding it
AU3382595A (en) 1994-07-29 1996-03-04 Smithkline Beecham Corporation Novel compounds
GB9415379D0 (en) 1994-07-29 1994-09-21 Smithkline Beecham Plc Novel compounds
EP0805678B1 (en) 1995-01-05 2003-10-29 THE BOARD OF REGENTS acting for and on behalf of THE UNIVERSITY OF MICHIGAN Surface-modified nanoparticles and method of making and using same
US6030613A (en) 1995-01-17 2000-02-29 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of therapeutics
ATE238668T1 (de) 1995-01-17 2003-05-15 Brigham & Womens Hospital Rezeptorspezifischer transepithelialer transport von immunogenen
US5739277A (en) 1995-04-14 1998-04-14 Genentech Inc. Altered polypeptides with increased half-life
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
AU710347B2 (en) 1995-08-31 1999-09-16 Alkermes Controlled Therapeutics, Inc. Composition for sustained release of an agent
US5723125A (en) 1995-12-28 1998-03-03 Tanox Biosystems, Inc. Hybrid with interferon-alpha and an immunoglobulin Fc linked through a non-immunogenic peptide
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
GB9701425D0 (en) 1997-01-24 1997-03-12 Bioinvent Int Ab A method for in vitro molecular evolution of protein function
US5989463A (en) 1997-09-24 1999-11-23 Alkermes Controlled Therapeutics, Inc. Methods for fabricating polymer-based controlled release devices
SE512663C2 (sv) 1997-10-23 2000-04-17 Biogram Ab Inkapslingsförfarande för aktiv substans i en bionedbrytbar polymer
US20060029600A1 (en) 1998-01-21 2006-02-09 Elan Pharmaceuticals, Inc. Treatment of viral encephalitis by agents blocking alpha-VLA-4 integrin function
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
DE69937291T2 (de) 1998-04-02 2008-07-10 Genentech, Inc., South San Francisco Antikörpervarianten und fragmente davon
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
BR0008758A (pt) 1999-01-15 2001-12-04 Genentech Inc Variantes de polipeptìdeos parentais com funçãoefetora alterada, polipeptìdeos, composição ácidonucleico isolado, vetor, célula hospedeira,método para produzir uma variante depolipeptìdeo, método para o tratamento de umadesordem em mamìferos e método para produziruma região fc variante
US7183387B1 (en) 1999-01-15 2007-02-27 Genentech, Inc. Polypeptide variants with altered effector function
EP1210428B1 (en) 1999-08-23 2015-03-18 Dana-Farber Cancer Institute, Inc. Pd-1, a receptor for b7-4, and uses therefor
US7605238B2 (en) 1999-08-24 2009-10-20 Medarex, Inc. Human CTLA-4 antibodies and their uses
JP2004501624A (ja) 2000-06-28 2004-01-22 ジェネティックス・インスチチュート・リミテッド・ライアビリティ・カンパニー Pd−l2分子:新規pd−1リガンドおよびその使用
EP2388590A1 (en) 2001-04-02 2011-11-23 Dana Farber Cancer Institute PD-1, a receptor for B7-4, and uses thereof
AR036993A1 (es) 2001-04-02 2004-10-20 Wyeth Corp Uso de agentes que modulan la interaccion entre pd-1 y sus ligandos en la submodulacion de respuestas inmunologicas
US20040241745A1 (en) 2001-07-31 2004-12-02 Tasuku Honjo Substance specific to pd-1
ES2405551T3 (es) 2001-10-01 2013-05-31 Dyax Corporation Vectores de presentación eucariotas multicatenarios y usos de los mismos
