WO2018022762A1 - Methods and compositions for treating myelofibrosis - Google Patents
Methods and compositions for treating myelofibrosis Download PDFInfo
- Publication number
- WO2018022762A1 WO2018022762A1 PCT/US2017/043967 US2017043967W WO2018022762A1 WO 2018022762 A1 WO2018022762 A1 WO 2018022762A1 US 2017043967 W US2017043967 W US 2017043967W WO 2018022762 A1 WO2018022762 A1 WO 2018022762A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- activin
- actriib
- amino acid
- antibody
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/155—Amidines (), e.g. guanidine (H2N—C(=NH)—NH2), isourea (N=C(OH)—NH2), isothiourea (—N=C(SH)—NH2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/179—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1796—Receptors; Cell surface antigens; Cell surface determinants for hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- Myelofibrosis is a rare disease mainly affecting people of older age.
- Myelofibrosis is a BCR-ABL1 -negative myeloproliferative neoplasm that presents de novo (primary) or may be preceded by polycythemia vera (post-polycythemia vera) or essential thrombocythemia (post-essential thrombocythemia).
- Clinical features include progressive anemia, marked splenomegaly, fibrosis (e.g., bone marrow fibrosis), constitutional symptoms (e.g., fatigue, night sweats, bone pain, pruritus, and cough), and weight loss [Tefferi A (2000) N Engl J Med 342: 1255-1265].
- JAK2 mutations occur at high frequency in myelofibrosis (e.g. JAK2 mutations in about 50% patients), and either directly (e.g. JAK2 or MPL mutations) or indirectly (e.g. LNK or CBL mutations) induce JAK-STAT hyperactivation.
- the only cure of myelofibrosis is bone marrow transplantation.
- treatment- related mortality is high, and only a minority of patients qualify for transplantation.
- Many of other currently available treatments are not effective in reversing the process of
- myelofibrosis be it primary or secondary disease.
- Myelofibrosis treatments include, for example, cyto-reductive therapy (e.g., treatment with hydroxyurea); treatment of anemia with androgens and/or erythropoietin; and splenectomy. These therapies have not demonstrated improvement in survival and are largely seen as palliative [Cervantes F., Myelofibrosis: Biology and treatment options, European Journal of Haematology, 2007, 79 (suppl. 68) 13- 17]. More recently, JAK inhibitors have been used to treat myelofibrosis.
- JAK inhibitors appear to be useful for reducing splenomegaly in myelofibrosis patients, but their effects on the disease are otherwise largely palliative [Gupta et al. (2012) Blood 120: 1367-1379].
- JAK inhibitors have little to no effect on many manifestations (complications) of the disease including, for example, cytopenia, transfusion dependence, accelerated or blast phase disease, and fibrosis.
- JAK inhibitors have been shown to induce, or worsen, thrombocytopenia, anemia, and neutropenia in some patients.
- an ActRIIB antagonist (inhibitor) can be used to treat myelofibrosis, particularly ameliorating various complications of the disease including, for example, splenomegaly, extramedullary hematopoiesis, and fibrosis.
- the data presented herein show that a GDF trap polypeptide decrease splenomegaly, extramedullary hematopoiesis, and fibrosis in & JAK2V617F of myelofibrosis.
- the disclosure relates to compositions and methods for treating myelofibrosis, particularly treating or preventing one or more complications of myelofibrosis (e.g., splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis), by administering to a patient in need thereof an effective amount of one or more ActRIIB antagonists, optionally in combination of one or more other supportive therapies or active agents for treating myelofibrosis.
- GDF trap polypeptides may affect
- myelofibrosis through a mechanism other than ActRIIB antagonism e.g., inhibition of one or more of GDF11, GDF 8, activin B, BMP6, GDF3, and BMP10 may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of additional agents, including, perhaps, other members of the TGF-beta superfamily, and such collective inhibition may lead to the desired effect on, for example, myelofibrosis]
- the disclosure nonetheless demonstrates that desirable therapeutic agents may be selected on the basis of ActRIIB antagonism.
- ActRIIB antagonists e.g., antagonists of the ActRIIB receptor, antagonists of one or more ActRIIB ligand (e.g., GDF11, GDF8, activin B, BMP6, GDF3, and BMP10), antagonists of one or more type I receptor (e.g., ALK4, ALK5, and/or ALK7), antagonists of one or more co-receptor, and/or antagonists of one or more ActRIIB downstream signaling components (e.g., Smads)], or combination of such antagonists] will useful in the treatment of myelofibrosis, particularly in treating or preventing one or more myelofibrosis
- ActRIIB antagonists e.g., antagonists of the ActRIIB receptor, antagonists of one or more ActRIIB ligand (e.g., GDF11, GDF8, activin B, BMP6, GDF3, and BMP10), antagonists of one or more type I receptor (e.g., ALK4, ALK5,
- ActRIIB antagonists or “ActRIIB inhibitors”.
- the disclosure relates to methods for treating myelofibrosis, comprising administering to a patient in need thereof an effective amount of an ActRIIB antagonist.
- the disclosure relates to methods for treating one or more complications of myelofibrosis, comprising administering to a patient in need thereof an effective amount of an ActRIIB antagonist.
- the disclosure relates to methods of preventing myelofibrosis, comprising administering to a patient in need thereof an effective amount of an ActRIIB antagonist.
- the disclosure relates to methods of preventing one or more complications of myelofibrosis, comprising administering to a patient in need thereof an effective amount of an ActRIIB antagonist.
- the disclosure relates to reducing the progression rate of myelofibrosis, comprising administering to a patient in need thereof an effective amount of an ActRIIB antagonist. In some embodiments, the disclosure relates to reducing the progression rate of one or more complications of myelofibrosis, comprising administering to a patient in need thereof an effective amount of an ActRIIB antagonist. In certain aspects, the disclosure relates to methods of reducing severity of myelofibrosis, comprising administering to a patient in need thereof an effective amount of an ActRIIB antagonist. In some embodiments, the disclosure relates to methods of reducing severity of one or more complications of myelofibrosis, comprising administering to a patient in need thereof an effective amount of an ActRIIB antagonist.
- the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has primary myelofibrosis. In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has post-polycythemia vera myelofibrosis.
- the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has post- essential thrombocythemia myelofibrosis. In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has low risk myelofibrosis according to the International Prognostic Scoring System (IPSS).
- IIPSS International Prognostic Scoring System
- the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has intermediate- 1 risk myelofibrosis according to the IPSS. In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has intermediate-2 risk myelofibrosis according to the IPSS.
- the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has high-risk myelofibrosis risk myelofibrosis according to the IPSS. In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has low risk myelofibrosis according to the dynamic IPSS (DIPSS).
- DIPSS dynamic IPSS
- the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has intermediate- 1 risk myelofibrosis according to the DIPSS. In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has intermediate-2 risk myelofibrosis according to the DIPSS.
- the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has high-risk myelofibrosis risk myelofibrosis according to the DIPSS. In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has low risk myelofibrosis according to the DIPSS-plus.
- the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has intermediate- 1 risk myelofibrosis according to the DIPSS-plus. In certain aspects, the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has intermediate-2 risk myelofibrosis according to the DIPSS-plus.
- the disclosure relates to methods of treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis, wherein the patient has high-risk myelofibrosis risk myelofibrosis according to the DIPSS-plus.
- an ActRIIB antagonists may be used to prevent or delay risk progression of myelofibrosis in accordance with any of the recognized risk stratification models for myelofibrosis (e.g., IPSS, DIPPS, and DIPPS-plus).
- an ActRIIB antagonist may be used to prevent or delay myelofibrosis risk progression from low risk to intermediate- 1 risk in accordance with IPSS, DIPPS, or DIPPS-plus.
- an ActRIIB antagonist may be used to prevent or delay myelofibrosis risk progression from intermediate- 1 risk to intermediate-2 risk in accordance with IPSS, DIPPS, or DIPPS-plus.
- an ActRIIB antagonist may be used to prevent or delay myelofibrosis risk progression from intermediate-2 risk to high risk in accordance with IPSS, DIPPS, or DIPPS-plus.
- an ActRIIB antagonists may be used to promote or increase myelofibrosis risk regression in accordance with any of the recognized risk stratification models for myelofibrosis (e.g., IPSS, DIPPS, and DIPPS-plus).
- an ActRIIB antagonist may be used to promote or increase myelofibrosis risk regression from high risk to intermediate-2 risk in accordance with IPSS, DIPPS, or DIPPS-plus.
- an ActRIIB antagonist may be used to promote or increase myelofibrosis risk regression from intermediate-2 risk to intermediate- 1 risk in accordance with IPSS, DIPPS, or DIPPS-plus.
- an ActRIIB antagonist may be used to promote or increase myelofibrosis risk regression from
- the disclosure relates to methods of using ActRIIB antagonists to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis wherein the patient comprises one or more gene mutations associated with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis wherein the myelofibrosis is associated with one or more gene mutations selected from the group consisting of: nullizygosity for JAK2 46/1 haplotype, JAK2V617F, IDH1, IDH2, EZH2, SRSF2, ASXL1, JAK1, JAK2, JAK3, TYK2, MPL, CALR, CALR+ASXL1-, CALR-ASKL1+, CALR+ASKL1+, CALR-ASKL1-, TET2, THPO, and L K.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis wherein the myelofibrosis is associated with one or more gene mutations in a Janus kinase (JAK) (e.g., JAK1, JAK2, and/or JAK3).
- JAK Janus kinase
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis wherein the myelofibrosis is associated with one or more gene mutations in JAK2.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis wherein the myelofibrosis is associated with a JAK2V617F mutation.
- the disclosure relates to methods of using an ActRIIB antagonist to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis wherein the myelofibrosis is associated with one or more elevated serum markers selected from the group consisting of: increased serum IL-8 levels, increased serum IL-2R levels, and increased serum free light chain levels.
- the disclosure relates to methods of using an ActRIIB antagonist to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis wherein the patient has been treated with a Janus kinase inhibitor (e.g., ruxolitinib, fedratinib (SAR302503), monoelotinib (CYT387), pacritinib, lestaurtinib, AZD-1480, BMS-911543, NS-018, LY2784544, SEP-701, XL019, and AT-9283).
- a Janus kinase inhibitor e.g., ruxolitinib, fedratinib (SAR302503), monoelotinib (CYT387), pacritinib, lestaurtinib, AZD-1480, BMS-911543, NS-018, LY2784544, SEP-701
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis wherein the patient is intolerant of a Janus kinase inhibitor. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of
- an ActRIIB antagonist to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis wherein the patient has been treated with hydroxyurea.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or one or more complications of myelofibrosis wherein the patient has an inadequate response to hydroxyurea.
- myelofibrosis is a clonal neoplastic disorder of hematopoiesis that is associated with various clinical complications that may manifest during disease progression in a patient.
- the examples of the disclosure demonstrate that an ActRIIB antagonist may be used to mitigate a number of these clinical complications, indicating that an ActRIIB antagonist may be used to more broadly treat various complications
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of ineffective hematopoiesis in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of extramedullary hematopoiesis in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of extramedullary hematopoiesis in the spleen (splenic extramedullary
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of extramedullary hematopoiesis in the liver (hepatic extramedullary hematopoiesis) in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of extramedullary hematopoiesis in the lung (pulmonary extramedullary hematopoiesis) in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of extramedullary hematopoiesis in the lymph nodes (lymphatic extramedullary hematopoiesis) in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of extramedullary hematopoiesis in the lymph nodes (lymphatic extramedullary hematopoiesis) in a patient with myelofibrosis.
- ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of inflammation and/or enlargement (size) of an organ or tissue in a myelofibrosis patient.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of inflammation and/or enlargement (size) in the spleen of a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of inflammation and/or enlargement (size) in the liver of a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of inflammation and/or enlargement (size) in the lung(s) of a patient with
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of inflammation and/or enlargement (size) in the lymph node(s) of a patient with myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of splenomegaly in a patient with myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of hepatomegaly in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of fibrosis in a patient with myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of bone marrow fibrosis in a patient with myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of spleen fibrosis in a patient with
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of liver fibrosis in a patient with myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of lung fibrosis in a patient with myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of lymph node fibrosis in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of osteosclerosis in a patient with myelofibrosis. In certain aspects, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of osteomyelofibrosis. In certain aspects, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of one or more blood-related complications of myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of anemia in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of thrombocytopenia in a patient with myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of pancytopenia in a patient with myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of poikilocytosis in a patient with myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of bleeding in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of one or more constitutional symptoms of myelofibrosis (e.g., fatigue, pruritus, weight loss, night sweats, fever, abdominal pain or discomfort, paresthesia, and early satiety).
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of pain in a tissue and/or organ in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of bone pain in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of arthralgia in a patient with myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of myalgia in a patient with myelofibrosis. In certain aspects, an ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of cachexia in a patient with myelofibrosis. In certain aspects, disclosure relates to increasing red blood cell levels in a myelofibrosis patient by administering an effective amount of an ActRIIB antagonist.
- disclosure relates to increasing hemoglobin levels in a myelofibrosis patient by administering an effective amount of an ActRIIB antagonist.
- a myelofibrosis patient to be treated in accordance with the methods described herein has anemia.
- ActRIIB antagonist may be used to treat, prevent, or reduce the progression rate and/or severity of anemia in a patient with myelofibrosis.
- the disclosure relate to methods using an ActRIIB antagonists to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis or a complication of
- an ActRIIB antagonist may be used to decrease blood cell transfusion burden in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to decrease blood cell transfusion by greater than about 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% for 4 to 8 weeks relative to the equal time prior to the start of the ActRIIB antagonist treatment.
- an ActRIIB antagonist may be used to decrease blood cell transfusion by greater than about 50% for 4 to 8 weeks relative to the equal time prior to the start of the ActRIIB antagonist treatment in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to decrease iron overload in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to decrease iron overload in an organ or tissue in a patient with myelofibrosis.
- an ActRIIB antagonist may be used to decrease iron overload in the spleen of a patient with myelofibrosis.
- an ActRIIB antagonist may be used to decrease iron overload in the liver of a patient with myelofibrosis. In some embodiments, an ActRIIB antagonist may be used to decrease iron overload in the heart of a patient with myelofibrosis.
- a myelofibrosis patient may further be administered one or more additional active agents and/or supportive therapies (in addition to administration of one or more ActRIIB antagonists) for treating, preventing, or reducing, the progression rate and/or severity of myelofibrosis or one or more complications of
- a patient may be further administered one or more supportive therapies or active agents is selected from the group consisting of: blood transfusion (whole blood or red blood cell transfusion), iron chelators (e.g.,
- deferoxamine, deferiprone and deferasirox corticosteroids, prednisone
- ESAs e.g., erythropoietin, epoetin alfa, epoetin beta, darbepoetin alfa, and methoxy polyethylene glycol- epoetin beta
- androgens danazol, thalidomide, lenalidomide, a cytoreductive agent, hydroxyurea, busulfan, melphalm, cladribine, splenectomy, radiotherapy, aspirin,
- the disclosure relates to methods for treating, preventing, or reducing the progression rate and/or severity of myelofibrosis or one or more
- an ActRIIB antagonist is administered prior to treatment with the Janus kinase inhibitor.
- an ActRIIB antagonist is administered after treatment with the Janus kinase inhibitor.
- an ActRIIB antagonist is administered concurrently with the Janus kinase inhibitor.
- Janus kinase inhibitors to be used in accordance with the methods described herein may be an agent that inhibits one or more Janus kinases selected from the group consisting of: JAKl, JAK2, and JAK3.
- a Janus kinase inhibitor may be an agent that inhibits signaling of one or more of JAKl, JAK2, and JAK3 in a cell-based assay.
- a Janus kinase inhibitor to be used in accordance with the methods described herein is selected from the group consisting of: ruxolitinib, fedratinib (SAR302503), monoelotinib (CYT387), pacritinib, lestaurtinib, AZD-1480, BMS- 91 1543, NS-018, LY2784544, SEP-701, XL019, and AT-9283.
- a Janus kinase inhibitor to be used in accordance with the methods described herein is ruxolitinib.
- Janus kinase inhibitors e.g., ruxolitinib
- Janus kinase inhibitors have been approved for treatment of a variety of disorders including, for example, myelofibrosis.
- a common adverse side-effect of Janus kinase inhibitor therapy is anemia. While blood cell transfusion and EPO receptor activator therapy may be used treated anemia in patients treated with a Janus kinase inhibitor, these anemia therapies also are associated with adverse effects in patients (e.g., promoting or increasing iron overload, inadequate response to EPO, and EPO intolerance).
- the present disclosure relates to the discovery that an ActRIIB antagonist (inhibitor) can be used to increase red blood cell and hemoglobin levels in patients treated with a Janus kinase inhibitor. Accordingly, in certain aspects, the disclosure relates to compositions and methods for increasing red blood cell/hemoglobin levels and treating or preventing anemia in a patient treated with a Janus kinase inhibitor by administering to a patient in need thereof an effective amount of one or more ActRIIB antagonists, optionally in combination of one or more other supportive therapies or active agents for treating anemia.
- GDF trap polypeptides may affect red blood cell and/or hemoglobin levels through a mechanism other than ActRIIB antagonism [e.g., inhibition of one or more of GDF11, GDF 8, activin B, BMP6, GDF3, and BMP10 may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of additional agents, including, perhaps, other members of the TGF-beta superfamily, and such collective inhibition may lead to the desired effect on, for example, red blood cell levels and/or hemoglobin levels in patients treated with a Janus kinase inhibitor], the disclosure nonetheless demonstrates that desirable therapeutic agents may be selected on the basis of ActRIIB antagonism.
- a mechanism other than ActRIIB antagonism e.g., inhibition of one or more of GDF11, GDF 8, activin B, BMP6, GDF3, and BMP10 may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of additional agents, including, perhaps, other members of the TGF-bet
- ActRIIB antagonists e.g., antagonists of the ActRIIB receptor, antagonists of one or more ActRIIB ligand (e.g., GDF11, GDF8, activin B, BMP6, GDF3, and BMP10), antagonists of one or more type I receptor (e.g., ALK4, ALK5, and/or ALK7), antagonists of one or more co-receptor, and/or antagonists of one or more ActRIIB downstream signaling components (e.g., Smads)], or combination of such antagonists] will useful in the treatment of patients treated with a Janus kinase, particularly in treating or preventing one or more complications associated with Janus kinase therapy (e.g., anemia, thrombocytopenia, and/or neutropenia).
- Such agents are collectively referred to herein as "ActRIIB antagonists" or "ActRIIB inhibitors”.
- the disclosure relate to methods for increasing red blood cell levels and/or hemoglobin levels in a patient treated with a Janus kinase inhibitor by administering to a patient in need thereof an effective amount of an ActRIIB antagonist.
- ActRIIB antagonists may be used to treat or prevent anemia in a patient treated with a Janus kinase inhibitor.
- a patient treated with a Janus kinase inhibitor may have been administered one or more blood cell transfusions prior to the start of ActRIIB antagonist treatment.
- a patient treated with a Janus kinase inhibitor is blood cell transfusion-dependent.
- the disclosure relate to methods of using an ActRIIB antagonist to decrease blood cell transfusion burden in a patient treated with a Janus kinase inhibitor.
- an ActRIIB antagonist may be used to decrease blood cell transfusion by greater than about 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%) for 4 to 8 weeks relative to the equal time prior to the start of the ActRIIB antagonists treatment in a patient treated with a Janus kinase inhibitor.
- an ActRIIB antagonist may be used to decrease blood cell transfusion by greater than about 50% for 4 to 8 weeks relative to the equal time prior to the start of the ActRIIB antagonists treatment in a patient treated with a Janus kinase inhibitor.
- the disclosure relates to methods of using an ActRIIB antagonist to decrease iron overload in a patient treated with a Janus kinase inhibitor.
- ActRIIB antagonists may be used to decrease iron content in the liver of a patient treated with a Janus kinase inhibitor.
- ActRIIB antagonists may be used to decrease iron content in the spleen of a patient treated with a Janus kinase inhibitor.
- ActRIIB antagonists may be used to decrease iron content in the heart of a patient treated with a Janus kinase inhibitor.
- the ActRIIB antagonist is administered prior to treatment with the Janus kinase inhibitor.
- the ActRIIB antagonist is administered after treatment with the Janus kinase inhibitor.
- the ActRIIB antagonist is administered concurrently with the Janus kinase inhibitor.
- a patient treated with a Janus kinase inhibitor has been treated with an agent that inhibitor inhibits one or more of Janus kinases selected from the group consisting of: JAK1, JAK2, and JAK3.
- the Janus kinase inhibitor inhibits signaling of one or more of JAK1, JAK2, and JAK3 in a cell-based assay.
- a patient may be treated with one or more Janus kinase inhibitors selected from the group consisting of: ruxolitinib, fedratinib (SAR302503), monoelotinib (CYT387), pacritinib, lestaurtinib, AZD-1480, BMS-911543, NS-018, LY2784544, SEP-701, XL019, and AT- 9283.
- a patient may be treated with ruxolitinib.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least GDFl 1 (e.g., a GDFl 1 antagonist). Effects on GDFl 1 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., a Smad signaling reporter assay). Therefore, in some embodiments, an ActRIIB antagonist, or combination of antagonists, of the disclosure may bind to at least GDFl 1. Ligand binding activity may be determined, for example, using a binding affinity assay including those described herein.
- an ActRIIB antagonist, or combination of antagonists, of the disclosure binds to at least GDFl 1 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- ActRIIB antagonists that inhibit GDFl 1 can be used in accordance with the methods and uses described herein including, for example, ligand traps (e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides), antibodies, small molecules, nucleotide sequences, and combinations thereof.
- ligand traps e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides
- antibodies small molecules, nucleotide sequences, and combinations thereof.
- an ActRIIB antagonist, or combination of antagonists, that inhibits GDFl 1 may further inhibit one or more of: activin (e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE), GDF 8, GDF 3, BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- activin e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE
- GDF 8 e.g., GDF 3, BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least GDF8 (e.g., a GDF8 antagonist). Effects on GDF8 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., a Smad signaling reporter assay). Therefore, in some embodiments, an ActRIIB antagonist, or combination of antagonists, of the disclosure may bind to at least GDF8. Ligand binding activity may be determined, for example, using a binding affinity assay including those described herein.
- an ActRIIB antagonist, or combination of antagonists, of the disclosure binds to at least GDF8 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- ActRIIB antagonists that inhibit GDF8 can be used in accordance with the methods and uses described herein including, for example, ligand traps (e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides), antibodies, small molecules, nucleotide sequences, and combinations thereof.
- ligand traps e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides
- antibodies small molecules, nucleotide sequences, and combinations thereof.
- an ActRIIB antagonist, or combination of antagonists, that inhibits GDF8 may further inhibit one or more of: activin (e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE), GDFl 1, GDF 3, BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- activin e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE
- GDFl 1 e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE
- GDFl 1 e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE,
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least GDF3 (e.g., a GDF3 antagonist). Effects on GDF3 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., a Smad signaling reporter assay). Therefore, in some embodiments, an ActRIIB antagonist, or combination of antagonists, of the disclosure may bind to at least GDF3. Ligand binding activity may be determined, for example, using a binding affinity assay including those described herein.
- an ActRIIB antagonist, or combination of antagonists, of the disclosure binds to at least GDF3 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- ActRIIB antagonists that inhibit GDF3 can be used in accordance with the methods and uses described herein including, for example, ligand traps (e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides), antibodies, small molecules, nucleotide sequences, and combinations thereof.
- ligand traps e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides
- antibodies small molecules, nucleotide sequences, and combinations thereof.
- an ActRIIB antagonist, or combination of antagonists, that inhibits GDF3 may further inhibit one or more of: activin (e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE), GDF 8, GDF 11 , BMP6, BMP 10, ActRIIB, ALK4, ALK5, and ALK7.
- activin e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE
- GDF 8 e.g., GDF 8
- BMP6, BMP 10 e.g., ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least BMP6 (e.g., a BMP6 antagonist). Effects on BMP6 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., a Smad signaling reporter assay). Therefore, in some embodiments, an ActRIIB antagonist, or combination of antagonists, of the disclosure may bind to at least BMP6. Ligand binding activity may be determined, for example, using a binding affinity assay including those described herein.