US20040005709A1 (en) 2001-10-24 2004-01-08 Hoogenboom Henricus Renerus Jacobus Mattheus Hybridization control of sequence variation
IL149820A0 (en) 2002-05-23 2002-11-10 Curetech Ltd Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency
CA2488441C (en) 2002-06-03 2015-01-27 Genentech, Inc. Synthetic antibody phage libraries
AU2003281200A1 (en) 2002-07-03 2004-01-23 Tasuku Honjo Immunopotentiating compositions
AR040778A1 (es) 2002-08-06 2005-04-20 Glaxo Group Ltd Anticuerpos alterados o fragmentos funcionales que se unen a mag (glicoproteina asociada a mielina).
CN101899114A (zh) 2002-12-23 2010-12-01 惠氏公司 抗pd-1抗体及其用途
EP1591527B1 (en) 2003-01-23 2015-08-26 Ono Pharmaceutical Co., Ltd. Substance specific to human pd-1
GB0400440D0 (en) 2004-01-09 2004-02-11 Isis Innovation Receptor modulators
PT3428191T (pt) 2004-10-06 2024-12-30 Mayo Found Medical Education & Res B7-h1 e tratamento do carcinona de células renais
CN109485727A (zh) 2005-05-09 2019-03-19 小野药品工业株式会社 程序性死亡-1(pd-1)的人单克隆抗体及使用抗pd-1抗体来治疗癌症的方法
EP3130350A1 (en) 2005-06-08 2017-02-15 Dana-Farber Cancer Institute, Inc. Methods and compositions for the treatment of persistent infections and cancer by inhibiting the programmed cell death 1 (pd-1)pathway
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
US8603930B2 (en) 2005-10-07 2013-12-10 Sulzer Metco (Us), Inc. High-purity fused and crushed zirconia alloy powder and method of producing same
CN105837690A (zh) 2006-06-12 2016-08-10 新兴产品开发西雅图有限公司 具有效应功能的单链多价结合蛋白
WO2008047914A1 (fr) 2006-10-20 2008-04-24 Forerunner Pharma Research Co., Ltd. Agent anticancéreux comprenant un anticorps anti-hb-egf en tant qu'ingrédient actif
AU2007331672A1 (en) 2006-12-15 2008-06-19 Ablynx N.V. Amino acid sequences that modulate the interaction between cells of the immune system
JP2010520748A (ja) 2007-02-20 2010-06-17 アナプティスバイオ インコーポレイティッド 体細胞超変異系
WO2008145142A1 (en) 2007-05-31 2008-12-04 Genmab A/S Stable igg4 antibodies
NZ600758A (en) 2007-06-18 2013-09-27 Merck Sharp & Dohme Antibodies to human programmed death receptor pd-1
EP2195347A1 (en) 2007-08-17 2010-06-16 INSERM (Institut National de la Santé et de la Recherche Médicale) Method for treating and diagnosing hematologic malignancies
PL2242773T3 (pl) 2008-02-11 2017-11-30 Cure Tech Ltd. Przeciwciała monoklonalne do leczenia nowotworu
EP2262837A4 (en) 2008-03-12 2011-04-06 Merck Sharp & Dohme PD-1 BINDING PROTEINS
EP2604280A3 (en) 2008-03-27 2013-10-16 ZymoGenetics, Inc. Compositions and methods for inhibiting PDGFRBETA and VEGF-A
EP2342228B1 (en) 2008-09-12 2017-09-06 Oxford University Innovation Limited Pd-1 specific antibodies and uses thereof
EP2342229A1 (en) 2008-09-12 2011-07-13 ISIS Innovation Limited Pd-1 specific antibodies and uses thereof
ES2592216T3 (es) 2008-09-26 2016-11-28 Dana-Farber Cancer Institute, Inc. Anticuerpos anti-PD-1, PD-L1 y PD-L2 humanos y sus usos
EP3153524B1 (en) 2008-12-03 2025-04-23 Genmab A/S Antibody variants having modifications in the constant region
US8741295B2 (en) 2009-02-09 2014-06-03 Universite De La Mediterranee PD-1 antibodies and PD-L1 antibodies and uses thereof
WO2011100841A1 (en) 2010-02-16 2011-08-25 Valorisation-Recherche, Limited Partnership Pd-1 modulation and uses thereof for modulating hiv replication
EP2545078A1 (en) 2010-03-11 2013-01-16 UCB Pharma, S.A. Pd-1 antibody
US20180237525A9 (en) 2010-03-26 2018-08-23 Randolph J. Noelle VISTA Agonist and Methods of Use
US9220776B2 (en) 2011-03-31 2015-12-29 Merck Sharp & Dohme Corp. Stable formulations of antibodies to human programmed death receptor PD-1 and related treatments
PL2699264T3 (pl) 2011-04-20 2018-08-31 Medimmune, Llc Przeciwciała i inne cząsteczki wiążące B7-H1 i PD-1
WO2013006449A2 (en) 2011-07-01 2013-01-10 The Trustees Of The University Of Pennsylvania Anti-properdin antibodies and uses thereof
LT2734551T (lt) 2011-07-24 2018-04-10 Cure Tech Ltd. Humanizuotų imunomoduliuojančių monokloninių antikūnų variantai
WO2013022091A1 (ja) 2011-08-11 2013-02-14 小野薬品工業株式会社 Pd-1アゴニストからなる自己免疫疾患治療剤
WO2013078230A1 (en) 2011-11-23 2013-05-30 The Trustees Of The University Of Pennsylvania Use of pdl1 expressing cells to convert t cells into regulatory t cells
WO2013142255A2 (en) 2012-03-22 2013-09-26 University Of Miami Multi-specific binding agents
WO2013177102A2 (en) 2012-05-21 2013-11-28 Felder Mitchell S Treatment of cancer by manipulating the immune system
TWI677507B (zh) 2012-06-22 2019-11-21 達特茅斯學院基金會 新穎之vista-ig構築體及vista-ig用於治療自體免疫、過敏及發炎病症之用途
ES3012536T3 (en) 2012-08-03 2025-04-09 Dana Farber Cancer Inst Inc Antibody against repulsive guidance molecule b (rgmb)
EP2948475A2 (en) 2013-01-23 2015-12-02 AbbVie Inc. Methods and compositions for modulating an immune response
US9657082B2 (en) 2013-01-31 2017-05-23 Thomas Jefferson University PD-L1 and PD-L2-based fusion proteins and uses thereof
WO2014122271A1 (en) 2013-02-07 2014-08-14 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for predicting the survival time of patients suffering from diffuse large b-cell lymphomas
KR20210108497A (ko) 2013-02-26 2021-09-02 메모리얼 슬로안 케터링 캔서 센터 면역치료용 조성물 및 방법
MX368665B (es) 2013-03-15 2019-10-10 Abbvie Biotherapeutics Inc Variantes de fc.
CA3093606A1 (en) 2013-03-15 2014-09-18 Xencor, Inc. Heterodimeric proteins for induction of t cells
WO2014161509A1 (en) 2013-04-05 2014-10-09 The University Of Hong Kong Novel pd1 isoforms, and uses thereof for potentiating immune responses
HRP20210122T1 (hr) 2013-05-02 2021-04-16 Anaptysbio, Inc. Protutijela usmjerena protiv programirane smrti-1 (pd-1)
CN111423511B (zh) 2013-05-31 2024-02-23 索伦托药业有限公司 与pd-1结合的抗原结合蛋白
EP3010528B1 (en) 2013-06-19 2019-09-11 Massachusetts Institute of Technology In vivo targeting of cells with ligand-conjugated particles
CN104250302B (zh) 2013-06-26 2017-11-14 上海君实生物医药科技股份有限公司 抗pd‑1抗体及其应用
WO2015002985A2 (en) 2013-07-01 2015-01-08 University Of Maryland Fc coupled compositions and methods of their use
WO2015038538A1 (en) 2013-09-10 2015-03-19 Medimmune, Llc Compositions and methods for treating sepsis