- an ActRIIB antagonist, or combination of antagonists, of the disclosure binds to at least BMP6 with a K D of at least 1 x 10 M (e.g., at least 1 x 10 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- ActRIIB antagonists that inhibit BMP6 can be used in accordance with the methods and uses described herein including, for example, ligand traps (e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides), antibodies, small molecules, nucleotide sequences, and combinations thereof.
- ligand traps e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides
- antibodies small molecules, nucleotide sequences, and combinations thereof.
- an ActRIIB antagonist, or combination of antagonists, that inhibits BMP6 may further inhibit one or more of: activin (e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE), GDF 8, GDF 3, GDFl 1, BMPIO, ActRIIB, ALK4, ALK5, and ALK7.
- activin e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE
- GDF 8 e.g., GDF 3, GDFl 1, BMPIO, ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least BMP10 (e.g., a BMP10 antagonist). Effects on BMPIO inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., a Smad signaling reporter assay). Therefore, in some embodiments, an ActRIIB antagonist, or combination of antagonists, of the disclosure may bind to at least BMPIO. Ligand binding activity may be determined, for example, using a binding affinity assay including those described herein.
- an ActRIIB antagonist, or combination of antagonists, of the disclosure binds to at least BMP10 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- ActRIIB antagonists that inhibit BMPIO can be used in accordance with the methods and uses described herein including, for example, ligand traps (e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides), antibodies, small molecules, nucleotide sequences, and combinations thereof.
- ligand traps e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides
- antibodies small molecules, nucleotide sequences, and combinations thereof.
- an ActRIIB antagonist, or combination of antagonists, that inhibits BMP10 may further inhibit one or more of: activin (e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE), GDF 8, GDF 3, GDFl 1, BMP6, ActRIIB, ALK4, ALK5, and ALK7.
- activin e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE
- GDF 8 e.g., GDF 3, GDFl 1, BMP6, ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least activin (e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE) (e.g., an activin antagonist). Effects on activin inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., a Smad signaling reporter assay). Therefore, in some embodiments, an ActRIIB antagonist, or combination of antagonists, of the disclosure may bind to at least activin.
- activin e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE
- an activin antagonist e.g., an activin antagonist. Effects on activin inhibition may be determined, for example, using a cell-based
- Ligand binding activity may be determined, for example, using a binding affinity assay including those described herein.
- an ActRIIB antagonist, or combination of antagonists, of the disclosure binds to at least activin with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 " 12 M).
- ActRIIB antagonists that inhibit activin can be used in accordance with the methods and uses described herein including, for example, ligand traps (e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides), antibodies, small molecules, nucleotide sequences, and combinations thereof.
- ligand traps e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides
- antibodies small molecules, nucleotide sequences, and combinations thereof.
- an ActRIIB antagonist, or combination of antagonists, that inhibits activin may further inhibit one or more of: GDF 8, GDF3, GDF11, BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least activin B.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein does not substantially bind to activin A (e.g., binds to activin A with a K D higher than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M) and/or inhibit activin A activity.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least activin B but does not substantially bind to activin A (e.g., binds to activin A with a K D higher than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M) and/or inhibit activin A activity.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least ActRIIB (e.g., an ActRIIB antagonist). Effects on ActRIIB inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., a Smad signaling reporter assay). Therefore, in some embodiments, an ActRIIB antagonist, or combination of antagonists, of the disclosure may bind to at least ActRIIB. Ligand binding activity may be determined, for example, using a binding affinity assay including those described herein.
- an ActRIIB antagonist, or combination of antagonists, of the disclosure binds to at least ActRIIB with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- ActRIIB antagonists that inhibit ActRIIB can be used in accordance with the methods and uses described herein including, for example, ligand traps (e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides), antibodies, small molecules, nucleotide sequences, and combinations thereof.
- ligand traps e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides
- antibodies small molecules, nucleotide sequences, and combinations thereof.
- an ActRIIB antagonist, or combination of antagonists, that inhibits ActRIIB may further inhibit one or more of: activin (e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE), GDF 8, GDF 3, GDFl 1, BMP6, BMP10, ALK4, ALK5, and ALK7.
- activin e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE
- GDF 8 e.g., GDF 3, GDFl 1, BMP6, BMP10, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least ALK4 (e.g., an ALK4 antagonist). Effects on ALK4 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., a Smad signaling reporter assay). Therefore, in some embodiments, an ActRIIB antagonist, or combination of antagonists, of the disclosure may bind to at least ALK4. Ligand binding activity may be determined, for example, using a binding affinity assay including those described herein.
- an ActRIIB antagonist, or combination of antagonists, of the disclosure binds to at least ALK4 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- ActRIIB antagonists that inhibit ALK4 can be used in accordance with the methods and uses described herein including, for example, ligand traps (e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides), antibodies, small molecules, nucleotide sequences, and combinations thereof.
- ligand traps e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides
- antibodies small molecules, nucleotide sequences, and combinations thereof.
- an ActRIIB antagonist, or combination of antagonists, that inhibits ALK4 may further inhibit one or more of: activin (e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE), GDF 8, GDF 3, GDFl 1, BMP6, BMP10, ActRIIB, ALK5, and ALK7.
- activin e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE
- GDF 8 e.g., GDF 3, GDFl 1, BMP6, BMP10, ActRIIB, ALK5, and ALK7.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least ALK5 (e.g., an ALK5 antagonist). Effects on ALK5 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., a Smad signaling reporter assay). Therefore, in some embodiments, an ActRIIB antagonists, or combination of antagonist, of the disclosure may bind to at least ALK5. Ligand binding activity may be determined, for example, using a binding affinity assay including those described herein.
- an ActRIIB antagonist, or combination of antagonists, of the disclosure binds to at least ALK5 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- ActRIIB antagonists that inhibit ALK5 can be used in accordance with the methods and uses described herein including, for example, ligand traps (e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides), antibodies, small molecules, nucleotide sequences, and combinations thereof.
- ligand traps e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides
- antibodies small molecules, nucleotide sequences, and combinations thereof.
- an ActRIIB antagonist, or combination of antagonists, that inhibits ALK5 may further inhibit one or more of: activin (e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE), GDF 8, GDF 3, GDF11, BMP6, BMP10, ActRIIB, ALK4, and ALK7.
- activin e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE
- GDF 8 e.g., GDF 3, GDF11, BMP6, BMP10, ActRIIB, ALK4, and ALK7.
- an ActRIIB antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least ALK7 (e.g., an ALK7 antagonist). Effects on ALK7 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., a Smad signaling reporter assay). Therefore, in some embodiments, an ActRIIB antagonist, or combination of antagonists, of the disclosure may bind to at least ALK7. Ligand binding activity may be determined, for example, using a binding affinity assay including those described herein.
- an ActRIIB antagonist, or combination of antagonists, of the disclosure binds to at least ALK7 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- ActRIIB antagonists that inhibit ALK7 can be used in accordance with the methods and uses described herein including, for example, ligand traps (e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides), antibodies, small molecules, nucleotide sequences, and combinations thereof.
- ligand traps e.g., ActRIIB polypeptides, GDF Traps, follistatin polypeptides, and FLRG polypeptides
- antibodies small molecules, nucleotide sequences, and combinations thereof.
- an ActRIIB antagonist, or combination of antagonists, that inhibits ALK7 may further inhibit one or more of: activin (e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE), GDF 8, GDF 3, GDF11, BMP6, BMP10, ActRIIB, ALK5, and ALK4.
- activin e.g., activin A, activin B, activin AB, activin C, activin AC, activin BC, activin E, activin AE, and/or activin BE
- GDF 8 e.g., GDF 3, GDF11, BMP6, BMP10, ActRIIB, ALK5, and ALK4.
- ActRIIB antagonists that are ActRIIB polypeptides.
- ActRIIB polypeptide collectively refers to naturally occurring ActRIIB polypeptides as well as truncations and variants thereof such as those described herein (e.g., GDF trap polypeptides).
- ActRIIB polypeptides comprise, consist essentially of, or consist of a ligand-binding domain of an ActRIIB polypeptide or modified (variant) form thereof.
- an ActRIIB polypeptide comprises, consists essentially of, or consists of an ActRIIB ligand-binding domain of an ActRIIB polypeptide, for example, a portion of the ActRIIB extracellular domain.
- ActRIIB polypeptides to be used in accordance with the methods described herein are soluble polypeptides.
- compositions comprising an ActRIIB polypeptide and uses thereof.
- an ActRIIB polypeptide of the disclosure comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids 29-109 of SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids 29- 109 of SEQ ID NO: 1, wherein the ActRIIB polypeptide comprises an acidic amino acid [naturally occurring (E or D) or artificial acidic amino acid] at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids 25-131 of SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the sequence of amino acids 25-131 of SEQ ID NO: 1, wherein the
- ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 1, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 2.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 2, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 3.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 3, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 4.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 4, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 4.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 5.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%,
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 5, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 4.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%), 99%), or 100% identical to the amino acid sequence of SEQ ID NO: 6, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 4.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 24.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 25.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 28.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 29.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%>, 85%>, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 29, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 30.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 30, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 31.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 31, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 45.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 45, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 50.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%,
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 53.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 53, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 54.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 54, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 58.
- ActRIIB polypeptides to be used in accordance with the methods and uses described herein do not comprise an acidic amino acid at the position corresponding to L79 of SEQ ID NO: 1.
- ActRIIB polypeptides and variants thereof may be homomultimers, for example, homodimer, homotrimers, homotetramers, homopentamers, and higher order homomultimer complexes.
- ActRIIB polypeptides and variants thereof are homodimers.
- ActRII polypeptide dimers described herein comprise an first ActRIIB polypeptide covalently, or non-covalently, associated with an second ActRIIB polypeptide wherein the first polypeptide comprises an ActRIIB domain and an amino acid sequence of a first member (or second member) of an interaction pair (e.g., a constant domain of an immunoglobulin) and the second polypeptide comprises an ActRIIB polypeptide and an amino acid sequence of a second member (or first member) of the interaction pair.
- an interaction pair e.g., a constant domain of an immunoglobulin
- ActRIIB polypeptides may be fusion proteins.
- an ActRIIB polypeptide may be a fusion protein comprising an ActRIIB polypeptide domain and one or more heterologous (non-ActRIIB) polypeptide domains.
- an ActRIIB polypeptide may be a fusion protein that has, as one domain, an amino acid sequence derived from an ActRIIB polypeptide (e.g., a ligand-binding domain of an ActRIIB receptor or a variant thereof) and one or more heterologous domains that provide a desirable property, such as improved pharmacokinetics, easier purification, targeting to particular tissues, etc.
- a domain of a fusion protein may enhance one or more of in vivo stability, in vivo half-life, uptake/administration, tissue localization or distribution, formation of protein complexes, multimerization of the fusion protein, and/or purification.
- an ActRIIB may enhance one or more of in vivo stability, in vivo half-life, uptake/administration, tissue localization or distribution, formation of protein complexes, multimerization of the fusion protein, and/or purification.
- an ActRIIB may enhance one or more of in vivo stability, in vivo half-life, uptake
- an ActRIIB fusion protein comprises a relatively unstructured linker positioned between the heterologous domain and the ActRIIB domain.
- This unstructured linker may correspond to the roughly 15 amino acid unstructured region at the C-terminal end of the extracellular domain of ActRIIB (the "tail"), or it may be an artificial sequence of between 3 and 15, 20, 30, 50 or more amino acids that are relatively free of secondary structure.
- a linker may be rich in glycine and proline residues and may, for example, contain repeating sequences of threonine/serine and glycines.
- linkers include, but are not limited to, the sequences TGGG (SEQ ID NO: 18), SGGG (SEQ ID NO: 19), TGGGG (SEQ ID NO: 16), SGGGG (SEQ ID NO: 17), GGGGS (SEQ ID NO: 20), GGGG (SEQ ID NO: 15), and GGG (SEQ ID NO: 14).
- ActRIIB fusion proteins may comprise a constant domain of an
- immunoglobulin including, for example, the Fc portion of an immunoglobulin.
- an amino acid sequence that is derived from an Fc domain of an IgG (IgGl, IgG2, IgG3, or IgG4), IgA (IgAl or IgA2), IgE, or IgM immunoglobulin.
- am Fc portion of an immunoglobulin domain may comprise, consist essentially of, or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 9-13.
- an ActRIIB fusion protein comprises an amino acid sequence as set forth in the formula A-B-C.
- the B portion is an N- and C- terminally truncated ActRIIB polypeptide as described herein.
- the A and C portions may be independently zero, one, or more than one amino acids, and both A and C portions are heterologous to B.
- the A and/or C portions may be attached to the B portion via a linker sequence.
- an ActRIIB fusion protein comprises a leader sequence.
- the leader sequence may be a native ActRIIB leader sequence or a heterologous leader sequence.
- the leader sequence is a tissue plasminogen activator (TP A) leader sequence.
- An ActRIIB polypeptide may comprise a purification subsequence, such as an epitope tag, a FLAG tag, a polyhistidine sequence, and a GST fusion.
- an ActRIIB polypeptide comprises one or more modified amino acid residues selected from: a glycosylated amino acid, a PEGylated amino acid, a famesylated amino acid, an acetylated amino acid, a biotinylated amino acid, and/or an amino acid conjugated to a lipid moiety.
- ActRIIB polypeptides may comprise at least one N-linked sugar, and may include two, three or more N-linked sugars.
- Such polypeptides may also comprise O-linked sugars.
- ActRIIB polypeptides be expressed in a mammalian cell line that mediates suitably natural glycosylation of the polypeptide so as to diminish the likelihood of an unfavorable immune response in a patient.
- ActRIIB polypeptides may be produced in a variety of cell lines that glycosylate the protein in a manner that is suitable for patient use, including engineered insect or yeast cells, and mammalian cells such as COS cells, CHO cells, HEK cells and NSO cells.
- an ActRIIB polypeptide is glycosylated and has a glycosylation pattern obtainable from a Chinese hamster ovary cell line.
- ActRIIB polypeptides of the disclosure exhibit a serum half-life of at least 4, 6, 12, 24, 36, 48, or 72 hours in a mammal (e.g., a mouse or a human).
- ActRIIB may exhibit a serum half-life of at least 6, 8, 10, 12, 14, 20, 25, or 30 days in a mammal (e.g., a mouse or a human).
- the disclosure provides pharmaceutical preparations comprising one or more ActRIIB antagonists of the present disclosure and a pharmaceutically acceptable carrier.
- a pharmaceutical preparation may also comprise one or more additional active agents such as a compound that is used to treat myelofibrosis, particularly treating or preventing one or more complications of myelofibrosis (e.g., splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis), and/or a patient treated with a Janus kinase inhibitor.
- pharmaceutical preparation will preferably be pyrogen-free (meaning pyrogen free to the extent required by regulations governing the quality of products for therapeutic use).
- an ActRIIB antagonist or combination of antagonists, of the disclosure to disorders or conditions described herein
- the ActRIIB antagonist is an antibody, or combination of antibodies.
- the antibody binds to at least ActRIIB.
- an antibody that binds to ActRIIB inhibits ActRIIB signaling, optionally as measured in a cell-based assay such as those described herein.
- an antibody that binds to ActRIIB inhibits one or more TGF-beta superfamily ligands, TGF-beta superfamily type I receptors, or TGF-beta superfamily co-receptors from binding to ActRIIB.
- an antibody that binds to ActRIIB inhibits one or more TGF-beta superfamily ligands from binding to ActRIIB selected from the group consisting of: activin (e.g., activin A, activin B, activin C, activin AB, activin AC, activin BC, activin E, activin AE, and activin BE), GDF8, GDFl 1, GDF3, BMP6, BMP10, BMP9, and BMP 5.
- an antibody binds to at least GDFl 1.
- an antibody that binds to GDFl 1 inhibits ActRIIB signaling, optionally as measured in a cell-based assay such as those described herein.
- an antibody that binds to GDFl 1 inhibits GDFl 1 -ActRIIB binding. In some embodiments, an antibody binds to at least GDF8. In certain embodiments, an antibody that binds to GDF8 inhibits ActRIIB signaling, optionally as measured in a cell-based assay such as those described herein. In certain embodiments, an antibody that binds to GDF8 inhibits GDF8-ActRIIB binding. In some embodiments, an antibody binds to at least BMP6. In certain embodiments, an antibody that binds to BMP6 inhibits ActRIIB signaling, optionally as measured in a cell-based assay such as those described herein. In certain embodiments, an antibody that binds to BMP6 inhibits BMP6- ActRIIB binding. In some embodiments, an antibody binds to BMP 10. In certain embodiments, a cell-based assay such as those described herein. In certain embodiments, an antibody that binds to BMP6 inhibits BMP6- Act
- an antibody that binds to at least BMP 10 inhibits ActRIIB signaling, optionally as measured in a cell-based assay such as those described herein. In certain embodiments, an antibody that binds to BMP 10 inhibits BMP 10- ActRIIB binding. In some embodiments, the antibody binds to at least GDF3. In certain embodiments, an antibody that binds to GDF3 inhibits ActRIIB signaling, optionally as measured in a cell-based assay such as those described herein. In certain embodiments, an antibody that binds to GDF3 inhibits GDF3- ActRIIB binding. In some embodiments, the antibody binds to at least activin (e.g.
- an antibody that binds to activin inhibits ActRIIB signaling, optionally as measured in a cell-based assay such as those described herein.
- an antibody that binds to activin e.g. activin A, activin B, activin C, activin AB, activin AC, activin BC, activin E, activin AE, and activin BE
- an antibody that binds to activin inhibits ActRIIB signaling, optionally as measured in a cell-based assay such as those described herein.
- an antibody that binds to activin e.g.
- the antibody binds to activin B.
- an antibody that binds to activin B inhibits ActRIIB signaling, optionally as measured in a cell-based assay such as those described herein.
- an antibody that binds to activin B inhibits activin B-ActRIIB binding.
- the antibody is a multispecific antibody, or combination of multispecific antibodies that binds to one or more of ActRIIB, GDF 11 , GDF8, activin A, activin B, BMP6, and BMP 10.
- an antibody binds to at least ALK4.
- an antibody that binds to ALK4 inhibits ALK4 signaling, optionally as measured in a cell-based assay such as those described herein.
- an antibody that binds to ALK4 inhibits one or more ActRIIB ligands, type II receptors, or co-receptors from binding to ALK4.
- an antibody that binds to ALK4 inhibits one or more
- ActRIIB ligands from binding to ALK4 selected from the group consisting of: activin (e.g., activin A, activin B, activin C, activin AB, activin AC, activin BC, activin E, activin AE, and activin BE), GDF 8, GDFl 1, BMP6, BMP 10, and GDF3.
- the antibody binds to at least ALK5.
- an antibody that binds to ALK5 inhibits ALK5 signaling, optionally as measured in a cell-based assay such as those described herein.
- an antibody that binds to ALK5 inhibits one or more ActRIIB ligands, type II receptors, or co-receptors from binding to ALK5.
- an antibody that binds to ALK5 inhibits one or more ActRIIB ligands from binding to ALK5 selected from the group consisting of: activin (e.g., activin A, activin B, activin C, activin AB, activin AC, activin BC, activin E, activin AE, and activin BE), GDF 8, GDFl 1, BMP6, BMP 10, and GDF3.
- activin e.g., activin A, activin B, activin C, activin AB, activin AC, activin BC, activin E, activin AE, and activin BE
- GDF 8 GDFl 1
- BMP6, BMP 10 GDF3
- an antibody that binds to ALK7 inhibits one or more ActRIIB ligands, type II receptors, or co- receptors from binding to ALK7.
- an antibody that binds to ALK7 inhibits one or more ActRIIB ligands from binding to ALK7 selected from the group consisting of: activin (e.g., activin A, activin B, activin C, activin AB, activin AC, activin BC, activin E, activin AE, and activin BE), GDF 8, GDFl 1, BMP6, BMP 10, and GDF3.
- the antibody binds to at least GDFl 1.
- the multispecific antibody inhibits signaling in a cell-based assay of one or more of: ActRIIB, GDF11, GDF8, activin A, activin B, GDF3, BMP6, and BMP10.
- antibody is a chimeric antibody, a humanized antibody, or a human antibody.
- the antibody is a single-chain antibody, an F(ab') 2 fragment, a single-chain diabody, a tandem single-chain Fv fragment, a tandem single-chain diabody, a or a fusion protein comprising a single-chain diabody and at least a portion of an immunoglobulin heavy-chain constant region.
- the ActRIIB antagonist is a small molecule inhibitor or
- the small molecule inhibitor is an inhibitor of at least ActRIIB. In some embodiments, the small molecule inhibitor is an inhibitor of at least ALK4. In some embodiments, the small molecule inhibitor is an inhibitor of at least ALK5. In some embodiments, the small molecule inhibitor is an inhibitor of at least ALK7. In some embodiments, the small molecule inhibitor is an inhibitor of at least GDF11. In some embodiments, the small molecule inhibitor is an inhibitor of at least GDF8. In some embodiments, the small molecule inhibitor is an inhibitor of at least
- the small molecule inhibitor is an inhibitor of at least BMP 10. In some embodiments, the small molecule inhibitor is an inhibitor of at least GDF3. In some embodiments, the small molecule inhibitor is an inhibitor of at least activin (e.g. activin A, activin B, activin C, activin AB, activin AC, activin BC, activin E, activin AE, and activin BE). In some embodiments, the small molecule inhibitor is an inhibitor of at least activin B.
- activin e.g. activin A, activin B, activin C, activin AB, activin AC, activin BC, activin E, activin AE, and activin BE. In some embodiments, the small molecule inhibitor is an inhibitor of at least activin B.
- the ActRIIB antagonist is a nucleic acid inhibitor or combination of nucleic acid inhibitors.
- the nucleic acid inhibitor is an inhibitor of at least ActRIIB.
- the nucleic acid inhibitor is an inhibitor of at least ALK4.
- the nucleic acid inhibitor is an inhibitor of at least ALK5.
- the nucleic acid inhibitor is an inhibitor of at least ALK7.
- the nucleic acid inhibitor is an inhibitor of at least GDF11.
- the nucleic acid inhibitor is an inhibitor of at least GDF8.
- the nucleic acid inhibitor is an inhibitor of at least BMP6. In some embodiments, the nucleic acid inhibitor is an inhibitor of at least BMP6.
- the nucleic acid inhibitor is an inhibitor of at least BMP 10. In some embodiments, the nucleic acid inhibitor is an inhibitor of at least GDF3. In some
- the nucleic acid inhibitor is an inhibitor of at least activin (e.g. activin A, activin B, activin C, activin AB, activin AC, activin BC, activin E, activin AE, and activin BE).
- the nucleic acid inhibitor is an inhibitor of at least activin B.
- the ActRIIB antagonist is a follistatin polypeptide.
- the follistatin polypeptide comprises an amino acid sequence that is at least 70%, 75% 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 63.
- the follistatin polypeptide comprises an amino acid sequence that is at least 70%, 75% 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 64. In some embodiments, the follistatin polypeptide comprises an amino acid sequence that is at least 70%, 75% 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 65.
- the follistatin polypeptide comprises an amino acid sequence that is at least 70%, 75% 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 66. In some embodiments, the follistatin polypeptide comprises an amino acid sequence that is at least 70%, 75% 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 67.
- the ActRIIB antagonist is a FLRG polypeptide.
- the FLRG polypeptide comprises an amino acid sequence that is at least 70%, 75% 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 68.
- Figure 1 shows an alignment of extracellular domains of human ActRIIA (SEQ ID NO: 36) and human ActRIIB (SEQ ID NO: 2) with the residues that are deduced herein, based on composite analysis of multiple ActRIIB and ActRIIA crystal structures, to directly contact ligand indicated with boxes.
- Figure 2 shows a multiple sequence alignment of various vertebrate ActRIIB proteins and human ActRIIA (SEQ ID NOs: 37-43) as well as a consensus ActRII sequence derived from the alignment (SEQ ID NO: 44).
- Figure 3 shows the full amino acid sequence for the GDF trap ActRIIB(L79D 20- 134)-hFc (SEQ ID NO: 45), including the TPA leader sequence (double underline), ActRIIB extracellular domain (residues 20-134 in SEQ ID NO: 1; single underline), and hFc domain.
- the aspartate substituted at position 79 in the native sequence is double underlined and highlighted, as is the glycine revealed by sequencing to be the N-terminal residue in the mature fusion protein.
- Figures 4A and 4B show a nucleotide sequence encoding ActRIIB(L79D 20-134)- hFc.
- SEQ ID NO: 48 corresponds to the sense strand
- SEQ ID NO: 49 corresponds to the antisense strand.
- the TPA leader (nucleotides 1-66) is double underlined
- the ActRIIB extracellular domain (nucleotides 76-420) is single underlined.
- Figure 5 shows the full amino acid sequence for the truncated GDF trap
- ActRIIB(L79D 25-13 l)-hFc SEQ ID NO: 50
- TPA leader double underline
- truncated ActRIIB extracellular domain residues 25-131 in SEQ ID NO: l; single underline
- hFc domain hFc domain.
- the aspartate substituted at position 79 in the native sequence is double underlined and highlighted, as is the glutamate revealed by sequencing to be the N-terminal residue in the mature fusion protein.
- Figures 6A and 6B show a nucleotide sequence encoding ActRIIB(L79D 25-131)- hFc.
- SEQ ID NO: 51 corresponds to the sense strand
- SEQ ID NO: 52 corresponds to the antisense strand.
- the TPA leader (nucleotides 1-66) is double underlined, and the truncated ActRIIB extracellular domain (nucleotides 76-396) is single underlined.
- the amino acid sequence for the ActRIIB extracellular domain is also shown.
- Figure 7 shows the amino acid sequence for the truncated GDF trap ActRIIB(L79D 25-13 l)-hFc without a leader (SEQ ID NO: 53).
- the truncated ActRIIB extracellular domain (residues 25-131 in SEQ ID NO: 1) is underlined.
- the aspartate substituted at position 79 in the native sequence is double underlined and highlighted, as is the glutamate revealed by sequencing to be the N-terminal residue in the mature fusion protein.
- Figure 8 shows the amino acid sequence for the truncated GDF trap ActRIIB(L79D 25-131) without the leader, hFc domain, and linker (SEQ ID NO: 54).
- the aspartate substituted at position 79 in the native sequence is underlined and highlighted, as is the glutamate revealed by sequencing to be the N-terminal residue in the mature fusion protein.
- Figures 9A and 9B shows an alternative nucleotide sequence encoding
- ActRIIB(L79D 25-13 l)-hFc corresponds to the sense strand
- SEQ ID NO: 56 corresponds to the antisense strand.
- the TPA leader (nucleotides 1-66) is double underlined
- the truncated ActRIIB extracellular domain (nucleotides 76-396) is underlined
- substitutions in the wild-type nucleotide sequence of the extracellular domain are double underlined and highlighted (compare with SEQ ID NO: 51, Figures 6A and 6B).
- the amino acid sequence for the ActRIIB extracellular domain is also shown.
- Figure 10 shows nucleotides 76-396 (SEQ ID NO: 57) of the alternative nucleotide sequence shown in Figures 9A and 9B (SEQ ID NO: 55). The same nucleotide substitutions indicated in Figures 9A and 9B are also underlined and highlighted here.
- SEQ ID NO: 57 encodes only the truncated ActRIIB extracellular domain (corresponding to residues 25-131 in SEQ ID NO: 1) with a L79D substitution, e.g., ActRIIB(L79D 25-131).
- Figure 11 shows multiple sequence alignment of Fc domains from human IgG isotypes using Clustal 2.1. Hinge regions are indicated by dotted underline.
- Figure 12 shows the full, unprocessed amino acid sequence for ActRIIB(25-131)-hFc (SEQ ID NO: 58).
- the TP A leader (residues 1-22) and double-truncated ActRIIB
- extracellular domain (residues 24-131, using numbering based on the native sequence in SEQ ID NO: 1) are each underlined. Highlighted is the glutamate revealed by sequencing to be the N-terminal amino acid of the mature fusion protein, which is at position 25 relative to SEQ ID NO: 1.
- Figures 13A and 13B show a nucleotide sequence encoding ActRIIB(25-131)-hFc (the coding strand is shown at top, SEQ ID NO: 59, and the complement shown at bottom 3'- 5', SEQ ID NO: 60). Sequences encoding the TP A leader (nucleotides 1-66) and ActRIIB extracellular domain (nucleotides 73-396) are underlined. The corresponding amino acid sequence for ActRIIB(25-131) is also shown.
- Figures 14A and 14B show an alternative nucleotide sequence encoding ActRIIB(25- 13 l)-hFc (the coding strand is shown at top, SEQ ID NO: 61, and the complement shown at bottom 3'-5', SEQ ID NO: 62).
- This sequence confers a greater level of protein expression in initial transformants, making cell line development a more rapid process.
- Sequences encoding the TPA leader (nucleotides 1-66) and ActRIIB extracellular domain (nucleotides 73-396) are underlined, and substitutions in the wild type nucleotide sequence of the ECD (see Figures 13 A and 13B) are highlighted.
- the corresponding amino acid sequence for ActRIIB(25-131) is also shown.
- TGF-beta The transforming growth factor-beta (TGF-beta) superfamily contains a variety of growth factors that share common sequence elements and structural motifs. These proteins are known to exert biological effects on a large variety of cell types in both vertebrates and invertebrates. Members of the superfamily perform important functions during embryonic development in pattern formation and tissue specification and can influence a variety of differentiation processes, including adipogenesis, myogenesis, chondrogenesis,
- TGF- ⁇ signals are mediated by heteromeric complexes of type I and type II serine/threonine kinase receptors, which phosphorylate and activate downstream SMAD proteins ⁇ e.g., SMAD proteins 1, 2, 3, 5, and 8) upon ligand stimulation [see, e.g., Massague (2000) Nat. Rev. Mol. Cell Biol. 1 : 169-178].
- type I and type II receptors are transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine- rich region, a transmembrane domain, and a cytoplasmic domain with predicted
- Type I receptors are essential for signaling.
- Type II receptors are required for binding ligands and for activation of type I receptors.
- Type I and II activin receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors.
- ActRII Two related type II receptors (ActRII), ActRIIA and ActRIIB, have been identified as the type II receptors for activins [see, e.g., Mathews and Vale (1991) Cell 65:973-982; and Attisano et a/. (1992) Cell 68: 97-108].
- ActRIIA and ActRIIB can biochemically interact with several other TGF- ⁇ family proteins including, for example, BMP6, BMP7, Nodal, GDF8, and GDF11 [see, e.g., Yamashita et al. (1995) J. Cell Biol.
- ALK4 is the primary type I receptor for activins, particularly for activin A, and ALK-7 may serve as a receptor for other activins as well, particularly for activin B.
- Activins are dimeric polypeptide growth factors that belong to the TGF-beta superfamily. There are three principal activin forms (A, B, and AB) that are
- the human genome also encodes an activin C and an activin E, which are primarily expressed in the liver, and heterodimeric forms containing p c or ⁇ ⁇ are also known.
- activins are unique and multifunctional factors that can stimulate hormone production in ovarian and placental cells, support neuronal cell survival, influence cell-cycle progress positively or negatively depending on cell type, and induce mesodermal differentiation at least in amphibian embryos [DePaolo et al. (1991) Proc Soc Ep Biol Med. 198:500-512; Dyson et al. (1997) Curr Biol. 7:81-84; and Woodruff (1998) Biochem Pharmacol. 55:953-963]. Moreover, erythroid differentiation factor (EDF) isolated from the stimulated human monocytic leukemic cells was found to be identical to activin A [Murata et al.
- EDF erythroid differentiation factor
- activin A promotes erythropoiesis in the bone marrow.
- activin signaling is antagonized by its related heterodimer, inhibin.
- FSH follicle-stimulating hormone
- Other proteins that may regulate activin bioactivity and/or bind to activin include follistatin (FS), follistatin-related protein (FSRP, also known as FLRG or FSTL3), and a2-macroglobulin.
- agents that bind to "activin A” are agents that specifically bind to the PA subunit, whether in the context of an isolated PA subunit or as a dimeric complex ⁇ e.g., a PAPA homodimer or a PAPB heterodimer).
- agents that bind to "activin A” are specific for epitopes present within the PA subunit, but do not bind to epitopes present within the non-PA subunit of the complex ⁇ e.g., the p B subunit of the complex).
- agents disclosed herein that antagonize (inhibit) "activin A” are agents that inhibit one or more activities as mediated by a PA subunit, whether in the context of an isolated PA subunit or as a dimeric complex ⁇ e.g., a PAPA homodimer or a PAPB heterodimer).
- agents that inhibit "activin A” are agents that specifically inhibit one or more activities of the PA subunit, but do not inhibit the activity of the non-p A subunit of the complex ⁇ e.g., the p B subunit of the complex).
- This principle applies also to agents that bind to and/or inhibit "activin B", “activin C", and "activin E”.
- Agents disclosed herein that antagonize "activin AB” are agents that inhibit one or more activities as mediated by the PA subunit and one or more activities as mediated by the ⁇ ⁇ subunit.
- GDF8 Growth and differentiation factor-8
- GDF8 is a negative regulator of skeletal muscle mass. GDF8 is highly expressed in the developing and adult skeletal muscle. The GDF8 null mutation in transgenic mice is characterized by a marked hypertrophy and hyperplasia of the skeletal muscle [McPherron et a/., Nature (1997) 387:83-90]. Similar increases in skeletal muscle mass are evident in naturally occurring mutations of GDF8 in cattle [see, e.g., Ashmore et al. (1974) Growth, 38:501-507; Swatland and Kieffer (1994) J. Anim. Sci. 38:752-757; McPherron and Lee (1997) Proc. Natl.
- GDF8 can modulate the production of muscle-specific enzymes (e.g., creatine kinase) and modulate myoblast cell proliferation [see, e.g. international patent application publication no. WO 00/43781].
- the GDF8 propeptide can noncovalently bind to the mature GDF8 domain dimer, inactivating its biological activity [see, e.g., Miyazono et al. (1988) J. Biol. Chem., 263 : 6407-6415; Wakefield et al. (1988) J. Biol.
- GDFl 1 Growth and differentiation factor-11 (GDFl 1), also known as BMPl 1, is a secreted protein [McPherron et al. (1999) Nat. Genet. 22: 260-264]. GDFl 1 is expressed in the tail bud, limb bud, maxillary and mandibular arches, and dorsal root ganglia during mouse development [see, e.g., Nakashima et al. (1999) Mech. Dev. 80: 185-189]. GDFl 1 plays a unique role in patterning both mesodermal and neural tissues [see, e.g., Gamer et al. (1999) Dev Biol., 208:222-32].
- GDFl 1 was shown to be a negative regulator of chondrogenesis and myogenesis in developing chick limb [see, e.g., Gamer et al. (2001) Dev Biol. 229:407-20].
- the expression of GDFl 1 in muscle also suggests its role in regulating muscle growth in a similar way to GDF8.
- the expression of GDFl 1 in brain suggests that GDFl 1 may also possess activities that relate to the function of the nervous system.
- GDF11 was found to inhibit neurogenesis in the olfactory epithelium [see, e.g., Wu et al. (2003) Neuron. 37: 197-207].
- an ActRIIB antagonist inhibitor
- myelofibrosis patients particularly ameliorating various complications of the disease including, for example, splenomegaly, extramedullary hematopoiesis, and fibrosis.
- the data presented herein show that a GDF trap polypeptide decrease splenomegaly, extramedullary hematopoiesis, and fibrosis in a
- the discloses relates to compositions and method for treating myelofibrosis, particularly treating or preventing one or more complications of myelofibrosis (splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis), by administering to a patient in need thereof an effective amount of one or more ActRIIB antagonists, optionally in combination of one or more other supportive therapies or active agents for treating myelofibrosis.
- homologous in all its grammatical forms and spelling variations, refers to the relationship between two proteins that possess a “common evolutionary origin,” including proteins from superfamilies in the same species of organism, as well as homologous proteins from different species of organism. Such proteins (and their encoding nucleic acids) have sequence homology, as reflected by their sequence similarity, whether in terms of percent identity or by the presence of specific residues or motifs and conserved positions.
- homologous when modified with an adverb such as "highly,” may refer to sequence similarity and may or may not relate to a common evolutionary origin.
- sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin.
- Percent (%) sequence identity with respect to a reference polypeptide (or nucleotide) sequence is defined as the percentage of amino acid residues (or nucleic acids) in a candidate sequence that are identical to the amino acid residues (or nucleic acids) in the reference polypeptide (nucleotide) sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
- Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid (nucleic acid) sequence identity values are generated using the sequence comparison computer program ALIGN-2.
- the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U. S.
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif, or may be compiled from the source code.
- the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- Alternize in all its grammatical forms, refers to the process of activating a protein and/or gene (e.g., by activating or amplifying that protein's gene expression or by inducing an inactive protein to enter an active state) or increasing a protein' s and/or gene's activity.
- “Antagonize”, in all its grammatical forms, refers to the process of inhibiting a protein and/or gene (e.g., by inhibiting or decreasing that protein's gene expression or by inducing an active protein to enter an inactive state) or decreasing a protein' s and/or gene' s activity.
- the terms “about” and “approximately” may mean values that are within an order of magnitude, preferably ⁇ 5 -fold and more preferably ⁇ 2-fold of a given value.
- ActRIIB Antagonists In part, the present disclosure relates to the discovery that an ActRIIB antagonist
- inhibitor can be used to treat myelofibrosis patients, particularly ameliorating various complications of the disease including, for example, splenomegaly, extramedullary hematopoiesis, and fibrosis.
- the data presented herein show that a GDF trap polypeptide decreases splenomegaly, extramedullary hematopoiesis, and fibrosis in a JAK2V617F model of myelofibrosis.
- While soluble GDF trap polypeptides may affect myelofibrosis through a mechanism other than ActRIIB antagonism [e.g., inhibition of one or more of GDF11, GDF 8, activin B, BMP6, GDF3, and BMP10 may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of additional agents, including, perhaps, other members of the TGF-beta superfamily, and such collective inhibition may lead to the desired effect on, for example, myelofibrosis], the disclosure nonetheless demonstrates that desirable therapeutic agents may be selected on the basis of ActRIIB antagonism.
- a mechanism other than ActRIIB antagonism e.g., inhibition of one or more of GDF11, GDF 8, activin B, BMP6, GDF3, and BMP10 may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of additional agents, including, perhaps, other members of the TGF-beta superfamily, and such collective inhibition may lead to the desired effect on, for example
- ActRIIB antagonists e.g., antagonists of the ActRIIB receptor, antagonists of one or more ActRIIB-binding ligand (e.g., GDF11, GDF 8, activin, BMP6, GDF 3, and BMP10) antagonists of one or more type I receptor (e.g., ALK4, ALK5, and/or ALK7), antagonists of one or more co-receptor, antagonists of one or more ActRIIB downstream signaling components (e.g., Smads), or combination of such antagonists] will useful in the treatment of myelofibrosis, particularly in the treatment or preventing of various myelofibrosis-associated complications (e.g., splenomegaly, extramedullary hematopoiesis, and fibrosis).
- Such agents are collectively referred to herein as "ActRIIB antagonists" or "ActRIIB inhibitors”.
- the present disclosure relates to ActRIIB polypeptides and variants thereof (e.g., GDF traps).
- the disclosure provides methods of using ActRIIB polypeptides, alone or in combination with one or more additional supportive therapies, to treat myelofibrosis, particularly treating or preventing one or more complications of myelofibrosis (e.g., splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis), and/or a patient treated with a Janus kinase inhibitor.
- the term "ActRIIB” refers to a family of activin receptor type IIB (ActRIIB) proteins from any species and variants derived from such ActRIIB proteins by mutagenesis or other modification.
- ActRIIB herein is understood to be a reference to any one of the currently identified forms.
- Members of the ActRIIB family are generally transmembrane proteins, composed of a ligand-binding extracellular domain comprising a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
- ActRIIB polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ActRIIB family member as well as any variants thereof
- the human ActRIIB precursor protein sequence is as follows:
- the signal peptide is indicated with a single underline; the extracellular domain is indicated in bold font; and the potential, endogenous N-linked glycosylation sites are indicated with a double underline.
- the processed (mature) extracellular ActRIIB polypeptide sequence is as follows:
- the protein may be produced with an "SGR" sequence at the
- ActRIIB with an alanine at position 64 of SEQ ID NO: 1 is also reported in the literature [Hilden et al. (1994) Blood, 83(8): 2163-2170]. Applicants have ascertained that an ActRIIB-Fc fusion protein comprising an extracellular domain of ActRIIB with the A64 substitution has a relatively low affinity for activin and GDF1 1. By contrast, the same ActRIIB-Fc fusion protein with an arginine at position 64 (R64) has an affinity for activin and GDF11 in the low nanomolar to high picomolar range. Therefore, sequences with an R64 are used as the "wild-type" reference sequence for human ActRIIB in this disclosure.
- the signal peptide is indicated by a single underline and the extracellular domain is indicated by bold font.
- A64 form is as follows:
- the protein may be produced with an "SGR" sequence at the
- NM 001106.3 which encode amino acids 1-513 of the ActRIIB precursor.
- the sequence as shown provides an arginine at position 64 and may be modified to provide an alanine instead.
- the signal sequence is underlined.
- a nucleic acid sequence encoding the processed extracellular human ActRIIB polypeptide is as follows (SEQ ID NO: 8):
- FIG. 1 An alignment of the amino acid sequences of human ActRIIB extracellular domain and human ActRIIA extracellular domain are illustrated in Figure 1. This alignment indicates amino acid residues within both receptors that are believed to directly contact ActRII ligands.
- the composite ActRII structures indicated that the ActRIIB-ligand binding pocket is defined, in part, by residues Y31, N33, N35, L38 through T41, E47, E50, Q53 through K55, L57, H58, Y60, S62, K74, W78 through N83, Y85, R87, A92, and E94 through F101. At these positions, it is expected that conservative mutations will be tolerated.
- ActRIIB is generally well-conserved among vertebrates, with large stretches of the extracellular domain completely conserved.
- Figure 2 depicts a multi- sequence alignment of a human ActRIIB extracellular domain compared to various ActRIIB orthologs. Many of the ligands that bind to ActRIIB are also highly conserved. Accordingly, from these alignments, it is possible to predict key amino acid positions within the ligand-binding domain that are important for normal ActRIIB-ligand binding activities as well as to predict amino acid positions that are likely to be tolerant to substitution without significantly altering normal ActRIIB-ligand binding activities.
- an active, human ActRIIB variant polypeptide useful in accordance with the presently disclosed methods may include one or more amino acids at corresponding positions from the sequence of another vertebrate ActRIIB, or may include a residue that is similar to that in the human or other vertebrate sequences.
- L46 in the human extracellular domain is a valine in Xenopus ActRIIB (SEQ ID NO: 42), and so this position may be altered, and optionally may be altered to another hydrophobic residue, such as V, I or F, or a non-polar residue such as A.
- E52 in the human extracellular domain is a K in Xenopus, indicating that this site may be tolerant of a wide variety of changes, including polar residues, such as E, D, K, R, H, S, T, P, G, Y and probably A.
- T93 in the human extracellular domain is a K in Xenopus, indicating that a wide structural variation is tolerated at this position, with polar residues favored, such as S, K, R, E, D, H, G, P, G and Y.
- F108 in the human extracellular domain is a Y in Xenopus, and therefore Y or other hydrophobic group, such as I, V or L should be tolerated.
- El 11 in the human extracellular domain is K in Xenopus, indicating that charged residues will be tolerated at this position, including D, R, K and H, as well as Q and N.
- Rl 12 in the human extracellular domain is K in Xenopus, indicating that basic residues are tolerated at this position, including R and H.
- a defining structural motif known as a three-finger toxin fold is important for ligand binding by type I and type II receptors and is formed by conserved cysteine residues located at varying positions within the extracellular domain of each monomelic receptor [Greenwald et al. (1999) Nat Struct Biol 6: 18-22; and Hinck (2012) FEBS Lett 586: 1860-1870]. Accordingly, the core ligand-binding domains of human
- ActRIIB as demarcated by the outermost of these conserved cysteines, corresponds to positions 29-109 of SEQ ID NO: 1 (ActRIIB precursor).
- the structurally less-ordered amino acids flanking these cysteine-demarcated core sequences can be truncated by about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 residues at the N-terminus and/or by about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 residues a the C-terminus without necessarily altering ligand binding.
- Exemplary ActRIIB extracellular domains for N-terminal and/or C-terminal truncation include SEQ ID NOs: 2, 3, 5, and 6.
- Attisano et al. showed that a deletion of the proline knot at the C-terminus of the extracellular domain of ActRIIB reduced the affinity of the receptor for activin.
- An ActRIIB- Fc fusion protein containing amino acids 20-119 of present SEQ ID NO: 1, "ActRIIB(20- 119)-Fc”, has reduced binding to GDF11 and activin relative to an ActRIIB(20-134)-Fc, which includes the proline knot region and the complete juxtamembrane domain (see, e.g., U.S. Patent No. 7,842,663).
- an ActRIIB(20-129)-Fc protein retains similar, but somewhat reduced activity, relative to the wild-type, even though the proline knot region is disrupted.
- ActRIIB extracellular domains that stop at amino acid 134, 133, 132, 131, 130 and 129 are all expected to be active, but constructs stopping at 134 or 133 may be most active.
- mutations at any of residues 129-134 are not expected to alter ligand-binding affinity by large margins.
- mutations of P129 and P130 do not substantially decrease ligand binding. Therefore, an ActRIIB(20-129)-Fc protein retains similar, but somewhat reduced activity, relative to the wild-type, even though the proline knot region is disrupted.
- ActRIIB extracellular domains that stop at amino acid 134, 133, 132, 131, 130 and 129 are all expected to be active, but constructs stopping at 134 or 133 may be most active.
- mutations at any of residues 129-134 are not
- ActRIIB polypeptide of the present disclosure may end as early as amino acid 109 (the final cysteine), however, forms ending at or between 109 and 1 19 (e.g., 109, 1 10, 1 1 1, 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, or 1 19) are expected to have reduced ligand binding.
- Amino acid 1 19 (with respect to present SEQ ID NO: 1) is poorly conserved and so is readily altered or truncated.
- ActRIIB polypeptides ending at 128 (with respect to SEQ ID NO: 1) or later should retain ligand-binding activity.
- ActRIIB polypeptides ending at or between 1 19 and 127 will have an intermediate binding ability. Any of these forms may be desirable to use, depending on the clinical or experimental setting.
- a protein beginning at amino acid 29 or before (with respect to SEQ ID NO: 1) will retain ligand-binding activity.
- Amino acid 29 represents the initial cysteine.
- An alanine-to-asparagine mutation at position 24 introduces an N-linked glycosylation sequence without substantially affecting ligand binding [U. S. Patent No. 7,842,663]. This confirms that mutations in the region between the signal cleavage peptide and the cysteine cross-linked region,
- ActRIIB polypeptides beginning at position 20, 21, 22, 23, and 24 should retain general ligand-biding activity
- ActRIIB polypeptides beginning at positions 25, 26, 27, 28, and 29 are also expected to retain ligand-biding activity. It has been demonstrated, e.g., U. S. Patent No. 7,842,663, that, surprisingly, an ActRIIB construct beginning at 22, 23, 24, or 25 will have the most activity.
- ActRIIB a general formula for an active portion (e.g., ligand-binding portion) of ActRIIB comprises amino acids 29-109 of SEQ ID NO: 1. Therefore ActRIIB
- polypeptides may, for example, comprise, consists essentially of, or consists of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ActRIIB beginning at a residue corresponding to any one of amino acids 20-29 (e.g., beginning at any one of amino acids 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 and ending at a position corresponding to any one amino acids 109-134 (e.g., ending at any one of amino acids 109, 1 10, 1 1 1, 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134) of SEQ ID NO: 1.