WO2015036394A1 (en) 2013-09-10 2015-03-19 Medimmune Limited Antibodies against pd-1 and uses thereof
ES2792183T3 (es) 2013-09-13 2020-11-10 Beigene Switzerland Gmbh Anticuerpos anti-PD1 y su uso como productos terapéuticos y de diagnóstico
RS59880B1 (sr) 2013-09-27 2020-03-31 Hoffmann La Roche Formulacije za anti-pdl1 antitelo
US10259875B2 (en) 2013-10-01 2019-04-16 Mayo Foundation For Medical Education And Research Methods for treating cancer in patients with elevated levels of BIM
CN104558177B (zh) 2013-10-25 2020-02-18 苏州思坦维生物技术股份有限公司 拮抗抑制程序性死亡受体pd-1与其配体结合的单克隆抗体及其编码序列与用途
MA39061A1 (fr) 2013-11-20 2017-10-31 Regeneron Pharma Modulateurs d'aplnr et leurs utilisations
PE20160953A1 (es) 2013-12-12 2016-09-26 Shanghai hengrui pharmaceutical co ltd Anticuerpo pd-1, fragmento de union al antigeno de este y uso medico de este
US9067998B1 (en) 2014-07-15 2015-06-30 Kymab Limited Targeting PD-1 variants for treatment of cancer
US9914769B2 (en) 2014-07-15 2018-03-13 Kymab Limited Precision medicine for cholesterol treatment
ES2923641T3 (es) 2013-12-30 2022-09-29 Epimab Biotherapeutics Inc Inmunoglobulina con Fabs en tándem y usos de la misma
JP2016530244A (ja) 2013-12-31 2016-09-29 ディベロップメント センター フォー バイオテクノロジーDevelopment Center For Biotechnology 抗vegf抗体及びその使用
TWI681969B (zh) 2014-01-23 2020-01-11 美商再生元醫藥公司 針對pd-1的人類抗體
JOP20200094A1 (ar) * 2014-01-24 2017-06-16 Dana Farber Cancer Inst Inc جزيئات جسم مضاد لـ pd-1 واستخداماتها
WO2015119841A1 (en) 2014-02-05 2015-08-13 Merck Sharp & Dohme Corp. Role of il-23 and pd-1 in autoreactive immune response
US20170015975A1 (en) 2014-02-10 2017-01-19 Nvigen, Inc. Cell modulation nanocomposition, and methods of use
JP6606505B2 (ja) 2014-03-11 2019-11-13 ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー 抗SIRPα抗体および二重特異性マクロファージ増強抗体
US10519237B2 (en) 2014-03-12 2019-12-31 Yeda Research And Development Co. Ltd Reducing systemic regulatory T cell levels or activity for treatment of disease and injury of the CNS
WO2017042633A2 (en) 2015-09-10 2017-03-16 Yeda Research And Development Co. Ltd Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the cns
ES3040431T3 (en) 2014-03-12 2025-10-31 Yeda Res & Dev Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the cns
US9394365B1 (en) 2014-03-12 2016-07-19 Yeda Research And Development Co., Ltd Reducing systemic regulatory T cell levels or activity for treatment of alzheimer's disease
WO2015145360A1 (en) 2014-03-24 2015-10-01 Glennie Martin J Modified antibodies containing modified igg2 domains which elicit agonist or antagonistic properties and use thereof
WO2015195163A1 (en) 2014-06-20 2015-12-23 R-Pharm Overseas, Inc. Pd-l1 antagonist fully human antibody
TWI693232B (zh) 2014-06-26 2020-05-11 美商宏觀基因股份有限公司 與pd-1和lag-3具有免疫反應性的共價結合的雙抗體和其使用方法
WO2016011069A1 (en) 2014-07-15 2016-01-21 The Board Of Trustees Of The Leland Stanford Junior University Medical uses of cd38 agonists (antibodies)
SG11201700496WA (en) 2014-07-22 2017-02-27 Cb Therapeutics Inc Anti-pd-1 antibodies