- Other examples include
- polypeptides that begin at a position from 20-29 (e.g., any one of positions 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29) or 21-29 (e.g., any one of positions 21, 22, 23, 24, 25, 26, 27, 28, or 29) and end at a position from 1 19-134 (e.g., any one of positions 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134), 1 19-133 (e.g., any one of positions 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, or 133), 129-134 (e.g., any one of positions 129, 130, 131, 132, 133, or 134), or 129-133 (e.g., any one of positions 129, 130, 131, 132, or 133) of SEQ ID NO: 1.
- constructs that begin at a position from 20-24 (e.g., any one of positions 20, 21, 22, 23, or 24), 21-24 (e.g., any one of positions 21, 22, 23, or 24), or 22-25 (e.g., any one of positions 22, 22, 23, or 25) and end at a position from 109-134 (e.g., any one of positions 109, 1 10, 1 1 1, 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134), 1 19- 134 (e.g., any one of positions 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130,
- ActRIIB variants comprise no more than 1, 2, 5, 6, 7, 8, 9, 10 or 15
- conservative amino acid changes in the ligand-binding pocket and zero, one or more non- conservative alterations at positions 40, 53, 55, 74, 79 and/or 82 in the ligand-binding pocket.
- Sites outside the binding pocket include the amino and carboxy termini of the extracellular domain (as noted above), and positions 42-46 and 65-73 (with respect to SEQ ID NO: 1).
- An asparagine-to-alanine alteration at position 65 (N65 A) actually improves ligand binding in the A64 background, and is thus expected to have no detrimental effect on ligand binding in the R64 background [U.S. Patent No. 7,842,663].
- SEQ ID NO: 1 these include position 80 (acidic or hydrophobic amino acid), position 78 (hydrophobic, and particularly tryptophan), position 37 (acidic, and particularly aspartic or glutamic acid), position 56 (basic amino acid), position 60 (hydrophobic amino acid, particularly phenylalanine or tyrosine).
- positions that may be desirable to conserve are as follows: position 52 (acidic amino acid), position 55 (basic amino acid), position 81 (acidic), 98 (polar or charged, particularly E, D, R or K), all with respect to SEQ ID NO: 1. It has been previously demonstrated that the addition of a further N-linked
- N-X-S/T sequences may be generally introduced at positions outside the ligand binding pocket defined in Figure 1 in ActRIIB polypeptide of the present disclosure.
- Particularly suitable sites for the introduction of non-endogenous N- X-S/T sequences include amino acids 20-29, 20-24, 22-25, 109-134, 120-134 or 129-134 (with respect to SEQ ID NO: 1).
- N-X-S/T sequences may also be introduced into the linker between the ActRIIB sequence and an Fc domain or other fusion component.
- Such a site may be introduced with minimal effort by introducing an N in the correct position with respect to a pre-existing S or T, or by introducing an S or T at a position corresponding to a pre-existing N.
- desirable alterations that would create an N-linked glycosylation site are: A24N, R64N, S67N (possibly combined with an N65A alteration), E105N, Rl 12N, G120N, E123N, P129N, A132N, Rl 12S and Rl 12T (with respect to SEQ ID NO: 1). Any S that is predicted to be glycosylated may be altered to a T without creating an immunogenic site, because of the protection afforded by the glycosylation.
- an ActRIIB polypeptide of the present disclosure may be a variant having one or more additional, non-endogenous N-linked glycosylation consensus sequences as described above.
- the disclosure relates to ActRIIB antagonists that comprise at least one ActRIIB polypeptide, which includes fragments, functional variants, and modified forms thereof.
- ActRIIB polypeptides for use in accordance with the disclosure are soluble (e.g., an extracellular domain of ActRIIB).
- ActRIIB polypeptides for use in accordance with the disclosure inhibit (antagonize) activity (e.g., Smad signaling) of one or more TGF-beta superfamily ligands [e.g., GDF1 1, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, and/or BMP10.
- TGF-beta superfamily ligands e.g., GDF1 1, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, and/or BMP10.
- ActRIIB polypeptides for use in accordance with the disclosure bind to one or more TGF-beta superfamily ligands [e.g., GDF1 1, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP 10, and/or BMP9].
- TGF-beta superfamily ligands e.g., GDF1 1, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP 10, and/or BMP9].
- ActRIIB polypeptide of the disclosure comprise, consist essentially of, or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ActRIIB beginning at a residue corresponding to amino acids 20-29 (e.g., beginning at any one of amino acids 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 and ending at a position corresponding to amino acids 109-134 (e.g., ending at any one of amino acids 109, 1 10, 1 1 1, 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134) of SEQ ID NO: 1.
- ActRIIB polypeptides of the disclosure comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 29-109 of SEQ ID NO: 1.
- ActRIIB polypeptides of the disclosure comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 29-109 of SEQ ID NO: 1, wherein the position corresponding to L79 of SEQ ID NO: 1 is an acidic amino acid (naturally occurring acidic amino acids D and E or an artificial acidic amino acid).
- ActRIIB polypeptides of the disclosure comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 25-131 of SEQ ID NO: 1.
- ActRIIB polypeptides of the disclosure comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 25-131 of SEQ ID NO: 1, wherein the position corresponding to L79 of SEQ ID NO: 1 is an acidic amino acid.
- ActRIIB polypeptide of disclosure comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of any one of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 24, 25, 28, 29, 30, 31, 33, 34, 35, 45, 50, 53, 54, and 58.
- ActRIIB polypeptide of disclosure comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of any one of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 24, 25, 28, 29, 30, 31, 33, 34, 35, 45, 50, 53, 54, and 58, wherein the position corresponding to L79 of SEQ ID NO: 1 is an acidic amino acid.
- ActRIIB polypeptides of the disclosure comprise least one ActRIIB polypeptide wherein the position corresponding to L79 of SEQ ID NO: 1 is not an acidic amino acid (i.e., is not a naturally occurring acid amino acids D or E or an artificial acidic amino acid residue).
- GDF trap polypeptides also referred to as "GDF traps"
- GDF traps of the present disclosure are variant ActRIIB polypeptides that comprise one or more mutations (e.g., amino acid additions, deletions, substitutions, and combinations thereof) in the extracellular domain (also referred to as the ligand-binding domain) of an ActRIIB polypeptide (e.g., a "wild-type” or unmodified ActRII polypeptide) such that the variant ActRIIB polypeptide has one or more altered ligand-binding activities than the corresponding wild-type ActRIIB polypeptide.
- mutations e.g., amino acid additions, deletions, substitutions, and combinations thereof
- the extracellular domain also referred to as the ligand-binding domain
- an ActRIIB polypeptide e.g., a "wild-type” or unmodified ActRII polypeptide
- GDF trap polypeptides of the present disclosure retain at least one similar activity as a corresponding wild-type ActRIIB polypeptide.
- preferable GDF traps bind to and inhibit (e.g. antagonize) the function of GDF11 and/or GDF8.
- GDF traps of the present disclosure further bind to and inhibit one or more of ligand of the TGF-beta superfamily. Accordingly, the present disclosure provides GDF trap polypeptides that have an altered binding specificity for one or more ActRIIB ligands.
- one or more mutations may be selected that increase the selectivity of the altered ligand-binding domain for GDF11 and/or GDF8 over one or more ActRIIB- binding ligands such as activins (activin A, activin B, activin AB, activin C, and/or activin E), particularly activin A.
- the altered ligand-binding domain has a ratio of K d for activin binding to K d for GDF11 and/or GDF8 binding that is at least 2-, 5-, 10-, 20-, 50-, 100- or even 1000-fold greater relative to the ratio for the wild-type ligand-binding domain.
- the altered ligand-binding domain has a ratio of IC 50 for inhibiting activin to IC 50 for inhibiting GDF 11 and/or GDF 8 that is at least 2-, 5-, 10-, 20-, 50-, 100- or even 1000-fold greater relative to the wild-type ligand-binding domain.
- the altered ligand- binding domain inhibits GDFl 1 and/or GDF8 with an IC 50 at least 2-, 5-, 10-, 20-, 50-, 100- or even 1000-times less than the IC 50 for inhibiting activin (e.g., activin A).
- GDF traps of the present disclosure are designed to preferentially bind to GDFl 1 and/or GDF8 (also known as myostatin).
- GDFl 1 and/or GDF8-binding traps may further bind to activin B.
- GDFl 1 and/or GDF8- binding traps may further bind to BMP6.
- GDFl 1 and/or GDF8-binding traps may further bind to BMP 10.
- GDFl 1 and/or GDF8-binding traps may further bind to activin B and BMP6.
- GDF traps of the present disclosure have diminished binding affinity for activins (e.g., activin A, activin A/B, activin B, activin C, activin E ), e.g., in comparison to a wild-type ActRIIB polypeptide.
- a GDF trap polypeptide of the present disclosure has diminished binding affinity for activin A.
- Amino acid residues of the ActRIIB proteins are in the ActRIIB ligand-binding pocket and help mediated binding to its ligands including, for example, activin A, GDFl 1, and GDF8.
- GDF trap polypeptides comprising an altered-ligand binding domain (e.g 3 a GDF 8/GDF 11 -binding domain) of an ActRIIB receptor which comprises one or more mutations at those amino acid residues.
- the positively-charged amino acid residue Asp (D80) of the ligand-binding domain of ActRIIB can be mutated to a different amino acid residue to produce a GDF trap polypeptide that preferentially binds to GDF8, but not activin.
- the D80 residue with respect to SEQ ID NO: 1 is changed to an amino acid residue selected from the group consisting of: an uncharged amino acid residue, a negative amino acid residue, and a hydrophobic amino acid residue.
- the hydrophobic residue L79 of SEQ ID NO: 1 can be altered to confer altered activin- GDF11/GDF8 binding properties.
- an L79P substitution reduces GDFl 1 binding to a greater extent than activin binding.
- replacement of L79 with an acidic amino acid an aspartic acid or glutamic acid; an L79D or an L79E substitution] greatly reduces activin A binding affinity while retaining GDFl 1 binding affinity.
- the methods described herein utilize a GDF trap polypeptide which is a variant ActRIIB polypeptide comprising an acidic amino acid (e.g., D or E) at the position corresponding to position 79 of SEQ ID NO: 1, optionally in combination with one or more additional amino acid substitutions, additions, or deletions.
- the present disclosure contemplates making functional variants by modifying the structure of an ActRIIB polypeptide for such purposes as enhancing therapeutic efficacy or stability (e.g., shelf-life and resistance to proteolytic degradation in vivo).
- Variants can be produced by amino acid substitution, deletion, addition, or
- Whether a change in the amino acid sequence of a polypeptide of the disclosure results in a functional homolog can be readily determined by assessing the ability of the variant polypeptide to produce a response in cells in a fashion similar to the wild-type polypeptide, or to bind to one or more TGF-beta ligands including, for example, BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP 5, BMP6, BMP7, BMP 8 a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7, GDF8, GDF9b/BMP15, GDF11/BMP11, GDF15/MIC1, TGF- ⁇ , TGF-p2, TGF-p3, activin A, activin B, activin C, activin E, activin AB, activin AC, nodal, glial cell-derived neurotrophic factor (GDNF), neurturin, artemin, persephin, MIS, and
- the present disclosure contemplates specific mutations of an ActRIIB polypeptide so as to alter the glycosylation of the polypeptide.
- Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O-linked or N-linked glycosylation sites.
- Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine or asparagine-X-serine (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the polypeptide (for O-linked glycosylation sites).
- a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
- Another means of increasing the number of carbohydrate moieties on a polypeptide is by chemical or enzymatic coupling of glycosides to the polypeptide.
- the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine. Removal of one or more carbohydrate moieties present on a polypeptide may be accomplished chemically and/or enzymatically.
- Chemical deglycosylation may involve, for example, exposure of a polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N- acetylgalactosamine), while leaving the amino acid sequence intact.
- Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al. [Meth. Enzymol. (1987) 138:350].
- polypeptides of the present disclosure for use in humans may be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines are expected to be useful as well.
- the present disclosure further contemplates a method of generating mutants, particularly sets of combinatorial mutants of an ActRIIB polypeptide as well as truncation mutants. Pools of combinatorial mutants are especially useful for identifying functionally active (e.g., TGF-beta superfamily ligand binding) ActRIIB sequences.
- the purpose of screening such combinatorial libraries may be to generate, for example, polypeptides variants which have altered properties, such as altered pharmacokinetic or altered ligand binding.
- a variety of screening assays are provided below, and such assays may be used to evaluate variants.
- ActRIIB variants may be screened for ability to bind to one or more TGF-beta superfamily ligands (e.g., BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP 5, BMP6, BMP7, BMP 8 a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7,
- TGF-beta superfamily ligands e.g., BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP 5, BMP6, BMP7, BMP 8 a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7,
- GDF8 GDF9b/BMP15, GDF11/BMP11, GDF15/MIC1, TGF- ⁇ , TGF-p2, TGF-p3, activin A, activin B, activin AB, activin AC, nodal, glial cell-derived neurotrophic factor (GD F), neurturin, artemin, persephin, MIS, and Lefty), to prevent binding of a TGF-beta superfamily ligand to a TGF-beta superfamily receptor, and/or to interfere with signaling caused by an TGF-beta superfamily ligand.
- GD F glial cell-derived neurotrophic factor
- the activity of ActRIIB polypeptides may also be tested in a cell-based or in vivo assay. For example, the effect of an ActRIIB polypeptide on the expression of genes involved in myelofibrosis acuity may be assessed.
- ActRII ligand proteins e.g., BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP5, BMP6, BMP7, BMP 8 a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7, GDF8, GDF9b/BMP15, GDF1 1/BMP1 1, GDF 15/MIC1, TGF- ⁇ , TGF-P2, TGF-P3, activin A, activin B, activin C, activin E, activin AB, activin AC, nodal, glial cell-derived neurotrophic factor (GD F), neurturin, artemin, persephin, MIS, and
- GD F glial cell-derived neurotrophic factor
- an ActRIIB polypeptide may be administered to a mouse or other animal and effects on myelofibrosis may be assessed using art-recognized methods.
- the activity of an ActRIIB polypeptide or variant thereof may be tested in blood cell precursor cells for any effect on growth of these cells, for example, by the assays as described herein and those of common knowledge in the art.
- a SMAD-responsive reporter gene may be used in such cell lines to monitor effects on downstream signaling.
- Combinatorial-derived variants can be generated which have increased selectivity or generally increased potency relative to a reference ActRIIB polypeptide. Such variants, when expressed from recombinant DNA constructs, can be used in gene therapy protocols.
- mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding unmodified ActRIIB polypeptide.
- the altered protein can be rendered either more stable or less stable to proteolytic degradation or other cellular processes which result in destruction, or otherwise inactivation, of an unmodified polypeptide.
- variants, and the genes which encode them can be utilized to alter polypeptide complex levels by modulating the half-life of the polypeptide. For instance, a short half-life can give rise to more transient biological effects and, when part of an inducible expression system, can allow tighter control of recombinant polypeptide complex levels within the cell.
- mutations may be made in the linker (if any) and/or the Fc portion to alter the half-life of the ActRIIB polypeptide.
- a combinatorial library may be produced by way of a degenerate library of genes encoding a library of polypeptides which each include at least a portion of potential ActRIIB sequences.
- a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential ActRIIB encoding nucleotide sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display).
- the library of potential homologs can be generated from a degenerate oligonucleotide sequence.
- Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes can then be ligated into an appropriate vector for expression.
- the synthesis of degenerate oligonucleotides is well known in the art [Narang, SA (1983) Tetrahedron 39:3; Itakura et al. (1981) Recombinant DNA, Proc. 3rd Cleveland Sympos. Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp273-289; Itakura et al. (1984) Annu. Rev. Biochem.
- ActRIIB polypeptides of the disclosure can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis [Ruf et al. (1994) Biochemistry 33 : 1565-1572; Wang et al. (1994) J. Biol. Chem. 269:3095-3099; Balint et al. (1993) Gene 137: 109-118; Grodberg et al. (1993) Eur. J. Biochem. 218:597-601;
- TGF-beta ligand e.g., BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP 5, BMP6, BMP7, BMP 8 a, BMP 8b, BMP9, BMP10, GDF3, GDF5,
- GDNF glial cell-derived neurotrophic factor
- neurturin artemin
- persephin persephin
- MIS lefty
- functionally active fragments of ActRIIB polypeptides of the present disclosure can be obtained by screening polypeptides recombinantly produced from the corresponding fragment of the nucleic acid encoding an ActRIIB polypeptide (e.g., SEQ ID NOs: 7, 8, 26, 32, 48, 49, 51, 52, 55, 56, 57, 59, 60, 61, and 62).
- fragments can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry. The fragments can be produced
- ligands e.g 3 BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP5, BMP6, BMP7, BMP 8 a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7, GDF8, GDF9b/BMP15, GDF11/BMP11, GDF15/MIC1, TGF- ⁇ , TGF-p2, TGF-p3, activin A, activin B, activin C, activin E, activin AB, activin AC, nodal, glial cell-derived neurotrophic factor (GDNF), neurturin, artemin, persephin, MIS, and Lefty).
- GDNF glial cell-derived neurotrophic factor
- ActRIIB polypeptides of the present disclosure may further comprise post-translational modifications in addition to any that are naturally present in the ActRIIB polypeptide.
- modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
- the ActRIIB polypeptide may contain non-amino acid elements, such as polyethylene glycols, lipids, polysaccharide or monosaccharide, and phosphates. Effects of such non-amino acid elements on the functionality of a ligand trap polypeptide may be tested as described herein for other ActRIIB variants.
- a polypeptide of the disclosure When a polypeptide of the disclosure is produced in cells by cleaving a nascent form of the polypeptide, post-translational processing may also be important for correct folding and/or function of the protein.
- Different cells e.g., CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293 have specific cellular machinery and
- ActRIIB polypeptides of the present disclosure include fusion proteins having at least a portion (domain) of an ActRIIB polypeptide and one or more heterologous portions (domains).
- fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S-transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy-chain constant region (Fc), maltose binding protein (MBP), or human serum albumin.
- a fusion domain may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
- matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used.
- Many of such matrices are available in "kit” form, such as the Pharmacia GST purification system and the QIAexpressTM system (Qiagen) useful with (HIS 6 ) fusion partners.
- a fusion domain may be selected so as to facilitate detection of the ActRIIB polypeptide. Examples of such detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
- the fusion domains have a protease cleavage site, such as for Factor Xa or thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent protease cleavage site, such as for Factor Xa or thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent
- fusion domains include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function) including, for example constant domains from
- immunoglobulins e.g., Fc domains.
- ActRIIB polypeptides of the present disclosure contain one or more modifications that are capable of “stabilizing” the polypeptides.
- stabilizing is meant anything that increases the in vitro half-life, serum half-life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other
- such modifications enhance the shelf-life of the polypeptides, enhance circulatory half-life of the polypeptides, and/or reduce
- stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an
- ActRIIB polypeptide domain and a stabilizer domain modifications of a glycosylation site (including, for example, addition of a glycosylation site to a polypeptide of the disclosure), and modifications of carbohydrate moiety (including, for example, removal of carbohydrate moieties from a polypeptide of the disclosure).
- the term "stabilizer domain” not only refers to a fusion domain (e.g., an immunoglobulin Fc domain) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous moiety, such as polyethylene glycol.
- an ActRIIB polypeptide is fused with a heterologous domain that stabilizes the polypeptide (a "stabilizer” domain), preferably a heterologous domain that increases stability of the polypeptide in vivo.
- a heterologous domain that stabilizes the polypeptide e.g., a "stabilizer” domain
- Fusions with a constant domain of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins.
- fusions to human serum albumin can confer desirable properties.
- GlFc human IgGl
- SEQ ID NO: 9 An example of a native amino acid sequence that may be used for the Fc portion of human IgGl (GlFc) is shown below (SEQ ID NO: 9). Dotted underline indicates the hinge region, and solid underline indicates positions with naturally occurring variants.
- the disclosure provides polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 9.
- Naturally occurring variants in GlFc would include E134D and M136L according to the numbering system used in SEQ ID NO: 9 (see Uniprot P01857).
- the IgGl Fc domain has one or more mutations at residues such as Asp- 265, lysine 322, and Asn-434.
- the mutant IgGl Fc domain having one or more of these mutations ⁇ e.g., Asp-265 mutation
- the mutant Fc domain having one or more of these mutations has increased ability of binding to the MHC class I-related Fc-receptor (FcRN) relative to a wild-type IgGl Fc domain.
- SEQ ID NO: 10 An example of a native amino acid sequence that may be used for the Fc portion of human IgG2 (G2Fc) is shown below (SEQ ID NO: 10). Dotted underline indicates the hinge region and double underline indicates positions where there are data base conflicts in the sequence (according to UniProt P01859).
- the disclosure provides polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 10.
- G3Fc Two examples of amino acid sequences that may be used for the Fc portion of human IgG3 (G3Fc) are shown below.
- the hinge region in G3Fc can be up to four times as long as in other Fc chains and contains three identical 15-residue segments preceded by a similar 17-residue segment.
- the first G3Fc sequence shown below (SEQ ID NO: 1 1) contains a short hinge region consisting of a single 15-residue segment, whereas the second G3Fc sequence (SEQ ID NO: 12) contains a full-length hinge region.
- dotted underline indicates the hinge region
- solid underline indicates positions with naturally occurring variants according to UniProt P01859.
- polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NOs: 1 1 and 12.
- variant WIS is lacking most of the V region and all of the CHI region. It has an extra interchain disulfide bond at position 7 in addition to the 11 normally present in the hinge region.
- variant ZUC lacks most of the V region, all of the CHI region, and part of the hinge.
- variant OMM may represent an allelic form or another gamma chain subclass. The present disclosure provides additional fusion proteins comprising G3Fc domains containing one or more of these
- polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 13.
- a given amino acid position in an immunoglobulin sequence consisting of hinge, C H 2, and C H 3 regions will be identified by a different number than the same position when numbering encompasses the entire IgGl heavy-chain constant domain (consisting of the C H 1, hinge, C H 2, and C H 3 regions) as in the Uniprot database.
- correspondence between selected C H 3 positions in a human GIFc sequence (SEQ ID NO: 9), the human IgGl heavy chain constant domain (Uniprot P01857), and the human IgGl heavy chain is as follows.
- fusion proteins ⁇ e.g., immunoglobulin Fc fusion proteins
- elements of the fusion proteins may be arranged in any manner that is consistent with desired
- an ActRIIB polypeptide domain may be placed C-terminal to a heterologous domain, or alternatively, a heterologous domain may be placed C-terminal to an ActRIIB polypeptide domain.
- the ActRIIB polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
- an ActRIIB receptor fusion protein may comprise an amino acid sequence as set forth in the formula A-B-C.
- the B portion corresponds to an ActRIIB polypeptide domain.
- the A and C portions may be independently zero, one, or more than one amino acid, and both the A and C portions when present are heterologous to B.
- an ActRIIB fusion protein comprises an amino acid sequence as set forth in the formula A-B-C, wherein A is a leader (signal) sequence, B consists of
- an ActRIIB fusion protein comprises an amino acid sequence as set forth in the formula A-B-C, wherein A is a TPA leader sequence, B consists of an ActRIIB receptor polypeptide domain, and C is an immunoglobulin Fc domain.
- Preferred fusion proteins comprise the amino acid sequence set forth in any one of SEQ ID NOs: 24, 25, 28, 29, 31, 33, 34, 45, 50, 53, and 58.
- ActRIIB polypeptides to be used in accordance with the methods described herein are isolated polypeptides.
- an isolated protein or polypeptide is one which has been separated from a component of its natural environment.
- a polypeptide of the disclosure is purified to greater than 95%, 96%, 97%), 98%o, or 99% purity as determined by, for example, electrophoretic ⁇ e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic ⁇ e.g., ion exchange or reverse phase HPLC). Methods for assessment of antibody purity are well known in the art [see, e.g., Flatman et al, (2007) J. Chromatogr. B 848:79-87].
- ActRIIB polypeptides to be used in accordance with the methods described herein are recombinant polypeptides.
- ActRIIB polypeptides of the disclosure can be produced by a variety of art-known techniques.
- polypeptides of the disclosure can be synthesized using standard protein chemistry techniques such as those described in Bodansky, M. Principles of Peptide Synthesis, Springer Verlag, Berlin (1993) and Grant G. A. (ed.), Synthetic Peptides: A User's Guide, W. H. Freeman and Company, New York (1992).
- automated peptide synthesizers are commercially available ⁇ e.g., Advanced ChemTech Model 396;
- the polypeptides of the disclosure may be recombinantly produced using various expression systems [e.g., E. coli, Chinese Hamster Ovary (CHO) cells, COS cells, baculovirus] as is well known in the art.
- the modified or unmodified polypeptides of the disclosure may be produced by digestion of recombinantly produced full-length ActRIIB polypeptides by using, for example, a protease, e.g., trypsin, therm olysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
- a protease e.g., trypsin, therm olysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
- PACE paired basic amino acid converting enzyme
- Computer analysis using commercially available software, e.g., Mac Vector, Omega, PCGene, Molecular Simulation, Inc. can be used to identify proteolytic cleavage sites.
- polypeptides may be produced from recombinantly generated full-length ActRIIB polypeptides using chemical cleavage (e.g., cyanogen bromide, hydroxylamine, etc.).
- the present disclosure provides isolated and/or recombinant nucleic acids encoding the ActRIIB polypeptides (including fragments, functional variants (e.g., GDF traps), and fusion proteins thereof).
- SEQ ID NO: 7 encodes a naturally occurring human ActRIIB precursor polypeptide (the R64 variant described above), while SEQ ID NO: 8 encodes the processed extracellular domain of ActRIIB (the R64 variant described above).
- the subject nucleic acids may be single-stranded or double stranded. Such nucleic acids may be DNA or RNA molecules. These nucleic acids may be used, for example, in methods for making ActRII-based ligand trap polypeptides as described herein.
- isolated nucleic acid(s) refers to a nucleic acid molecule that has been separated from a component of its natural environment.
- An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
- nucleic acids encoding ActRIIB polypeptides of the disclosure are understood to include nucleic acids that are variants of any one of SEQ ID NOs: 7, 8, 26, 32, 48, 49, 51, 52, 55, 56, 57, 59, 60, 61, and 62.
- Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions, or deletions including allelic variants, and therefore, will include coding sequence that differ from the nucleotide sequence designated in any one of SEQ ID NOs: 7, 8, 26, 32, 48, 49, 51, 52, 55, 56, 57, 59, 60, 61, and 62.
- ActRIIB polypeptides of the disclosure are encoded by isolated and/or recombinant nucleic acid sequences that are at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOs: 7, 8, 26, 32, 48, 49, 51, 52, 55, 56, 57, 59, 60, 61, and 62.
- nucleic acid sequences that are at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequences complementary to SEQ ID NOs: 7, 8, 26, 32, 48, 49, 51, 52, 55, 56, 57, 59, 60, 61, and 62, and variants thereof, are also within the scope of the present disclosure.
- the nucleic acid sequences of the disclosure can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
- nucleic acids of the present disclosure also include nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NOs: 7, 8, 26, 32, 48, 49, 51, 52, 55, 56, 57, 59, 60, 61, and 62, complement sequences of SEQ ID NOs: 7, 8, 26, 32, 48, 49, 51, 52, 55, 56, 57, 59, 60, 61, and 62, or fragments thereof.
- appropriate stringency conditions which promote DNA hybridization can be varied.
- appropriate stringency conditions which promote DNA hybridization can be varied.
- the hybridization at 6.0 x sodium chloride/sodium citrate (SSC) at about 45 °C, followed by a wash of 2.0 x SSC at 50 °C.
- the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 °C to a high stringency of about 0.2 x SSC at 50 °C.
- the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 °C, to high stringency conditions at about 65 °C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
- the disclosure provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
- Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NOs: 7, 8, 26, 32, 48, 49, 51, 52, 55, 56, 57, 59, 60, 61, and 62 to degeneracy in the genetic code are also within the scope of the disclosure.
- a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein.
- CAU and CAC are synonyms for histidine
- nucleotides up to about 3-5% of the nucleotides
- nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this disclosure.
- the recombinant nucleic acids of the present disclosure may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
- Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art and can be used in a variety of host cells.
- one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are
- the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and can vary with the host cell used.
- the subject nucleic acid disclosed herein is provided in an expression vector comprising a nucleotide sequence encoding an ActRIIB polypeptide and operably linked to at least one regulatory sequence.
- Regulatory sequences are art-recognized and are selected to direct expression of the ActRIIB polypeptide.
- the term regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology : Methods in Enzymology, Academic Press, San Diego, CA (1990). For instance, any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an ActRIIB polypeptide.
- Such useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast a-mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
- the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
- a recombinant nucleic acid of the present disclosure can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
- Expression vehicles for production of a recombinant ActRIIB polypeptide include plasmids and other vectors.
- suitable vectors include plasmids of the following types: pBR322-derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
- Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
- the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
- vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
- derivatives of viruses such as the bovine papilloma virus (BPV-1), or Epstein- Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
- BBV-1 bovine papilloma virus
- pHEBo Epstein- Barr virus
- pREP-derived and p205 Epstein- Barr virus
- examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
- the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
- suitable expression systems for both prokaryotic and eukaryotic cells as well as general recombinant procedures, e.g., Molecular Cloning A
- baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the B-gal containing pBlueBac III).
- a vector will be designed for production of the subject ActRIIB polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
- a vector will be designed for production of the subject ActRIIB polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
- the subject gene constructs can be used to cause expression of the subject ActRII polypeptides in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for purification.
- This disclosure also pertains to a host cell transfected with a recombinant gene including a coding sequence for one or more of the subject ActRIIB polypeptides.
- the host cell may be any prokaryotic or eukaryotic cell.
- an ActRIIB polypeptide of the disclosure may be expressed in bacterial cells such as E. coli, insect cells ⁇ e.g., using a baculovirus expression system), yeast, or mammalian cells [e.g. a Chinese hamster ovary (CHO) cell line].
- Other suitable host cells are known to those skilled in the art.
- a host cell transfected with an expression vector encoding an ActRIIB polypeptide can be cultured under appropriate conditions to allow expression of the ActRIIB polypeptide to occur.
- the polypeptide may be secreted and isolated from a mixture of cells and medium containing the polypeptide.
- the ActRIIB polypeptide may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
- a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
- the subject polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, immunoaffinity purification with antibodies specific for particular epitopes of the ActRIIB polypeptides, and affinity purification with an agent that binds to a domain fused to the ActRIIB polypeptide ⁇ e.g., a protein A column may be used to purify an ActRIIB-Fc fusion protein).
- the ActRIIB polypeptide is a fusion protein containing a domain which facilitates its purification.
- purification is achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenyl sepharose chromatography, size exclusion chromatography, and cation exchange chromatography.
- the purification could be completed with viral filtration and buffer exchange.
- An ActRIIB protein may be purified to a purity of >90%, >95%, >96%, >98%, or >99% as determined by size exclusion
- a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant ActRIIB polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni 2+ metal resin.
- the purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified ActRIIB polypeptide. See, e.g., Hochuli et al. (1987) J. Chromatography 411 : 177; and Janknecht et al. (1991) PNAS USA 88:8972.
- fusion genes are well known. Essentially, the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
- the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
- PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence. See, e.g., Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992.
- an ActRIIB antagonist to be used in accordance with the method and uses disclosed herein is an antibody (ActRIIB antagonist antibody), or combination of antibodies.
- An ActRIIB antagonist antibody, or combination of antibodies may bind to, for example, one or more ActRIIB -binding ligands (e.g., activin, GDF11, GDF8, GDF3, BMP10, and BMP6), ActRIIB receptor, type I receptor (e.g., ALK4, ALK5, and/or ALK7), and/or ActRIIB co-receptor.
- ActRIIB antagonist antibodies may be used alone or in combination with one or more supportive therapies or active agents, to treat
- myelofibrosis particularly treating or preventing one or more complications of myelofibrosis (e.g., splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis), and/or a patient treated with a Janus kinase inhibitor.
- myelofibrosis e.g., splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis
- a patient treated with a Janus kinase inhibitor e.g., splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis
- a ActRIIB antagonist antibody is an antibody that inhibits at least activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, and/or activin BE). Therefore, in some aspects, activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, and/or activin BE). Therefore, in some activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, and/or activin BE). Therefore, in some activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, and/or activin BE). Therefore, in some activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin
- a ActRIIB antagonist antibody binds to at least activin.
- an activin antibody or anti -activin antibody generally refers to an antibody that binds to activin with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting activin.
- the extent of binding of an activin antibody to an unrelated, non-activin protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to activin as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- RIA radioimmunoassay
- an activin antibody binds to an epitope of activin that is conserved among activin from different species.
- an anti-activin antibody binds to human activin.
- an activin antibody may inhibit activin from binding to a type I and/or type II receptor (e.g., ActRIIB, ALK4, ALK5, and/or ALK7) and thus inhibit activin-mediated signaling (e.g., Smad signaling).
- an activin antibody may inhibit activin from binding to an ActRIIB co-receptor and thus inhibit activin-mediated signaling (e.g., Smad signaling).
- activin A has similar sequence homology to activin B and therefore antibodies that bind to activin A, in some instances, may also bind to and/or inhibit activin B, which also applies to anti-activin B antibodies.
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to activin and further binds to, for example, one or more additional ActRIIB ligands [e.g., GDF11, GDF8, GDF3, BMP10, and BMP6], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- additional ActRIIB ligands e.g., GDF11, GDF8, GDF3, BMP10, and BMP6
- type I receptor and/or type II receptors e.g., ActRIIB, ALK4, ALK5, and/or ALK7
- a multispecific antibody that binds to activin does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- a multispecific antibody that binds to activin does not bind or does not substantially bind to activin A (e.g., binds to activin A with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an activin antibody and one or more additional antibodies that bind to, for example, one or more additional ActRIIB superfamily ligands [e.g., GDF8, GDF11, GDF3, and BMP6], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- a combination of antibodies that comprises an activin antibody does not comprise a BMP9 antibody.
- a combination of antibodies that comprises an activin antibody does not comprise an activin A antibody.
- an ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least activin B. Therefore, in some embodiments, an ActRIIB antagonist antibody, or combination of antibodies, binds to at least activin B.
- an activin B antibody or anti-activin B antibody generally refers to an antibody that binds to activin B with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting activin B.
- the extent of binding of an activin B antibody to an unrelated, non-activin B protein is less than about 10%, 9%, 8%, 7%, 6%), 5%), 4%), 3%), 2%), or less than about 1% of the binding of the antibody to activin as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- an activin B antibody binds to an epitope of activin B that is conserved among activin B from different species.
- an anti-activin B antibody binds to human activin B.
- an activin B antibody may inhibit activin B from binding to a type I and/or type II receptor (e.g., ActRIIB, ALK4, ALK5, and/or ALK7) and thus inhibit activin B-mediated signaling (e.g., Smad signaling).
- an activin B antibody may inhibit activin B from binding to a co-receptor and thus inhibit activin B-mediated signaling (e.g., Smad signaling). It should be noted that activin B has similar sequence homology to activin A and therefore antibodies that bind to activin B, in some instances, may also bind to and/or inhibit activin A.
- the disclosure relates to a multispecific antibody (e.g., bi- specific antibody), and uses thereof, that binds to activin B and further binds to, for example, one or more additional ActRIIB ligands [e.g., GDF11, GDF8, GDF3, BMP10, and BMP6], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- additional ActRIIB ligands e.g., GDF11, GDF8, GDF3, BMP10, and BMP6
- type I receptor and/or type II receptors e.g., ActRIIB, ALK4, ALK5, and/or ALK7
- co-receptors e.g., ActRIIB, ALK4, ALK5, and/or ALK7
- a multispecific antibody that binds to activin B does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- a multispecific antibody that binds to activin B does not bind or does not substantially bind to activin A (e.g., binds to activin A with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an activin B antibody and one or more additional antibodies that bind to, for example, one or more additional ActRIIB ligands [e.g., GDF8, GDFl 1, GDF3, BMP6, and BMP 10], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- a combination of antibodies that comprises an activin B antibody does not comprise a BMP9 antibody.
- a combination of antibodies that comprises an activin B antibody does not comprise an activin A antibody.
- an ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least GDF8. Therefore, in some embodiments, an ActRIIB antagonist antibody, or combination of antibodies, binds to at least GDF8.
- a GDF8 antibody or anti-GDF8 antibody generally refers to an antibody that binds to GDF8 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting GDF8.
- the extent of binding of a GDF8 antibody to an unrelated, non-GDF8 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to GDF8 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a GDF8 antibody binds to an epitope of GDF8 that is conserved among GDF8 from different species.
- an anti-GDF8 antibody binds to human GDF8.
- a GDF8 antibody may inhibit GDF8 from binding to a type I and/or type II receptor (e.g., ActRIIB, ALK4, ALK5, and/or ALK7) and thus inhibit GDF8-mediated signaling (e.g., Smad signaling).
- a GDF8 antibody may inhibit GDF8 from binding to a co-receptor and thus inhibit GDF8- mediated signaling (e.g., Smad signaling).
- GDF8 has high sequence homology to GDF l 1 and therefore antibodies that bind to GDF8, in some instances, may also bind to and/or inhibit GDFl 1.
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to GDF8 and further binds to, for example, one or more additional ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDFl 1, GDF3, BMP10, and BMP6], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE
- GDFl 1, GDF3, BMP10, and BMP6 one or more type I receptor and/or type II receptors (e.g
- a multispecific antibody that binds to GDF8 does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- a multispecific antibody that binds to GDF8 does not bind or does not substantially bind to activin A (e.g., binds to activin A with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a GDF8 antibody and one or more additional antibodies that bind to, for example, one or more additional ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDFl 1, GDF3, BMP6, BMP 10, and BMP 15], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- a combination of antibodies that comprises a GDF8 antibody does not comprise a BMP9 antibody.
- a combination of antibodies that comprises a GDF8 antibody does not comprise an activin A antibody.
- an ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least GDFl 1. Therefore, in some embodiments, an ActRIIB antagonist antibody, or combination of antibodies, binds to at least GDFl 1.
- a GDFl 1 antibody or anti-GDFl 1 antibody generally refers to an antibody that binds to GDFl 1 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting GDFl 1.
- the extent of binding of a GDFl 1 antibody to an unrelated, non-GDFl 1 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to GDFl 1 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a GDFl 1 antibody binds to an epitope of GDFl 1 that is conserved among GDFl 1 from different species.
- an anti-GDFl 1 antibody binds to human GDFl 1.
- a GDFl 1 antibody may inhibit GDFl 1 from binding to a type I and/or type II receptor (e.g., ActRIIB, ALK4, ALK5, and/or ALK7) and thus inhibit GDFl 1 -mediated signaling (e.g., Smad signaling).
- a GDFl 1 antibody may inhibit GDFl 1 from binding to a co-receptor and thus inhibit GDFl 1 -mediated signaling (e.g., Smad signaling).
- GDFl 1 has high sequence homology to GDF8 and therefore antibodies that bind to GDFl 1, in some instances, may also bind to and/or inhibit GDF8.
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to GDFl 1 and further binds to, for example, one or more additional ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF8, GDF3, BMP 10, and BMP6], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE
- GDF8 GDF3, BMP 10, and BMP6 one or more type I receptor and/or type II receptors
- a multispecific antibody that binds to GDFl 1 does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- a multispecific antibody that binds to GDFl 1 does not bind or does not substantially bind to activin A (e.g., binds to activin A with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a GDFl 1 antibody and one or more additional antibodies that bind to, for example, one or more additional ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF8, GDF3, BMP6, and BMP 10], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- a combination of antibodies that comprises a GDFl 1 antibody does not comprise a BMP9 antibody.
- a combination of antibodies that comprises a GDFl 1 antibody does not comprise an activin A antibody.
- an ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least BMP6. Therefore, in some embodiments, an ActRIIB antagonist antibody, or combination of antibodies, binds to at least BMP6.
- a BMP6 antibody or anti-BMP6 antibody generally refers to an antibody that can bind to BMP6 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting BMP6.
- the extent of binding of a BMP6 antibody to an unrelated, non-BMP6 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to BMP6 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a BMP6 antibody binds to an epitope of BMP6 that is conserved among BMP6 from different species.
- an anti- BMP6 antibody binds to human BMP6.
- a BMP6 antibody may inhibit BMP6 from binding to a type I and/or type II receptor (e.g., ActRIIB, ALK4, ALK5, and/or ALK7) and thus inhibit BMP6-mediated signaling (e.g., Smad signaling).
- a BMP6 antibody may inhibit BMP6 from binding to a co-receptor and thus inhibit BMP6-mediated signaling (e.g., Smad signaling).
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to BMP6 and further binds to, for example, one or more additional ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF8, GDF3, BMP10, and GDF11], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE
- GDF8 GDF3, BMP10 e.g., one or more type I receptor and/or type II receptors
- a multispecific antibody that binds to BMP6 does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- a multispecific antibody that binds to BMP6 does not bind or does not substantially bind to activin A (e.g., binds to activin A with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a BMP6 antibody and one or more additional antibodies that bind to, for example, one or more additional ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF8, GDF11, GDF3, and BMP10], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co- receptors.
- a combination of antibodies that comprises a BMP6 antibody does not comprise a BMP9 antibody.
- a combination of antibodies that comprises a BMP6 antibody does not comprise an activin A antibody.
- an ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least GDF3. Therefore, in some embodiments, an ActRIIB antagonist antibody, or combination of antibodies, binds to at least GDF3.
- a GDF3 antibody or anti-GDF3antibody generally refers to an antibody that can bind to GDF3 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting GDF3.
- the extent of binding of a GDF3 antibody to an unrelated, non-GDF3 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to GDF3 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a GDF3 antibody binds to an epitope of GDF3 that is conserved among GDF3 from different species.
- an anti- GDF3 antibody binds to human GDF3.
- a GDF3 antibody may inhibit GDF3 from binding to a type I and/or type II receptor (e.g., ActRIIB, ALK4, ALK5, and/or ALK7) and thus inhibit GDF3-mediated signaling (e.g., Smad signaling).
- a GDF3 antibody may inhibit GDF3 from binding to a co-receptor and thus inhibit GDF3-mediated signaling (e.g., Smad signaling).
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to GDF3 and further binds to, for example, one or more additional ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF8, BMP6, BMP 10, and GDF11], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE
- GDF8, BMP6, BMP 10 e.g., one or more type I receptor and/or type II receptors
- a multispecific antibody that binds to GDF3 does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- a multispecific antibody that binds to GDF3 does not bind or does not substantially bind to activin A (e.g., binds to activin A with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a GDF3 antibody and one or more additional antibodies that bind to, for example, one or more additional ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF8, GDF11, BMP6, and BMP 10], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co- receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE
- GDF8 GDF11, BMP6, and BMP 10 one or more type I receptor and/or type II receptors (e.g., ActRIIB,
- a combination of antibodies that comprises a GDF3 antibody does not comprise a BMP9 antibody. In some embodiments, a combination of antibodies that comprises a GDF3 antibody does not comprise an activin A antibody.
- an ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least BMP 10. Therefore, in some embodiments, an ActRIIB antagonist antibody, or combination of antibodies, binds to at least BMP 10.
- a BMP 10 antibody (or anti-BMPIO antibody) generally refers to an antibody that can bind to BMP 10 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting BMP 10.
- the extent of binding of a BMP 10 antibody to an unrelated, non-BMP 10 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to BMP10 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a BMP 10 antibody binds to an epitope of BMP 10 that is conserved among BMP 10 from different species.
- an anti-BMPIO antibody binds to human BMP 10.
- a BMP 10 antibody may inhibit BMP 10 from binding to a type I and/or type II receptor (e.g., ActRIIB, ALK4, ALK5, and/or ALK7) and thus inhibit BMPlO-mediated signaling (e.g., Smad signaling).
- a BMP 10 antibody may inhibit BMP 10 from binding to a co-receptor and thus inhibit BMPlO-mediated signaling (e.g., Smad signaling).
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to BMP 10 and further binds to, for example, one or more additional ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF8, GDF11, GDF3, and BMP6], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- GDF8 GDF11, GDF3, and BMP6 one or more type I receptor and/or type II receptors (e.g.,
- a multispecific antibody that binds to BMP 10 does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- a multispecific antibody that binds to BMP 10 does not bind or does not substantially bind to activin A (e.g., binds to activin A with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a BMP 10 antibody and one or more additional antibodies that bind to, for example, one or more additional ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF8, GDF3 BMP6, BMP 10, and GDF11], one or more type I receptor and/or type II receptors (e.g., ActRIIB, ALK4, ALK5, and/or ALK7), and/or one or more co-receptors.
- a combination of antibodies that comprises a BMP 10 antibody does not comprise a BMP9 antibody.
- a combination of antibodies that comprises a BMP 10 antibody does not comprise an activin A antibody.
- an ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least ActRIIB. Therefore, in some embodiments, an ActRIIB antagonist antibody, or combination of antibodies, binds to at least ActRIIB.
- an ActRIIB antibody (anti-ActRIIB antibody) generally refers to an antibody that binds to ActRIIB with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting ActRIIB.
- the extent of binding of an anti-ActRIIB antibody to an unrelated, non-ActRIIB protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to ActRIIB as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-ActRIIB antibody binds to an epitope of ActRIIB that is conserved among ActRIIB from different species.
- an anti-ActRIIB antibody binds to human ActRIIB.
- an anti-ActRIIB antibody may inhibit one or more ActRIIB ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) GDF11, BMP6, GDF3, and BMP 10] from binding to ActRIIB.
- ActRIIB ligands e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) GDF11, BMP6, GDF3, and BMP 10] from binding to ActRIIB.
- an anti-ActRIIB antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to ActRIIB and one or more ActRIIB ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, and BMP10], type I receptor (e.g., ALK4, ALK5, and/or ALK7), co-receptor, and/or an additional type II receptor (e.g., ActRIIA).
- ActRIIB ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, and BMP10]
- type I receptor e.g., ALK4, ALK5, and/or ALK7
- co-receptor e.g., Act
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an anti-ActRIIB antibody and one or more additional antibodies that bind to, for example, one or more ActRIIB ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) BMP6, GDF3, and BMP10], co-receptors, type I receptors (e.g., ALK4, ALK5, and/or ALK7), and/or additional type II receptors (e.g., ActRIIA).
- ActRIIB has sequence similarity to ActRIIA and therefore antibodies that bind to ActRIIB, in some instances, may also bind to and/or inhibit ActRIIA.
- an ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least ALK4. Therefore, in some embodiments, an ActRIIB antagonist antibody, or combination of antibodies, binds to at least ALK4.
- an ALK4 antibody (anti-ALK4 antibody) generally refers to an antibody that binds to ALK4 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting ALK4.
- the extent of binding of an anti-ALK4 antibody to an unrelated, non-ALK4 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to ALK4 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-ALK4 antibody binds to an epitope of ALK4 that is conserved among ALK4 from different species.
- an anti-ALK4 antibody binds to human ALK4.
- an anti- ALK4 antibody may inhibit one or more ActRIIB ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) GDF11, BMP6, GDF3, and BMP10] from binding to ALK4.
- ActRIIB ligands e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) GDF11, BMP6, GDF3, and BMP10] from binding to ALK4.
- an anti-ALK4 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to ALK4 and one or more GDF/BMP ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, and BMP10], type II receptor (e.g., ActRIIB), co-receptor, and/or an additional type I receptor (e.g., ALK5 and/or ALK7).
- GDF/BMP ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, and BMP10]
- type II receptor e.g., ActRIIB
- co-receptor e.g., ALK5 and/or ALK7.