WO2016014799A1 (en) 2014-07-23 2016-01-28 University Of Iowa Research Foundation Epidermal growth factor and blockade of immune checkpoints in cancer immunotherapy
CN105330740B (zh) 2014-07-30 2018-08-17 珠海市丽珠单抗生物技术有限公司 抗pd-1抗体及其应用
CA2957258C (en) 2014-08-05 2023-11-07 MabQuest SA Immunological reagents
GB201419084D0 (en) 2014-10-27 2014-12-10 Agency Science Tech & Res Anti-PD-1 antibodies
US10822414B2 (en) 2014-11-11 2020-11-03 Sutro Biopharma, Inc. Anti-PD-1 antibodies, compositions comprising anti-PD-1 antibodies and methods of using anti-PD-1 antibodies
TWI595006B (zh) 2014-12-09 2017-08-11 禮納特神經系統科學公司 抗pd-1抗體類和使用彼等之方法
CA2971734C (en) 2014-12-22 2025-11-18 Enumeral Biomedical Holdings Inc Anti-pd-1 antibodies
JP2018506280A (ja) 2015-02-06 2018-03-08 カドモン コーポレイション,リミティド ライアビリティ カンパニー 免疫調節薬
AR103726A1 (es) 2015-02-27 2017-05-31 Merck Sharp & Dohme Cristales de anticuerpos monoclonales anti-pd-1 humanos
NZ735820A (en) 2015-04-17 2025-02-28 Bristol Myers Squibb Co Compositions comprising a combination of an anti-pd-1 antibody and another antibody
CN105061597B (zh) 2015-06-09 2016-04-27 北京东方百泰生物科技有限公司 一种抗pd-1的单克隆抗体及其获得方法
HK1254803A1 (zh) 2015-06-23 2019-07-26 Memorial Sloan Kettering Cancer Center 新型pd -1的免疫调节剂
EP3322732A2 (en) 2015-07-13 2018-05-23 Cytomx Therapeutics Inc. Anti-pd-1 antibodies, activatable anti-pd-1 antibodies, and methods of use thereof
CN106699888B (zh) 2015-07-28 2020-11-06 上海昀怡健康科技发展有限公司 一种pd-1抗体及其制备方法和应用
CN116333138A (zh) 2015-07-30 2023-06-27 宏观基因有限公司 Pd-1结合分子和其使用方法
WO2017021910A1 (en) 2015-08-04 2017-02-09 Glaxosmithkline Intellectual Property Development Limited Combination treatments and uses and methods thereof
WO2017024465A1 (en) 2015-08-10 2017-02-16 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017024515A1 (en) 2015-08-11 2017-02-16 Wuxi Biologics (Cayman) Inc. Novel anti-pd-1 antibodies
FI3334763T3 (fi) 2015-08-11 2024-10-30 Wuxi Biologics Ireland Ltd Uusia pd-l1-vasta-aineita
HK1257840A1 (zh) 2015-09-01 2019-11-01 Agenus Inc. 抗-pd-1抗体及其使用方法
LU92821B1 (en) 2015-09-09 2017-03-20 Mologen Ag Combination comprising immunostimulatory oligonucleotides
US10786567B2 (en) 2015-09-28 2020-09-29 Suzhou Suncediabiopharmaeuticals Co., Ltd. Stable anti-PD-1 antibody pharmaceutical preparation and application thereof in medicine
US10981991B2 (en) 2015-09-29 2021-04-20 Shanghai Zhangjiang Biotechnology Co., Ltd. PD-1 antibodies and uses thereof
US11034765B2 (en) 2015-10-02 2021-06-15 Symphogen A/S Anti-PD-1 antibodies and compositions
CA2997799A1 (en) 2015-10-02 2017-04-06 F. Hoffmann-La Roche Ag Anti-pd1 antibodies and methods of use
US11207393B2 (en) 2015-10-16 2021-12-28 President And Fellows Of Harvard College Regulatory T cell PD-1 modulation for regulating T cell effector immune responses
CN107586342A (zh) 2016-07-08 2018-01-16 生命序有限公司 重组免疫检查点受体及其应用
JP2019534859A (ja) 2016-09-19 2019-12-05 セルジーン コーポレイション Pd−1結合タンパク質を使用して白斑を治療する方法
US20180289802A1 (en) 2017-03-29 2018-10-11 Celgene Corporation Formulations comprising pd-1 binding proteins and methods of making thereof
CN107137712A (zh) 2017-05-09 2017-09-08 中山大学 Pd‑1h激动剂或拮抗剂的应用