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an anti-ALK4 antibody and one or more additional antibodies that bind to, for example, one or more ActRIIB ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) BMP6, and BMP 10], co-receptors, type II receptors (e.g., ActRIIB), and/or additional type I receptors (e.g., ALK5 and/or ALK7).
- ActRIIB ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) BMP6, and BMP 10]
- co-receptors e.
- an ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least ALK5. Therefore, in some embodiments, an ActRIIB antagonist antibody, or combination of antibodies, binds to at least ALK5.
- an ALK5 antibody (anti-ALK5 antibody) generally refers to an antibody that binds to ALK5 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting ALK5.
- the extent of binding of an anti-ALK5 antibody to an unrelated, non-ALK5 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to ALK5 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-ALK5 antibody binds to an epitope of ALK5 that is conserved among ALK5 from different species.
- an anti-ALK5 antibody binds to human ALK5.
- an anti- ALK5 antibody may inhibit one or more ActRIIB ligands [e.g., GDF8, activin (e.g., activin
- an anti-ALK5 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to ALK5 and one or more ActRIIB ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin
- type II receptor e.g., ActRIIB
- co-receptor e.g., ALK4 and/or ALK7
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an anti-ALK5 antibody and one or more additional antibodies that bind to, for example, one or more ActRIIB ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) BMP6, and BMP 10], co-receptors, type II receptors (e.g., ActRIIB), and/or additional type I receptors (e.g., ALK4 and/or ALK7).
- ActRIIB ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) BMP6, and BMP 10]
- co-receptors e.
- an ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least ALK7. Therefore, in some embodiments, an ActRIIB antagonist antibody, or combination of antibodies, binds to at least ALK7.
- an ALK7 antibody (anti-ALK7 antibody) generally refers to an antibody that binds to ALK7 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting ALK7.
- the extent of binding of an anti-ALK7 antibody to an unrelated, non-ALK7 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to ALK7 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-ALK7 antibody binds to an epitope of ALK7 that is conserved among ALK7 from different species.
- an anti-ALK7 antibody binds to human ALK7.
- an anti- ALK7 antibody may inhibit one or more ActRIIB ligands [e.g., GDF8, activin (e.g., activin
- an anti-ALK7 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to ALK7 and one or more ActRIIB ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin
- type II receptor e.g., ActRIIB
- co-receptor e.g., ALK4 and/or ALK5
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an anti-ALK7 antibody and one or more additional antibodies that bind to, for example, one or more ActRIIB ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) BMP6, and BMP 10], co-receptors, type II receptors (e.g., ActRIIB), and/or additional type I receptors (e.g., ALK4 and/or ALK5).
- ActRIIB ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) BMP6, and BMP 10]
- co-receptors e.
- antibody is used herein in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
- An antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
- antibody fragments include, but are not limited to, Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies; linear antibodies; single-chain antibody molecules (e.g., scFv); and multispecific antibodies formed from antibody fragments [see, e.g., Hudson et al. (2003) Nat. Med. 9: 129-134; Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer- Verlag, New York), pp. 269-315 (1994); WO 93/16185; and U.S. Pat. Nos. 5,571,894;
- Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific [see, e.g., EP 404,097; WO 1993/01161; Hudson et al.
- Single-domain antibodies are antibody fragments comprising all or a portion of the heavy-chain variable domain or all or a portion of the light-chain variable domain of an antibody.
- a single-domain antibody is a human single- domain antibody [see, e.g., U.S. Pat. No. 6,248,516].
- Antibodies disclosed herein may be polyclonal antibodies or monoclonal antibodies.
- the antibodies of the present disclosure comprise a label attached thereto and able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme, or enzyme co-factor).
- the antibodies of the present disclosure are isolated antibodies.
- the antibodies of the present disclosure are recombinant antibodies.
- the antibodies herein may be of any class.
- the class of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
- IgA immunoglobulin
- IgD immunoglobulin
- IgE immunoglobulin
- IgG immunoglobulin
- IgM immunoglobulins
- an antibody for use in the methods disclosed herein specifically binds to its target antigen, preferably with high binding affinity.
- Affinity may be expressed as a K D value and reflects the intrinsic binding affinity (e.g., with minimized avidity effects).
- binding affinity is measured in vitro, whether in a cell-free or cell -associated setting. Any of a number of assays known in the art, including those disclosed herein, can be used to obtain binding affinity measurements including, for example, Biacore, radiolabeled antigen-binding assay (RIA), and ELISA.
- antibodies of the present disclosure bind to their target antigens (e.g.
- K D is measured by RIA performed with the Fab version of an antibody of interest and its target antigen as described by the following assay.
- Solution binding affinity of Fabs for the antigen is measured by equilibrating Fab with a minimal concentration of radiolabeled antigen (e.g., 125 I-labeled) in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate [see, e.g., Chen et al. (1999) J. Mol. Biol. 293 :865-881].
- multi-well plates e.g., MICROTITER ® from Thermo Scientific
- a capturing anti-Fab antibody e.g., from Cappel Labs
- bovine serum albumin preferably at room temperature (approximately 23°C).
- radiolabeled antigen are mixed with serial dilutions of a Fab of interest [e.g., consistent with assessment of the anti-VEGF antibody, Fab-12, in Presta et al, (1997) Cancer Res. 57:4593-4599].
- the Fab of interest is then incubated, preferably overnight but the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation, preferably at room temperature for about one hour. The solution is then removed and the plate is washed times several times, preferably with polysorbate 20 and PBS mixture. When the plates have dried, scintillant (e.g., MICROSCINT from Packard) is added, and the plates are counted on a gamma counter (e.g., TOPCOUNT ® from Packard).
- a gamma counter e.g., TOPCOUNT ® from Packard
- K D is measured using surface plasmon resonance assays using, for example a BIACORE ® 2000 or a B I AC ORE ® 3000 (BIAcore, Inc., Piscataway, N.J.) with immobilized antigen CM5 chips at about 10 response units (RU).
- CM5 carboxymethylated dextran biosensor chips
- EDC N-ethyl-N'-(3-dimethylaminopropyl)-carbodiimide hydrochloride
- NHS N- hydroxysuccinimide
- an antigen can be diluted with 10 mM sodium acetate, pH 4.8, to 5 ⁇ g/ml (about 0.2 ⁇ ) before injection at a flow rate of 5 ⁇ /minute to achieve approximately 10 response units (RU) of coupled protein.
- 1 M ethanolamine is injected to block unreacted groups.
- two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% polysorbate 20 (TWEEN-20 ® ) surfactant (PBST) at a flow rate of approximately 25 ⁇ /min.
- association rates (k on ) and dissociation rates (k 0 ff) are calculated using, for example, a simple one-to-one Langmuir binding model (BIACORE ® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams.
- the equilibrium dissociation constant (K D ) is calculated as the ratio k 0 ff / k on [see, e.g., Chen et al, (1999) J. Mol. Biol. 293 :865-881].
- Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g., E. coli or phage), as described herein.
- recombinant host cells e.g., E. coli or phage
- the nucleic acid and amino acid sequences of human ALK4, ALK5, ALK7, ActRIIB, activin (activin A, activin B, activin C, and activin E), GDFl 1, GDF8, BMP10, GDF3, and BMP6, are known in the art.
- numerous methods for generating antibodies are well known in the art, some of which are described herein. Therefore antibody antagonists for use in accordance with this disclosure may be routinely made by the skilled person in the art based on the knowledge in the art and teachings provided herein.
- an antibody provided herein is a chimeric antibody.
- a chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species. Certain chimeric antibodies are described, for example, in U.S. Pat. No. 4,816,567; and Morrison et al, (1984) Proc. Natl. Acad. Sci. USA, 81 :6851-6855.
- a chimeric antibody comprises a non-human variable region ⁇ e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non- human primate, such as a monkey) and a human constant region.
- a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody.
- chimeric antibodies include antigen- binding fragments thereof.
- a chimeric antibody provided herein is a humanized antibody.
- a humanized antibody refers to a chimeric antibody comprising amino acid residues from non-human hypervariable regions (HVRs) and amino acid residues from human framework regions (FRs).
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
- a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
- a "humanized form" of an antibody refers to an antibody that has undergone humanization.
- Humanized antibodies and methods of making them are reviewed, for example, in Almagro and Fransson (2008) Front. Biosci. 13 : 1619-1633 and are further described, for example, in Riechmann et al, (1988) Nature
- Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best-fit” method [see, e.g., Sims et al. (1993) J. Immunol. 151 :2296 ]; framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions [see, e.g., Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89:4285; and Presta et al.
- an antibody provided herein is a human antibody.
- Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel (2008) Curr. Opin. Pharmacol. 5: 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459.
- human antibodies may be prepared by administering an immunogen ⁇ e.g., a GDF11 polypeptide, an activin B polypeptide, an ActRIIA polypeptide, or an ActRIIB polypeptide) to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge.
- Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic animals, the endogenous immunoglobulin loci have generally been inactivated.
- endogenous immunoglobulin loci have generally been inactivated.
- Human variable regions from intact antibodies generated by such animals may be further modified, for example, by combining with a different human constant region.
- Human antibodies provided herein can also be made by hybridoma-based methods.
- Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described [see, e.g., Kozbor J. Immunol., (1984) 133 : 3001; Brodeur et al. (1987) Monoclonal Antibody Production Techniques and Applications, pp. 51- 63, Marcel Dekker, Inc., New York; and Boerner et al. (1991) J. Immunol., 147: 86].
- Human antibodies generated via human B-cell hybridoma technology are also described in Li et al, (2006) Proc. Natl. Acad. Sci.
- Human antibodies provided herein may also be generated by isolating Fv clone variable-domain sequences selected from human-derived phage display libraries. Such variable-domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are known in the art and described herein.
- antibodies of the present disclosure may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities.
- a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, for example, in Hoogenboom et al. (2001) in Methods in Molecular Biology 178: 1- 37, O'Brien et al., ed., Human Press, Totowa, N.J. and further described, for example, in the McCafferty et al. (1991) Nature 348:552-554; Clackson et al, (1991) Nature 352: 624-628; Marks et al. (1992) J. Mol. Biol.
- repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al. (1994) Ann. Rev. Immunol., 12: 433-455.
- Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
- Libraries from immunized sources provide high-affinity antibodies to the immunogen (e.g., ALK4, ALK5, ALK7, ActRIIB, activin, GDF11, GDF8, GDF3, BMP 10, or BMP6) without the requirement of constructing hybridomas.
- naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al. (1993) EMBO J, 12: 725-734.
- naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter (1992) J. Mol. Biol., 227: 381-388.
- Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and U.S. Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598,
- an antibody provided herein is a multispecific antibody, for example, a bispecific antibody.
- Multispecific antibodies typically monoclonal antibodies
- that have binding specificities for at least two different epitopes e.g., two, three, four, five, or six or more
- one or more e.g., two, three, four, five, six or more
- Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy-chain/light-chain pairs having different specificities [see, e.g., Milstein and Cuello (1983) Nature 305: 537; International patent publication no. WO 93/08829; and Traunecker et al. (1991) EMBO J. 10: 3655, and U.S. Pat. No. 5,731,168 ("knob-in-hole” engineering)].
- Multispecific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (see, e.g., WO 2009/089004A1); cross-linking two or more antibodies or fragments [see, e.g., U.S. Pat. No. 4,676,980; and Brennan et al. (1985) Science, 229: 81]; using leucine zippers to produce bispecific antibodies [see, e.g., Kostelny et al. (1992) J. Immunol., 148(5): 1547-1553]; using "diabody” technology for making bispecific antibody fragments [see, e.g., Hollinger et al. (1993) Proc. Natl.
- Multispecific antibodies can be prepared as full-length antibodies or antibody fragments.
- an antibody disclosed herein is a monoclonal antibody.
- Monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
- polyclonal antibody preparations which typically include different antibodies directed against different epitopes
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single epitope on an antigen.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present methods may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
- anti-protein/anti-peptide antisera or monoclonal antibodies can be made by standard protocols [see, e.g., Antibodies: A Laboratory Manual ed. by Harlow and Lane (1988) Cold Spring Harbor Press: 1988].
- a mammal such as a mouse, hamster, or rabbit, can be immunized with an immunogenic form of the activin polypeptide, an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein.
- Techniques for conferring immunogenicity on a protein or peptide include conjugation to carriers or other techniques well known in the art.
- An immunogenic portion of an activin polypeptide can be administered in the presence of adjuvant. The progress of immunization can be monitored by detection of antibody titers in plasma or serum. Standard ELISA or other immunoassays can be used with the immunogen as antigen to assess the levels of antibody production and/or level of binding affinity.
- antibody-producing cells can be harvested from an immunized animal and fused by standard somatic cell fusion procedures with immortalizing cells such as myeloma cells to yield hybridoma cells.
- immortalizing cells such as myeloma cells.
- Hybridoma cells can be screened for human monoclonal antibodies.
- one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein thereby generating an Fc region variant.
- the Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g., a substitution, deletion, and/or addition) at one or more amino acid positions.
- the present disclosure contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody in vivo is important yet certain effector functions [e.g., complement-dependent cytotoxicity (CDC) and antibody-dependent cellular cytotoxicity (ADCC)] are unnecessary or deleterious.
- CDC complement-dependent cytotoxicity
- ADCC antibody-dependent cellular cytotoxicity
- In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
- Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
- NK cells express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII.
- FcR expression on hematopoietic cells is summarized in, for example, Ravetch and Kinet (1991) Annu. Rev. Immunol. 9:457-492.
- Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest are described in U.S. Pat. No. 5,500,362; Hellstrom, I. et al. (1986) Proc. Natl. Acad. Sci. USA 83 :7059-7063];
- non-radioactive assays methods may be employed (e.g., ACTITM, non-radioactive cytotoxicity assay for flow cytometry; CellTechnology, Inc. Mountain View, Calif ; and CytoTox 96 ® non-radioactive cytotoxicity assay, Promega, Madison, Wis.).
- PBMC peripheral blood mononuclear cells
- NK natural killer cells
- ADCC activity of the molecule of interest may be assessed in vivo, for example, in an animal model such as that disclosed in Clynes et al. (1998) Proc. Natl. Acad. Sci. USA 95:652-656.
- Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity [see, e.g., Clq and C3c binding ELISA in WO 2006/029879 and WO 2005/100402].
- a CDC assay may be performed [see, e.g, Gazzano-Santoro et al. (1996) J. Immunol. Methods 202: 163; Cragg, M. S. et al. (2003) Blood 101 : 1045-1052; and Cragg, M. S, and M. J. Glennie (2004) Blood 103 :2738-2743].
- FcRn binding and in vivo clearance/half-life determinations can also be performed using methods known in the art [see, e.g., Petkova, S. B. et al. (2006) Intl. Immunol. 18(12): 1759-1769].
- Antibodies of the present disclosure with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056).
- Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
- cysteine engineered antibodies e.g., "thioMAbs”
- one or more residues of an antibody are substituted with cysteine residues.
- the substituted residues occur at accessible sites of the antibody.
- reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
- any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region.
- Cysteine engineered antibodies may be generated as described, for example, in U.S. Pat. No. 7,521,541.
- the techniques used to screen antibodies in order to identify a desirable antibody may influence the properties of the antibody obtained. For example, if an antibody is to be used for binding an antigen in solution, it may be desirable to test solution binding. A variety of different techniques are available for testing interactions between antibodies and antigens to identify particularly desirable antibodies.
- Such techniques include ELIS As, surface plasmon resonance binding assays ⁇ e.g., the Biacore binding assay, Biacore AB, Uppsala, Sweden), sandwich assays ⁇ e.g., the paramagnetic bead system of IGEN
- amino acid sequence variants of the antibodies and/or the binding polypeptides provided herein are contemplated.
- Amino acid sequence variants of an antibody and/or binding polypeptides may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody and/or binding polypeptide, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody and/or binding polypeptide. Any
- deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., target- binding (e.g., and activin such as activin E and/or activin C binding).
- target- binding e.g., and activin such as activin E and/or activin C binding.
- Alterations may be made in HVRs, for example, to improve antibody affinity.
- Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process [see, e.g., Chowdhury (2008) Methods Mol. Biol. 207: 179-196 (2008)], and/or SDRs (a-CDRs), with the resulting variant VH or VL being tested for binding affinity.
- Affinity maturation by constructing and reselecting from secondary libraries has been described in the art [see, e.g., Hoogenboom et al, in Methods in Molecular Biology 178: 1-37, O'Brien et al., ed., Human Press, Totowa, N.J., (2001).
- affinity maturation diversity is introduced into the variable genes chosen for maturation by any of a variety of methods ⁇ e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis).
- a secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity.
- HVR-directed approaches in which several HVR residues ⁇ e.g., 4-6 residues at a time) are randomized.
- HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling.
- CDR-H3 and CDR-L3 in particular are often targeted.
- substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind to the antigen.
- conservative alterations ⁇ e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs.
- Such alterations may be outside of HVR "hotspots" or SDRs.
- each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
- a useful method for identification of residues or regions of the antibody and/or the binding polypeptide that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells (1989) Science, 244: 1081-1085.
- a residue or group of target residues ⁇ e.g., charged residues such as Arg, Asp, His, Lys, and Glu
- a neutral or negatively charged amino acid e.g., alanine or polyalanine
- a crystal structure of an antigen-antibody complex is determined to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include an antibody with an N-terminal methionyl residue.
- Other insertional variants of the antibody molecule include the fusion of the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
- an antibody and/or binding polypeptide provided herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
- the moieties suitable for derivatization of the antibody and/or binding polypeptide include but are not limited to water soluble polymers.
- water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-l,3-dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof.
- PEG polyethylene glycol
- Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- the number of polymers attached to the antibody and/or binding polypeptide may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody and/or binding
- an ActRIIB antagonist to be used in accordance with the methods and uses described herein is a small molecule (ActRIIB antagonists small molecule), or combination of small molecule antagonists.
- An ActRIIB antagonist small molecule, or combination of small molecule antagonists may inhibit, for example, one or more ActRIIB ligands (e.g., activin, GDF11, GDF8, GDF3, BMP6, and/or BMP10), a type I receptor (e.g., ALK4, ALK5, and/or ALK7), a type II receptor (e.g., ActRIIB), and/or a co-receptor.
- ActRIIB ligands e.g., activin, GDF11, GDF8, GDF3, BMP6, and/or BMP10
- a type I receptor e.g., ALK4, ALK5, and/or ALK7
- a type II receptor e.g., ActRIIB
- co-receptor e.g
- an ActRIIB antagonist small molecule inhibits signaling mediated by one or more ActRIIB ligands, for example, as determined in a cell -based assay such as those described herein.
- ActRIIB antagonist small molecule may be used, alone or in combination with one or more supportive therapies or active agents, to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis particularly treating, preventing or reducing the progression rate and/or severity of one or more myelofibrosis-associated complications (e.g., splenomegaly, extramedullary hematopoiesis, anemia and fibrosis and/or treat a patient treated with a Janus kinase inhibitor.
- myelofibrosis-associated complications e.g., splenomegaly, extramedullary hematopoiesis, anemia and fibrosis and/or treat a patient treated with a Janus kinase inhibitor.
- an ActRIIB antagonist small molecule inhibits at least GDF11, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), GDF3, BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- GDF3, BMP6, BMP10 e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- GDF3 e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin
- an ActRIIB antagonist small molecule inhibits at least GDF8, optionally further inhibiting one or more of GDF11, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), GDF3, BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- GDF3, BMP6, BMP10 e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- GDF3 e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/
- an ActRIIB antagonist small molecule, or combination of small molecule antagonists inhibits at least activin (activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), optionally further inhibiting one or more of GDF8, GDF11, GDF3, BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist small molecule, or combination of small molecule antagonists inhibits at least activin B, optionally further inhibiting one or more of GDF8, GDF11, GDF3, BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist small molecule inhibits at least BMP6, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), GDF3, GDF11, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- GDF3 GDF11
- BMP10 e.g., ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist small molecule inhibits at least GDF3, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP 15, BMP6, GDF11, BMP 10, ActRIIB, ALK4, ALK5, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- an ActRIIB antagonist small molecule inhibits at least BMP 10, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP 15, BMP6, GDF11, GDF3, ActRIIB, ALK4, ALK5, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- BMP 15, BMP6, GDF11, GDF3, ActRIIB, ALK4, ALK5, and ALK7 e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- an ActRIIB antagonist small molecule inhibits at least ActRIIB, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP 15, BMP6, GDF11, GDF3, BMP10, ALK4, ALK5, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- BMP 15, BMP6, GDF11, GDF3, BMP10, ALK4, ALK5, and ALK7 e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- an ActRIIB antagonist small molecule inhibits at least ALK4, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP 15, BMP6, GDF11, GDF3, ActRIIB, BMP10, ALK5, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- an ActRIIB antagonist small molecule inhibits at least ALK5, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP15, BMP6, GDF11, GDF3, ActRIIB, ALK4, BMP10, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- BMP15 e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- BMP15 e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and
- an ActRIIB antagonist small molecule, or combination of small molecule antagonists inhibits at least ALK7, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP15, BMP6, GDF11, GDF3, ActRIIB, ALK4, ALK5, and BMP 10.
- an ActRIIB antagonist small molecule, or combination of small molecule antagonists, as disclosed herein does not inhibit or does not substantially inhibit BMP9.
- an ActRIIB antagonist small molecule, or combination of small molecule antagonists, as disclosed herein does not inhibit or does not substantially inhibit activin A.
- ActRIIB antagonist small molecules can be direct or indirect inhibitors.
- an indirect small molecule antagonist, or combination of small molecule antagonists may inhibit the expression (e.g., transcription, translation, cellular secretion, or combinations thereof) of at least one or more ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin B, activin BC, activin AE, or activin BE), GDF11, BMP10, BMP9, BMP6, BMP5, GDF3, and/or GDF8], type I receptor (e.g., ALK4, ALK5, and/or ALK7), type II receptors (e.g., ActRIIB), co-receptor, and/or one or more downstream ActRIIB signaling components (
- a direct small molecule antagonist, or combination of small molecule antagonists may directly bind to and inhibit, for example, one or more one or more ActRIIB ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin B, activin BC, activin AE, or activin BE), GDF11, BMP10, BMP9, BMP6, BMP 5, GDF3, and/or GDF8], type I receptor (e.g., ALK4, ALK5 and/or ALK7), type II receptors (e.g., ActRIIB), co-receptor, and/or one or more downstream ActRIIB signaling components (e.g., Smads).
- ActRIIB ligands e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin B, activin BC, activin AE
- Binding small-molecule antagonists of the present disclosure may be identified and chemically synthesized using known methodology (see, e.g., PCT Publication Nos. WO 00/00823 and WO 00/39585).
- small molecule antagonists of the disclosure are usually less than about 2000 daltons in size, alternatively less than about 1500, 750, 500, 250 or 200 daltons in size, wherein such organic small molecules that are capable of binding, preferably specifically, to a polypeptide as described herein. These small molecule antagonists may be identified without undue experimentation using well-known techniques.
- Binding organic small molecules of the present disclosure may be, for example, aldehydes, ketones, oximes, hydrazones, semicarbazones, carbazides, primary amines, secondary amines, tertiary amines, N-substituted hydrazines, hydrazides, alcohols, ethers, thiols, thioethers, disulfides, carboxylic acids, esters, amides, ureas, carbamates, carbonates, ketals, thioketals, acetals, thioacetals, aryl halides, aryl sulfonates, alkyl halides, alkyl sulfonates, aromatic compounds, heterocyclic compounds, anilines, alkenes, alkynes, diols, amino alcohols, oxazolidines, oxazolines, thiazolidines, thiazolines, enamines, sulfonamide
- an ActRIIB antagonist to be used in accordance with the methods and uses disclosed herein is a polynucleotide (ActRIIB antagonist polynucleotide), or combination of polynucleotides.
- An ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists may inhibit, for example, one or more ActRIIB ligands (e.g., activin, GDF11, GDF8, GDF3, BMP6, and/or BMP10,), type I receptors (e.g., ALK4, ALK5, and/or ALK7), type II receptors (e.g., ActRIIB), co-receptor, and/or downstream signaling component (e.g., Smads).
- ActRIIB ligands e.g., activin, GDF11, GDF8, GDF3, BMP6, and/or BMP10
- type I receptors e.g., ALK4, ALK5, and/or ALK7
- type II receptors e.g., ActRIIB
- co-receptor e.g., Smads
- an ActRIIB antagonist polynucleotide or combination of polynucleotide antagonists, inhibits signaling mediated by one or more ActRIIB ligands, for example, as determined in a cell-based assay such as those described herein.
- ActRIIB antagonist polynucleotides may be used, alone or in combination with one or more supportive therapies or active agents, to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis, particularly treating, preventing or reducing the progression rate and/or severity of one or more myelofibrosis-associated complications (e.g., splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis) and/or treat a patient treated with a Janus kinase inhibitor.
- myelofibrosis-associated complications e.g., splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis
- an ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists inhibits at least GDF11, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), GDF3, BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- GDF3, BMP6, BMP10 e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- an ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists inhibits at least GDF8, optionally further inhibiting one or more of GDF11, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), GDF3, BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- GDF3 BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist polynucleotide inhibits at least activin (activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), optionally further inhibiting one or more of GDF8, GDF11, GDF3, BMP6, BMP10, ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists inhibits at least activin B, optionally further inhibiting one or more of GDF8, GDF11, GDF3, BMP6, BMPIO, ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists inhibits at least BMP6, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), GDF3, GDFl 1, BMPIO, ActRIIB, ALK4, ALK5, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- polynucleotide antagonists inhibits at least GDF3, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP6, GDF 11 , BMP 10, ActRIIB, ALK4, ALK5, and ALK7.
- GDF8 activin
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- BMP6, GDF 11 e.g., BMP 10, ActRIIB, ALK4, ALK5, and ALK7.
- an ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists inhibits at least BMPIO, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP6, GDFl 1, GDF3, ActRIIB, ALK4, ALK5, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- an ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists inhibits at least ActRIIB, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP6, GDFl 1, GDF3, BMPIO, ALK4, ALK5, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- a GDF/BMP polynucleotide antagonist an ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists inhibits at least ALK4, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP6, GDFl 1, GDF 3, ActRIIB, BMPIO, ALK5, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- BMP6, GDFl 1, GDF 3, ActRIIB, BMPIO, ALK5, and ALK7 e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE
- an ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists inhibits at least ALK5, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP6, GDFl 1, GDF 3, ActRIIB, ALK4, BMPIO, and ALK7.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE
- BMP6 GDFl 1, GDF 3, ActRIIB, ALK4, BMPIO, and ALK7.
- an ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists inhibits at least ALK7, optionally further inhibiting one or more of GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE), BMP6, GDFl 1, GDF 3, ActRIIB, ALK4, ALK5, and BMP10.
- an ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists, as disclosed herein does not inhibit or does not substantially inhibit BMP9.
- an ActRIIB antagonist polynucleotide, or combination of polynucleotide antagonists, as disclosed herein does not inhibit or does not substantially inhibit activin A.
- the polynucleotide antagonists of the disclosure may be an antisense nucleic acid, an RNAi molecule [e.g., small interfering RNA (siRNA), small- hairpin RNA (shRNA), microRNA (miRNA)], an aptamer and/or a ribozyme.
- RNAi molecule e.g., small interfering RNA (siRNA), small- hairpin RNA (shRNA), microRNA (miRNA)
- the nucleic acid and amino acid sequences of human GDF11, GDF8, activin (activin A, activin B, activin C, and activin E), BMP6, GDF3, ActRIIB, ALK4, ALK5, ALK7, and BMP10 are known in the art.
- many different methods of generating polynucleotide antagonists are well known in the art. Therefore polynucleotide antagonists for use in accordance with this disclosure may be routinely made by the skilled person in the art based on the
- Antisense technology can be used to control gene expression through antisense DNA or RNA, or through triple-helix formation.
- Antisense techniques are discussed, for example, in Okano (1991) J. Neurochem. 56:560; Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression, CRC Press, Boca Raton, Fla. (1988). Triple-helix formation is discussed in, for instance, Cooney et al. (1988) Science 241 :456; and Dervan et al., (1991) Science 251 : 1300.
- the methods are based on binding of a polynucleotide to a complementary DNA or RNA.
- the antisense nucleic acids comprise a single-stranded RNA or DNA sequence that is complementary to at least a portion of an RNA transcript of a gene disclosed herein. However, absolute complementarity, although preferred, is not required.
- a sequence "complementary to at least a portion of an RNA,” referred to herein, means a sequence having sufficient complementarity to be able to hybridize with the RNA, forming a stable duplex; in the case of double-stranded antisense nucleic acids of a gene disclosed herein, a single strand of the duplex DNA may thus be tested, or triplex formation may be assayed.
- the ability to hybridize will depend on both the degree of complementarity and the length of the antisense nucleic acid. Generally, the larger the hybridizing nucleic acid, the more base mismatches with an RNA it may contain and still form a stable duplex (or triplex as the case may be).
- One skilled in the art can ascertain a tolerable degree of mismatch by use of standard procedures to determine the melting point of the hybridized complex. Polynucleotides that are complementary to the 5' end of the message, for example, the
- 5'-untranslated sequence up to and including the AUG initiation codon should work most efficiently at inhibiting translation.
- sequences complementary to the 3'- untranslated sequences of mRNAs have been shown to be effective at inhibiting translation of mRNAs as well [see, e.g., Wagner, R., (1994) Nature 372:333-335].
- oligonucleotides complementary to either the 5'- or 3 '-non-translated, non-coding regions of a gene of the disclosure could be used in an antisense approach to inhibit translation of an endogenous mRNA.
- Polynucleotides complementary to the 5'-untranslated region of the mRNA should include the complement of the AUG start codon.
- Antisense polynucleotides complementary to mRNA coding regions are less efficient inhibitors of translation but could be used in accordance with the methods of the present disclosure. Whether designed to hybridize to the 5'-, 3'- or coding region of an mRNA of the disclosure, antisense nucleic acids should be at least six nucleotides in length, and are preferably oligonucleotides ranging from 6 to about 50 nucleotides in length. In specific aspects the oligonucleotide is at least 10 nucleotides, at least 17 nucleotides, at least 25 nucleotides or at least 50 nucleotides.
- the antisense nucleic acid of the present disclosure is produced intracellularly by transcription from an exogenous sequence.
- a vector or a portion thereof is transcribed, producing an antisense nucleic acid (RNA) of a gene of the disclosure.
- RNA antisense nucleic acid
- Such a vector would contain a sequence encoding the desired antisense nucleic acid.
- Such a vector can remain episomal or become chromosomally integrated, as long as it can be transcribed to produce the desired antisense RNA.
- Such vectors can be constructed by recombinant DNA technology methods standard in the art. Vectors can be plasmid, viral, or others known in the art, used for replication and expression in vertebrate cells.
- Expression of the sequence encoding desired genes of the instant disclosure, or fragments thereof, can be by any promoter known in the art to act in vertebrate, preferably human cells.
- Such promoters can be inducible or constitutive.
- Such promoters include, but are not limited to, the SV40 early promoter region [see , e.g., Benoist and Chambon (1981) Nature 290:304-310], the promoter contained in the 3' long-terminal repeat of Rous sarcoma virus [see, e.g., Yamamoto et al. (1980) Cell 22:787-797], the herpes thymidine promoter [see, e.g., Wagner et al. (1981) Proc. Natl. Acad. Sci. U.S.A. 78: 1441-1445], and the regulatory sequences of the SV40 early promoter region [see , e.g., Benoist and Chambon (1981) Nature 290:304-310], the promoter contained
- the polynucleotide antagonists are interfering RNA (RNAi) molecules that target the expression of one or more of: GDF11, GDF8, activin (activin A, activin B, activin C, and activin E), BMP6, ActRIIB, GDF3, ALK4, ALK5, ALK7, and
- RNAi refers to the expression of an RNA which interferes with the expression of the targeted mRNA. Specifically, RNAi silences a targeted gene via interacting with the specific mRNA through a siRNA (small interfering RNA). The ds RNA complex is then targeted for degradation by the cell.
- An siRNA molecule is a double-stranded RNA duplex of 10 to 50 nucleotides in length, which interferes with the expression of a target gene which is sufficiently complementary (e.g. at least 80% identity to the gene). In some embodiments, the siRNA molecule comprises a nucleotide sequence that is at least 85, 90, 95, 96, 97, 98, 99, or 100% identical to the nucleotide sequence of the target gene.
- RNAi molecules include short-hairpin RNA (shRNA); also short- interfering hairpin and microRNA (miRNA).
- shRNA short-hairpin RNA
- miRNA microRNA
- the shRNA molecule contains sense and antisense sequences from a target gene connected by a loop. The shRNA is transported from the nucleus into the cytoplasm, and it is degraded along with the mRNA.
- Pol III or U6 promoters can be used to express RNAs for RNAi.
- Paddison et al [Genes & Dev. (2002) 16:948-958, 2002] have used small RNA molecules folded into hairpins as a means to affect RNAi. Accordingly, such short-hairpin RNA (shRNA) molecules are also advantageously used in the methods described herein.
- stem lengths can range anywhere from about 25 to about 30 nt, and loop size can range between 4 to about 25 nt without affecting silencing activity. While not wishing to be bound by any particular theory, it is believed that these shRNAs resemble the double- stranded RNA (dsRNA) products of the DICER RNase and, in any event, have the same capacity for inhibiting expression of a specific gene.
- the shRNA can be expressed from a lentiviral vector.
- An miRNA is a single-stranded RNA of about 10 to 70 nucleotides in length that are initially transcribed as pre-miRNA characterized by a "stem-loop" structure, which are subsequently processed into mature miRNA after further processing through the RISC.
- RNAi molecules that mediate RNAi, including without limitation siRNA
- chemical synthesis Hohjoh, FEBS Lett 521 : 195-199, 2002
- hydrolysis of dsRNA Yang et al, Proc Natl Acad Sci USA 99:9942-9947, 2002
- T7 RNA polymerase Trigger RNA polymerase
- hydrolysis of double-stranded RNA using a nuclease such as E. coli RNase III
- the disclosure provides polynucleotide antagonists including but not limited to, a decoy DNA, a double- stranded DNA, a single-stranded DNA, a complexed DNA, an encapsulated DNA, a viral DNA, a plasmid DNA, a naked RNA, an encapsulated RNA, a viral RNA, a double-stranded RNA, a molecule capable of generating RNA interference, or combinations thereof.
- the polynucleotide antagonists of the disclosure are aptamers.
- Aptamers are nucleic acid molecules, including double-stranded DNA and single-stranded RNA molecules, which bind to and form tertiary structures that specifically bind to a target molecule.
- the generation and therapeutic use of aptamers are well established in the art (see, e.g., U.S. Pat. No. 5,475,096). Additional information on aptamers can be found in U.S. Patent Application Publication No. 20060148748.
- Nucleic acid aptamers are selected using methods known in the art, for example via the Systematic Evolution of Ligands by
- SELEX Exponential Enrichment
- Another screening method to identify aptamers is described in U.S. Pat. No. 5,270,163.
- the SELEX process is based on the capacity of nucleic acids for forming a variety of two- and three-dimensional structures, as well as the chemical versatility available within the nucleotide monomers to act as ligands (form specific binding pairs) with virtually any chemical compound, whether monomelic or polymeric, including other nucleic acid molecules and polypeptides. Molecules of any size or composition can serve as targets.
- the SELEX method involves selection from a mixture of candidate oligonucleotides and stepwise iterations of binding, partitioning and amplification, using the same general selection scheme, to achieve desired binding affinity and selectivity.
- the SELEX method includes steps of contacting the mixture with the target under conditions favorable for binding; partitioning unbound nucleic acids from those nucleic acids which have bound specifically to target molecules; dissociating the nucleic acid-target complexes; amplifying the nucleic acids dissociated from the nucleic acid-target complexes to yield a ligand enriched mixture of nucleic acids.
- the steps of binding, partitioning, dissociating and amplifying are repeated through as many cycles as desired to yield nucleic acid ligands which bind with high affinity and specificity to the target molecule.
- binding molecules are separately administered to the animal [see, e.g., O'Connor (1991) J. Neurochem. 56:560], but such binding molecules can also be expressed in vivo from polynucleotides taken up by a host cell and expressed in vivo [see, e.g.,
- an ActRIIB antagonist is a follistatin or FLRG polypeptide.
- follistatin and/or FLRG polypeptides may be used, alone or in combination with one or more supportive therapies or active agents, to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis, particularly treating, preventing or reducing the progression rate and/or severity of one or more myelofibrosis-associated complications (e.g., splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis) and/or treat a patient treated with a Janus kinase inhibitor.
- myelofibrosis-associated complications e.g., splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis
- follistatin polypeptide includes polypeptides comprising any naturally occurring polypeptide of follistatin as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, and further includes any functional monomer or multimer of follistatin.
- follistatin polypeptide includes polypeptides comprising any naturally occurring polypeptide of follistatin as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, and further includes any functional monomer or multimer of follistatin.
- follistatin polypeptides of the disclosure bind to and/or inhibit activin activity, particularly activin A.
- Variants of follistatin polypeptides that retain activin binding properties can be identified based on previous studies involving follistatin and activin interactions.
- WO2008/030367 discloses specific follistatin domains ("FSDs") that are shown to be important for activin binding.
- FSDs follistatin N-terminal domain
- FSD2 SEQ ID NO: 67
- FSD1 SEQ ID NO: 66
- Follistatin polypeptides include polypeptides derived from the sequence of any known follistatin having a sequence at least about 80% identical to the sequence of a follistatin polypeptide, and optionally at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or greater identity.
- follistatin polypeptides include the mature follistatin polypeptide or shorter isoforms or other variants of the human follistatin precursor polypeptide (SEQ ID NO: 63) as described, for example, in
- the human follistatin precursor polypeptide isoform FST344 is as follows:
- the human follistatin precursor polypeptide isoform FST317 is as follows:
- the FSD1 and FSD2 sequences are as follows:
- ETCENVDCGPGKKCRMNKKNKPRCV (SEQ ID NO: 66; FSD1)
- KTCRDVFCPGSSTCVVDQTNNAYCVT (SEQ ID NO: 67; FSD2)
- an agent for use in accordance with the methods disclosed herein is a folli statin-like related gene (FLRG), also known as follistatin-related protein 3 (FSTL3).
- FLRG polypeptide includes polypeptides comprising any naturally occurring polypeptide of FLRG as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity.
- FLRG polypeptides of the disclosure bind to and/or inhibit activin activity, particularly activin A. Variants of FLRG polypeptides that retain activin binding properties can be identified using routine methods to assay FLRG and activin interactions (see, e.g., US
- FLRG polypeptides include polypeptides derived from the sequence of any known FLRG having a sequence at least about 80% identical to the sequence of an FLRG polypeptide, and optionally at least 85%, 90%, 95%, 97%, 99% or greater identity.
- the human FLRG precursor (follistatin-related protein 3 precursor) polypeptide is as follows:
- the signal peptide is underlined.
- follistatin polypeptides and FLRG polypeptides include fusion proteins having at least a portion of the follistatin polypeptide or FLRG polypeptide and one or more fusion domains, such as, for example, domains that facilitate isolation, detection, stabilization or multimerization of the polypeptide. Suitable fusion domains are discussed in detail above with reference to the ActRIIB polypeptides.
- an antagonist agent of the disclosure is a fusion protein comprising an activin-binding portion of a follistatin polypeptide fused to an Fc domain.
- an antagonist agent of the disclosure is a fusion protein comprising an activin binding portion of an FLRG polypeptide fused to an Fc domain.
- the present disclosure relates to the use of the subject ActRIIB polypeptides and variants thereof (e.g., GDF8 traps) to identify compounds (agents) which are agonist or antagonists of ActRIIB polypeptides.
- Compounds identified through this screening can be tested to assess their ability to treat myelofibrosis, for example, in animal models.
- high-throughput screening of compounds can be carried out to identify agents that perturb ActRIIB-mediated effects on a selected cell line.
- the assay is carried out to screen and identify compounds that specifically inhibit or reduce binding of an ActRIIB polypeptide to its binding partner, such as an ActRIIB ligand (e.g., activin A, activin B, activin AB, activin C, GDF8, GDF3, GDFl 1 or BMP10).
- an ActRIIB ligand e.g., activin A, activin B, activin AB, activin C, GDF8, GDF3, GDFl 1 or BMP10
- the assay can be used to identify compounds that enhance binding of an ActRII polypeptide to its binding partner such as an ActRIIB ligand.
- the compounds can be identified by their ability to interact with an ActRIIB polypeptide.
- test compounds (agents) of the invention may be created by any combinatorial chemical method.
- the subject compounds may be naturally occurring biomolecules synthesized in vivo or in vitro.
- Compounds (agents) to be tested for their ability to act as modulators of tissue growth can be produced, for example, by bacteria, yeast, plants or other organisms (e.g., natural products), produced chemically (e.g., small molecules, including peptidomimetics), or produced recombinantly.
- Test compounds contemplated by the present invention include non-peptidyl organic molecules, peptides, polypeptides, peptidomimetics, sugars, hormones, and nucleic acid molecules.
- the test agent is a small organic molecule having a molecular weight of less than about 2,000 Daltons.
- the test compounds of the disclosure can be provided as single, discrete entities, or provided in libraries of greater complexity, such as made by combinatorial chemistry. These libraries can comprise, for example, alcohols, alkyl halides, amines, amides, esters, aldehydes, ethers and other classes of organic compounds. Presentation of test compounds to the test system can be in either an isolated form or as mixtures of compounds, especially in initial screening steps.
- the compounds may be optionally derivatized with other compounds and have derivatizing groups that facilitate isolation of the compounds.
- derivatizing groups include biotin, fluorescein, digoxygenin, green fluorescent protein, isotopes, polyhistidine, magnetic beads, glutathione S-transferase (GST), photoactivatible crosslinkers or any combinations thereof.
- the effects of cellular toxicity or bioavailability of the test compound can be generally ignored in the in vitro system, the assay instead being focused primarily on the effect of the drug on the molecular target as may be manifest in an alteration of binding affinity between an ActRIIB polypeptide and its binding partner ⁇ e.g., an ActRIIB ligand).
- the compound of interest is contacted with an isolated and purified ActRIIB polypeptide which is ordinarily capable of binding to an ActRIIB ligand, as appropriate for the intention of the assay.
- an isolated and purified ActRIIB polypeptide which is ordinarily capable of binding to an ActRIIB ligand, as appropriate for the intention of the assay.
- an ActRIIB ligand ⁇ e.g., GDF11
- Detection and quantification of ActRIIB/ActRIIB-ligand complexes provides a means for determining the compound's efficacy at inhibiting (or potentiating) complex formation between the ActRIIB polypeptide and its binding protein.
- the efficacy of the compound can be assessed by generating dose- response curves from data obtained using various concentrations of the test compound.
- a control assay can also be performed to provide a baseline for comparison.
- isolated and purified ActRIIB ligand is added to a composition containing the ActRIIB polypeptide, and the formation of ActRIIB/ ActRIIB ligand complex is quantitated in the absence of the test compound. It will be understood that, in general, the order in which the reactants may be admixed can be varied, and can be admixed
- cellular extracts and lysates may be used to render a suitable cell-free assay system.
- Complex formation between an ActRIIB polypeptide and its binding protein may be detected by a variety of techniques. For instance, modulation of the formation of complexes can be quantitated using, for example, detectably labeled proteins such as radiolabeled ⁇ e.g., 32 P, 35 S, 14 C or 3 H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIB polypeptide and/or its binding protein, by immunoassay, or by chromatographic detection.
- the present disclosure contemplates the use of fluorescence polarization assays and fluorescence resonance energy transfer (FRET) assays in measuring, either directly or indirectly, the degree of interaction between an ActRIIB polypeptide and its binding protein.
- FRET fluorescence resonance energy transfer
- an interaction trap assay also known as the "two-hybrid assay” for identifying agents that disrupt or potentiate interaction between an ActRIIB polypeptide and its binding partner. See, e.g., U.S. Pat. No. 5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J Biol Chem
- the present disclosure contemplates the use of reverse two-hybrid systems to identify compounds ⁇ e.g., small molecules or peptides) that dissociate interactions between an ActRII polypeptide or GDF trap and its binding protein [see, e.g., Vidal and Legrain, (1999) Nucleic Acids Res 27:919-29; Vidal and Legrain, (1999) Trends Biotechnol 17:374-81; and U.S. Pat. Nos. 5,525,490; 5,955,280; and 5,965,368].
- the subject compounds are identified by their ability to interact with an ActRIIB polypeptide. The interaction between the compound and the
- ActRIIB polypeptide may be covalent or non-covalent.
- such interaction can be identified at the protein level using in vitro biochemical methods, including photo- crosslinking, radiolabeled ligand binding, and affinity chromatography [see, e.g., Jakoby WB et al. (1974) Methods in Enzymology 46: 1].
- the compounds may be screened in a mechanism-based assay, such as an assay to detect compounds which bind to an ActRIIB polypeptide. This may include a solid-phase or fluid-phase binding event.
- the gene encoding an ActRIIB polypeptide can be transfected with a reporter system ⁇ e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein) into a cell and screened against the library preferably by high-throughput screening or with individual members of the library.
- a reporter system ⁇ e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein
- Other mechanism-based binding assays may be used; for example, binding assays which detect changes in free energy. Binding assays can be performed with the target fixed to a well, bead or chip or captured by an immobilized antibody or resolved by capillary electrophoresis. The bound compounds may be detected usually using colorimetric endpoints or fluorescence or surface plasmon resonance.
- an ActRIIB antagonist (inhibitor) can be used to treat myelofibrosis patients, particularly ameliorating various complications of the disease including, for example, splenomegaly, extramedullary hematopoiesis, and fibrosis.
- the data presented herein show that a GDF trap polypeptide decrease splenomegaly, extramedullary hematopoiesis, and fibrosis in a
- the discloses relates to compositions and method for treating myelofibrosis, particularly treating or preventing one or more complications of myelofibrosis (splenomegaly, extramedullary hematopoiesis, anemia, and fibrosis), by administering to a patient in need thereof an effective amount of one or more ActRIIB antagonists, optionally in combination of one or more other supportive therapies or active agents for treating myelofibrosis.
- a therapeutic that "prevents" a disorder or condition refers to a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.
- treating includes amelioration or elimination of the condition once it has been established. In either case, prevention or treatment may be discerned in the diagnosis provided by a physician or other health care provider and the intended result of administration of the therapeutic agent.
- treatment or prevention of a disease or condition as described in the present disclosure is achieved by administering an ActRIIB antagonist in an effective amount.
- An effective amount of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
- a therapeutically effective amount of an agent of the present disclosure may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the agent to elicit a desired response in the individual.
- a prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result.
- the terms "subject,” an "individual,” or a "patient” are interchangeable throughout the specification and generally refer to mammals.
- Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats).
- Myelofibrosis is a clonal neoplastic disorder of hematopoiesis, generally characterized by progressive bone marrow fibrosis resulting in increasingly ineffective hematopoiesis, extramedullary hematopoiesis, a variety of inflammatory complications, and shortened survival [Mascarenhas et al. (2012) Curr Med Chem 19:4399-4413; and Vannucchi et al. (2011) Hematol Am Soc Hematol Educ Prog 201 1 : 222-230] . It i s one of the
- cytokines such fibroblast growth factor by the abnormal hematopoietic cell clone leads to replacement of the hematopoietic tissue of the bone marrow by connective tissue via collagen fibrosis.
- the decrease in hematopoietic tissue impairs the patient's ability to generate new blood cells, resulting in progressive pancytopenia, a shortage of all blood types.
- the proliferation and fibroblasts and deposition of collagen is a secondary phenomenon, and the fibroblasts themselves are not part of the abnormal cell clone.