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090280116A1 (en) * 2007-11-13 2009-11-12 Cogenesys, Inc. Humanized antibodies against tl1a
US20120100139A1 (en) * 2008-10-02 2012-04-26 Emergent Product Development Seattle, Llc CD86 Antagonist Multi-Target Binding Proteins
US20160068586A1 (en) * 2010-03-11 2016-03-10 Ucb Biopharma Sprl Pd-1 antibodies
US20140161794A1 (en) * 2010-04-16 2014-06-12 Biogen Idec Ma Inc. Anti-vla-4 antibodies
US20170088618A1 (en) * 2015-09-29 2017-03-30 Celgene Corporation Pd-1 binding proteins and methods of use thereof

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3515944A4 *

Cited By (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3355920A4 (en) * 2015-09-29 2019-05-15 Celgene Corporation PD-1 BINDING PROTEINS AND METHOD OF USE THEREOF
US11168136B2 (en) 2015-11-18 2021-11-09 Merck Sharp & Dohme Corp. PD1 and/or LAG3 binders
US12351630B2 (en) 2015-11-18 2025-07-08 Merck Sharp & Dohme Llc PD1 and/or LAG3 binders
US11168135B2 (en) 2015-11-18 2021-11-09 Merck Sharp & Dohme Corp. PD1 and/or LAG3 binders
US11155619B2 (en) 2015-11-18 2021-10-26 Merck Sharp & Dohme Corp. PD1 and/or LAG3 binders
EP3601338A4 (en) * 2017-03-29 2020-12-16 Celgene Corporation FORMULATIONS INCLUDING PROTEINS BINDING PD-1 AND THEIR PREPARATION METHODS
US11746161B2 (en) 2017-06-05 2023-09-05 Janssen Biotech, Inc. Antibodies that specifically bind PD-1 and methods of use
US11732043B2 (en) 2017-07-06 2023-08-22 Merus N.V. Antibodies that modulate a biological activity expressed by a cell
US12398209B2 (en) 2018-01-22 2025-08-26 Janssen Biotech, Inc. Methods of treating cancers with antagonistic anti-PD-1 antibodies
WO2019213660A2 (en) 2018-05-04 2019-11-07 The Broad Institute, Inc. Compositions and methods for modulating cgrp signaling to regulate innate lymphoid cell inflammatory responses
WO2020186101A1 (en) 2019-03-12 2020-09-17 The Broad Institute, Inc. Detection means, compositions and methods for modulating synovial sarcoma cells
WO2020186235A1 (en) 2019-03-14 2020-09-17 The Broad Institute, Inc. Compositions and methods for modulating cgrp signaling to regulate intestinal innate lymphoid cells
WO2021155132A1 (en) * 2020-01-29 2021-08-05 University Of Washington De novo stable, modular pd-1 binding proteins and oligomeric variants
US12312405B2 (en) 2020-05-26 2025-05-27 Boehringer Ingelheim International Gmbh Anti-PD-1 antibodies
US11993654B2 (en) 2021-03-31 2024-05-28 Merus N.V. PD-1 binding domains

Also Published As

Publication number Publication date
IL265197A (en) 2019-05-30
AU2017329024A1 (en) 2019-03-21
CA3036701A1 (en) 2018-03-22
US10751414B2 (en) 2020-08-25
EA201990747A1 (ru) 2019-10-31
US20180092975A1 (en) 2018-04-05
CL2019000622A1 (es) 2019-07-26
MX2019002867A (es) 2019-11-12
KR102257154B1 (ko) 2021-05-28
JP2019531284A (ja) 2019-10-31
SG11201901950TA (en) 2019-04-29
EP3515944A1 (en) 2019-07-31
US20210069325A1 (en) 2021-03-11
EP3515944A4 (en) 2020-05-06
CN109952317A (zh) 2019-06-28
BR112019004733A2 (pt) 2019-05-28
KR20190069399A (ko) 2019-06-19

Similar Documents

Publication Publication Date Title
US10751414B2 (en) Methods of treating psoriasis using PD-1 binding antibodies
US20230272076A1 (en) PD-1 Binding Proteins and Methods of Use Thereof
US12084499B2 (en) SIRP-α binding proteins and methods of use thereof
US10766958B2 (en) Methods of treating vitiligo using PD-1 binding antibodies
US20180289802A1 (en) Formulations comprising pd-1 binding proteins and methods of making thereof
US11591390B2 (en) SIRP-α binding proteins and methods of use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17851703

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2019513745

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3036701

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: DZP2019000112

Country of ref document: DZ

ENP Entry into the national phase

Ref document number: 20197007885

Country of ref document: KR

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017329024

Country of ref document: AU

Date of ref document: 20170918

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019004733

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2017851703

Country of ref document: EP

Effective date: 20190423

ENP Entry into the national phase

Ref document number: 112019004733

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190311