- progressive scarring, or fibrosis, of the bone marrow patients develop
- extramedullary hematopoiesis as the haemopoetic cells are forced to migrate to other areas, particularly the liver and spleen. This causes an enlargement of these organs. In the liver, the condition is call hepatomegaly. Enlargement of the spleen is called splenomegaly, which also contributes pancytopenia, particularly thrombocytopenia and anemia. There are also reports of extramedullary hematopoiesis occurring in the lungs and lymph nodes. Another complication of extramedullary hematopoiesis is poikilocytosis, of the presence of abnormally shaped red blood cells.
- myelofibrosis Common clinical manifestations of myelofibrosis include progressive hepatosplenomegaly, abnormal blood counts, and debilitating symptoms such as fatigue, weight loss, night sweats, fever, pruritus, bone pain, early satiety, abdominal pain or discomfort, arthralgias, myalgias, parasthesias, cachexia, splenic infarct and bleeding.
- arthralgias myalgias, parasthesias, cachexia, splenic infarct and bleeding.
- the only treatment with a clearly demonstrated impact on disease progression has been allogeneic hematopoietic stem cell transplantation alloHSCT, but treatment-related mortality is high and only a minority of patients qualify for this intensive therapy [Gupta et al. (2012) Blood 120: 1367-1379].
- ActRIIB antagonists may be used, alone or in combination with one or more supportive therapies or active agents, to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis (e.g., primary myelofibrosis, post-polycythemia vera myelofibrosis, and post-essential thrombocythemia myelofibrosis).
- myelofibrosis e.g., primary myelofibrosis, post-polycythemia vera myelofibrosis, and post-essential thrombocythemia myelofibrosis.
- ActRIIB antagonists may be used, alone or in combination with one or more supportive therapies or active agents, to treat, prevent, or reduce the progression rate and/or severity of one or more complications of myelofibrosis including, for example, ineffective hematopoiesis, anemia, inflammation, fibrosis (e.g., bone marrow fibrosis, spleen fibrosis, and liver fibrosis), pancytopenia, thrombocytopenia, extramedullary hematopoiesis (e.g., splenic extramedullary hematopoiesis, hepatic extramedullary hematopoiesis, pulmonary extramedullary
- ineffective hematopoiesis anemia, inflammation, fibrosis (e.g., bone marrow fibrosis, spleen fibrosis, and liver fibrosis), pancytopenia, thrombocytopenia, extramedullary hematopoiesis (e
- hematopoiesis and lymphatic extramedullary hematopoiesis
- hematopoiesis and lymphatic extramedullary hematopoiesis
- osteosclerosis osteomyelofibrosis
- poikilocytosis fatigue, weight loss, night sweats, fever, pruritus, bone pain, early satiety, abdominal pain or discomfort, arthralgias, myalgias, parasthesias, cachexia, splenic infarct, and bleeding.
- PMF primary myelofibrosis
- Bone marrow fibrosis in PMF is usually associated with JAK2V617F or mutant CALR, or MPL, trisomy 9, or del(13q) [Hussein et al. (2009) Eur J Haematol. 82:329-338].
- the presence of these genetic markers therefore, strongly supports a diagnosis of PMF, in the presence of a myeloid neoplasm associated with bone marrow fibrosis.
- the disclosure relates to methods and uses of ActRIIB antagonists to treat, prevent, or reduce the
- progression rate and/or severity of primary myelofibrosis particularly treating, preventing, or reducing the progression rate and/or severity of one or more complications of primary myelofibrosis.
- post-PV MF post-polycythemia vera myelofibrosis
- post-ET MF post- essential thrombocythemia myelofibrosis
- IWG-MRT International Working Group for MPN Research and Treatment
- Grade 2-3 according to the European classification: diffuse, often coarse fiber network with no evidence of collagenization (negative tri chrome stain) or diffuse, coarse fiber network with areas of collagenization (positive tri chrome stain) [Thiele et al. (2005) Haematol ogica. 90: 1128-1132].
- Grade 3-4 according to the standard classification: diffuse and dense increase in reticulin with extensive intersections, occasionally with only focal bundles of collagen and/or focal osteosclerosis or diffuse and dense increase in reticulin with extensive intersections with coarse bundles of collagen, often associated with significant osteosclerosis [Manoharan et al. (1979) Br J Haematol 43 : 185-190].
- IWG-MRT diagnostic secondary criteria of which two must be detected in a patient along with the TvVG- MRT primary criteria for a post-PV MF diagnosis: 1) anemia or sustained loss of requirement for phlebotomy in the absence of cytoreductive therapy, 2) a leukoerythroblastic peripheral blood picture, 3) increasing splenomegaly defined as either an increase in palpable splenomegaly of > 5 cm or the appearance of a newly palpable splenomegaly, 4) development of > 1 of three constitutional symptoms: > 10% weight loss in six months, night sweats, unexplained fever.
- TvVG-MRT primary criteria for post-ET MF There are two TvVG-MRT primary criteria for post-ET MF: 1)
- TvVG-MRT diagnostic secondary criteria of which two must be detected in a patient along with the TvVG-MRT primary criteria for a post-ET MF diagnosis: 1) anemia and a > 2 g/dL decrease from baseline hemoglobin levels, 2) a leukoerythroblastic peripheral blood picture, 3) increasing splenomegaly defined as either an increase in palpable splenomegaly of > 5 cm or the appearance of a newly palpable splenomegaly, 4) increased lactate dehydrogenase, and 5) development of > 1 of three constitutional symptoms: > 10% weight loss in six months, night sweats, unexplained fever.
- the disclosure relates to methods and uses of ActRIIB antagonists to treat, prevent, or reduce the progression rate and/or severity of post-polycythemia vera myelofibrosis, particularly treating, preventing, or reducing the progression rate and/or severity of one or more complications of post-polycythemia vera myelofibrosis. In certain aspects, the disclosure relates to methods and uses of ActRIIB antagonists to treat, prevent, or reduce the
- progression rate and/or severity of post-essential thrombocythemia myelofibrosis particularly treating, preventing, or reducing the progression rate and/or severity of one or more complications of post-essential thrombocythemia myelofibrosis.
- the IPSS for myelofibrosis is applicable to patients being evaluated at time of initial diagnosis and uses five independent predictors of inferior survival: age >65 years, hemoglobin ⁇ 10 g/dL, leukocyte count >25 ⁇ 109/L, circulating blasts >1%, and presence of constitutional symptoms. The presence of 0, 1, 2, and >3 adverse factors defines low, intermediate- 1, intermediate-2, and high-risk disease, respectively. The corresponding median survivals were 11.3, 7.9, 4, and 2.3 years, respectively.
- the disclosure relates to methods and uses of ActRIIB antagonists to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis in a patient that has low, intermediate- 1, intermediate-2, or high-risk myelofibrosis according to the IPSS. In some embodiments, the disclosure relates to methods and uses of ActRIIB antagonists to prevent or delay
- the disclosure relates to methods and uses of ActRIIB antagonists to promote or increase myelofibrosis risk regression according to the IPSS (e.g., promotes or increase regression from high to intermediate-2 risk, intermediate-2 to intermediate- 1 risk, and intermediate- 1 to low risk according to the IPSS).
- the rvVG-MRT subsequently developed a dynamic prognostic model (dynamic international prognostic scoring system [DIPSS]) that uses the same prognostic variables used in IPSS but can be applied at any time during the disease course [Passamonti F et al. (2010) Blood. 115: 1703-1708].
- DIPSS assigns two, instead of one, adverse points for hemoglobin ⁇ 10 g/dL and risk categorization is accordingly modified: low (0 adverse points), intermediate- 1 (1 or 2 points), intermediate-2 (3 or 4 points), and high (5 or 6 points). The corresponding median survivals were not reached, 14.2, 4, and 1.5 years.
- the disclosure relates to methods and uses of ActRIIB antagonists to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis in a patient that has low, intermediate- 1, intermediate-2, or high-risk myelofibrosis according to the DIPSS.
- the disclosure relates to methods and uses of ActRIIB antagonists to prevent or delay myelofibrosis risk progression according to the DIPSS (e.g., prevents or delays risk progression from low to intermediate- 1 risk, intermediate- 1 to intermediate-2 risk, and intermediate-2 to high risk according to the DIPSS).
- the disclosure relates to methods and uses of ActRIIB antagonists to promote or increase myelofibrosis risk regression according to the DIPSS (e.g., promotes or increase regression from high to intermediate-2 risk, intermediate-2 to intermediate- 1 risk, and intermediate- 1 to low risk according to the DIPSS).
- ActRIIB antagonists to promote or increase myelofibrosis risk regression according to the DIPSS (e.g., promotes or increase regression from high to intermediate-2 risk, intermediate-2 to intermediate- 1 risk, and intermediate- 1 to low risk according to the DIPSS).
- IPSS- and DIPSS-independent risk factors for survival in myelofibrosis were subsequently identified and included unfavorable karyotype (i.e., complex karyotype or sole or two abnormalities that include +8, -7/7q-, i(17q), inv(3), -5/5q-, 12p-, or 1 lq23 rearrangement) [Hussein et al. (2010) Blood. 115:496-499], red cell transfusion need [Tefferi et al. (2009) Am J Hematol. 85: 14-17], and platelet count ⁇ 100 ⁇ 109/L [Patnaik et al. (2010) Eur J Haematol. 84: 105-108].
- unfavorable karyotype i.e., complex karyotype or sole or two abnormalities that include +8, -7/7q-, i(17q), inv(3), -5/5q-, 12p-, or 1 lq23
- DIPSS was modified into DIPSS-plus by incorporating these three additional DIPSS-independent risk factors: platelet count ⁇ 100 ⁇ 109/L, red cell transfusion need, and unfavorable karyotype.
- the four DIPSS-plus risk categories based on the aforementioned eight risk factors are low (no risk factors), intermediate- 1 (one risk factor), intermediate-2 (two or three risk factors), and high (four or more risk factors) with respective median survivals of 15.4, 6.5, 2.9, and 1.3 years.
- the disclosure relates to methods and uses of ActRIIB antagonists to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis in a patient that has low, intermediate- 1, intermediate-2, or high-risk myelofibrosis according to the DIPSS-plus.
- the disclosure relates to methods and uses of ActRIIB antagonists to prevent or delay myelofibrosis risk progression according to the DIPSS-plus (e.g., prevents or delays risk progression from low to intermediate- 1 risk, intermediate- 1 to intermediate-2 risk, and intermediate-2 to high risk according to the DIPSS-plus).
- the disclosure relates to methods and uses of ActRIIB antagonists to promote or increase myelofibrosis risk regression according to the DIPSS-plus (e.g., promotes or increase regression from high to intermediate-2 risk, intermediate-2 to intermediate- 1 risk, and intermediate- 1 to low risk according to the DIPSS-plus).
- ActRIIB antagonists to promote or increase myelofibrosis risk regression according to the DIPSS-plus (e.g., promotes or increase regression from high to intermediate-2 risk, intermediate-2 to intermediate- 1 risk, and intermediate- 1 to low risk according to the DIPSS-plus).
- CALR mutational frequency in JAK2/MPL-unmutated cases was 74%.
- CALR mutations were associated with younger age, higher platelet count, and lower DIPSS-plus score.
- CALR-mutated patients were also less likely to be anemic, require transfusions, or display leukocytosis. Spliceosome mutations were infrequent in CALR-mutated patients.
- the authors reported the longest survival in CALR+ASXLl- patients (median 10.4 years) and shortest in CALR-ASXL1+ patients (median 2.3 years) [Tefferi et al. (2014) Leukemia, prepublished as DOI 10.1038/leu.2014.57].
- CALR-ASXL1- patients had similar survival and were grouped together in an intermediate risk category (median survival 5.8 years). As is becoming evident for overall survival, leukemia-free survival is also significantly compromised in patients carrying certain mutations including IDH and SRSF2 [Tefferi et al. (2012) Leukemia. 26:475-480; Lasho et al. (2012) Blood. 120:4168-4171]. In addition, mutations in LNK and THPO have also been associated with myelofibrosis.
- JAK2V617F Janus kinase 2
- JAK2V617F a Janus kinase 2 gain-of-function mutation
- JAK2V617F a JAK2 inhibitor which is the first drug approved by the FDA for the treatment of myelofibrosis
- the Janus kinase family of receptor tyrosine kinases includes four different proteins (JAKl, JAK2, JAK3 and TYK2), and this family proteins is known to play a crucial role in myeloid and lymphoid cell growth and development. In particular, they mediate intracellular interactions from cytokine receptors, resulting in activation of signal transducer activator of transcription (STAT) factors and downstream promotion of genes that regulate cellular proliferation and differentiation [Quintas-Cardama et al. (2011) Nat Rev Drug Discov 10: 127-140].
- STAT signal transducer activator of transcription
- JAK2V617F mutation results in constitutive activation of JAK2 and thus promotes myeloid cell proliferation and differentiation.
- Other Janus kinase inhibitors undergoing clinical trials include, for example, fedratinib (SAR302503), monoelotinib (CYT387), pacritinib, lestaurtinib, AZD-1480, BMS-911543, NS-018, LY2784544, SEP-701, XL019, and AT- 9283.
- the disclosure relates to methods and uses of ActRIIB antagonists to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis in a patient that has one or more of: monosomal karyotype, inv(3)/i(17q) abnormalities, circulating blasts >9% and/or leukocytes >40 ⁇ 109/L, nullizygosity for JAK2 46/1 haplotype, JAK2V617F mutation, IDH1 mutation, IDH2 mutation, EZH2 mutation, SRSF2 mutation, ASXL1 mutation, increased serum IL-8 levels, increased serum IL-2R levels, increased free light chain levels, JAK1 mutation, JAK2 mutation, JAK3 mutation, TYK2 mutation, MPL mutation, CALR mutation, CALR+ASXL1-, CALR-ASKL1+, CALR+ASKL1+, CALR- ASKL1-, TET2 mutation, THPO mutation, and L K mutation.
- Blood transfusion whole blood or red blood cell transfusion
- transfusion there are a variety of conventional agents used to treat anemia in these patients.
- erythropoiesis-stimulating agents e.g., ESAs such as erythropoietin (EPO) and derivatives thereof
- ESAs erythropoietin
- androgens e.g., testosterone enanthate and fluoxymesterone
- prednisone danazol
- thalidomide e.g., prednisone
- lenalidomide e.g., prednisone
- ESAs e.g., testosterone enanthate and fluoxymesterone
- prednisone e.g., danazol
- thalidomide e.g., prednisone
- lenalidomide e.g., prednisone, danazol
- lenalidomide e.g., prednisone, danazol
- ESAs e.g., testosterone enanthate and fluoxymesterone
- ESAs responses are usually short-lived (around 1 year). If ESAs do not work or have poor efficacy, danazol or androgen preparations are typically used to treat anemic patients with a response rate around 20%. Low-dose thalidomide in association with tapering prednisone has produced responses in anemia in approximately 20-40% of patients [Thapaliya et al. (2011) Am J Hematol 86(l):86-98]. However, thalidomide treatment is often poorly tolerated with peripheral neuropathies, constipation, and somnolence leading to discontinuation of the drug in most patients.
- the disclosure relates to methods and uses of ActRIIB antagonists to treat, prevent, or reduce the progression rate and/or severity of myelofibrosis in a patient that has anemia. In some embodiments, the disclosure relates to methods and uses of ActRIIB antagonists to treat, prevent, or reduce the progression rate and/or severity of anemia in a myelofibrosis patient.
- the disclosure relates to a method of treating, preventing, or reducing the progression rate and/or severity myelofibrosis in a patient in need thereof of comprises administration of one or more ActRIIB antagonists conjointly with one or more additional active agents selected from the group consisting of: an erythropoiesis-stimulating agent [e.g., ESAs such as erythropoietin (EPO) and derivatives thereof], androgen (e.g., testosterone enanthate and fluoxymesterone), prednisone, danazol, thalidomide, prednisone, and lenalidomide.
- ESAs erythropoiesis-stimulating agent
- EPO erythropoietin
- additional active agents selected from the group consisting of: an erythropoiesis-stimulating agent [e.g., ESAs such as erythropoietin (EPO) and derivatives thereof], androgen (e.g
- the disclosure relates to a method of treating, preventing, or reducing the progression rate and/or severity anemia in a myelofibrosis patient in need thereof of comprises administration of one or more ActRIIB antagonists conjointly with one or more additional active agents selected from the group consisting of: an erythropoiesis-stimulating agent [e.g., ESAs such as erythropoietin (EPO) and derivatives thereof], androgen (e.g., testosterone enanthate and fluoxymesterone), prednisone, danazol, thalidomide, prednisone, and lenalidomide.
- ESAs erythropoiesis-stimulating agent
- EPO erythropoietin
- the disclosure relates a method of treating, preventing, or reducing the progression rate and/or severity anemia in a myelofibrosis patient in need thereof of comprises administration of one or more ActRIIB antagonists conjointly with a blood transfusion (whole blood or red blood cell transfusion).
- a level of less than normal for the appropriate age and gender category may be indicative of anemia, although individual variations are taken into account.
- a hemoglobin level from 10-12.5 g/dl, and typically about 11.0 g/dl is considered to be within the normal range in healthy adults, although, in terms of therapy, a lower target level may cause fewer cardiovascular side effects. See, e.g., Jacobs et al. (2000) Nephrol Dial Transplant 15, 15-19.
- hematocrit levels percentage of the volume of a blood sample occupied by the cells
- Hematocrit levels for healthy individuals range from about 41- 51% for adult males and from 35-45% for adult females.
- a patient may be treated with a dosing regimen intended to restore the patient to a target level of red blood cells, hemoglobin, and/or hematocrit or allow the reduction or elimination of red blood cell transfusions (reduce transfusion burden) while maintaining an acceptable level of red blood cells, hemoglobin and/or hematocrit.
- the target hemoglobin and/or hematocrit level can be any suitable for the target hemoglobin and/or hematocrit level.
- one or more ActRIIB antagonists optionally combined with an
- EPO receptor activator may be used in combination with one or more iron-chelating molecules to promote iron excretion in the urine and/or stool and thereby prevent or reverse tissue iron overload in myelofibrosis patients.
- Effective iron-chelating agents should be able to selectively bind and neutralize ferric iron, the oxidized form of non-transferrin bound iron which likely accounts for most iron toxicity through catalytic production of hydroxyl radicals and oxidation products [see, e.g., Esposito et al. (2003) Blood 102:2670-2677].
- iron-chelating agents are structurally diverse, but all possess oxygen or nitrogen donor atoms able to form neutralizing octahedral coordination complexes with individual iron atoms in stoichiometries of 1 : 1 (hexadentate agents), 2: 1 (tridentate), or 3 : 1 (bidentate) [Kalinowski et al. (2005) Pharmacol Rev 57:547-583].
- effective iron-chelating agents also are relatively low molecular weight ⁇ e.g., less than 700 daltons), with solubility in both water and lipids to enable access to affected tissues.
- Specific examples of iron-chelating molecules include deferoxamine, a hexadentate agent of bacterial origin requiring daily parenteral
- ActRIIB antagonists of the disclosure may be used in combination with an EPO receptor activator to achieve an increase in red blood cells, particularly at lower dose ranges. This may be beneficial in reducing the known off-target effects and risks associated with high doses of EPO receptor activators.
- ESAs The primary adverse effects of ESAs include, for example, an excessive increase in the hematocrit or hemoglobin levels and polycythemia. Elevated hematocrit levels can lead to hypertension (more particularly aggravation of hypertension).
- the present disclosure provides methods of treating or preventing anemia in a myelofibrosis patient by administering to the patient a therapeutically effective amount of one or more ActRIIB antagonists and a EPO receptor activator.
- an ActRIIB antagonists of the disclosure may be used in combination with EPO receptor activators to reduce the required dose of these activators in patients that are susceptible to adverse effects of ESAs. These methods may be used for therapeutic and prophylactic treatments of a patient.
- ActRIIB antagonists of the present disclosure act by a different mechanism that ESAs, these antagonists may be useful for increasing red blood cell and hemoglobin levels in patients that do not respond well to ESAs or other EPO receptor activators.
- an ActRIIB antagonist of the present disclosure may be beneficial for a patient in which administration of a normal to increased (> 300 R7/kg/week) dose of ESA does not result in the increase of hemoglobin level up to the target level.
- An inadequate response to ESAs can be either constitutive (observed upon the first treatment with ESA) or acquired (observed upon repeated treatment with ESA).
- Cytoreductive agents have been the treatment of choice for most patients with symptomatic splenomegaly.
- Hydroxy carbamide hydroxyurea, HC
- HC hydroxyurea
- HC can often exacerbate cytopenias and therefore is often not well tolerated.
- JAK inhibitors may be useful to treat splenomegaly, they may actually worsen other complications of myelofibrosis, particularly anemia and anemia-associated disorders.
- immunomodulating drugs e.g., pomalidomide
- inhibitors of the mammalian target of the mTOR pathway e.g., rapamycin, sirolimus, deforolimus, everolimus, temsirolimus, NVP-BEZ235, BGT226, SF1126, PK1-587, F K128, AZD8055, and AZD2014
- epigenetic factors modulators e.g., histone deacetylases inhibitors such as givinostat (ITF2357), panobinostat (LBH589) and pracinostat
- ActRIIB antagonists in combination with one or more other therapeutic modalities in the treatment of patients as described herein.
- ActRIIB antagonists can be administered in combination with cytotoxins, immunosuppressive agents, radiotoxic agents, and/or therapeutic antibodies.
- Particular co-therapeutics contemplated by the present invention include, but are not limited to, steroids (e.g., corticosteroids, such as Prednisone), immune-suppressing and/or antiinflammatory agents (e.g., gamma-interferon, cyclophosphamide, azathioprine, methotrexate, penicillamine, cyclosporine, colchicine, antithymocyte globulin, mycophenolate mofetil, and hydroxychloroquine), cytotoxic drugs, calcium channel blockers (e.g., nifedipine), angiotensin converting enzyme inhibitors (ACE) inhibitors, para-aminobenzoic acid (PABA), dimethyl sulfoxide, transforming growth factor beta (TGFP) inhibitors, interleukin-5 (IL-5) inhibitors, and pan caspase inhibitors.
- steroids e.g., corticosteroids, such as Prednisone
- Additional agents that may be used in combination with ActRIIB antagonist include, but are not limited to, lectins (as described in, for example, U.S. Patent No.: 7,026,283, the entire contents of which is incorporated herein by reference), as well as the anti-fibrotic agents described by Wynn et al (2007, J Clin Invest 117:524-529).
- additional anti-fibrotic agents and therapies include, but are not limited to, various anti-inflammatory/immunosuppressive/cytotoxic drugs (including colchicine, azathioprine, cyclophosphamide, prednisone, thalidomide, pentoxifylline and theophylline), TGFP signaling modifiers (including relaxin, SMAD7, HGF, and BMP7, as well as TGFpi, ⁇ , ⁇ , EGR-I, and CTGF inhibitors), cytokine and cytokine receptor antagonists (inhibitors of IL- ⁇ , IL-5, IL-6, IL- 13, IL-21, IL-4R, IL-13Rod, GM-CSF, TNF-a, oncostatin M, W1SP-I, and PDGFs), cytokines and chemokincs (IFN- ⁇ , IFN- ⁇ / ⁇ , IL-12, IL-10, HGF, CXCL10, and CXCL
- MMP inhibitors inhibitors of MMP2, MMP9, and MMP12
- T1MP inhibitors antibodies specific for TEVIP-1 .
- an ActRIIB antagonists of the disclosure can be used alone to treat a patient in need thereof.
- the ActRIIB antagonists may be used in combination with conventional therapeutic approaches directed to treatment or prevention of proliferative disorders described herein, including, for example, surgery (e.g., splenectomy) , cytotoxic agents, radiological treatments involving irradiation or administration of radioactive substances, chemotherapeutic agents, anti-hormonal agents, growth inhibitory agents, antineoplastic compositions, and treatment with anti-cancer agents listed herein and known in the art, or combinations thereof.
- cytotoxic agent refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells.
- radioactive isotopes e.g., At 211 , l 131 , l 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 and radioactive isotopes of Lu
- chemotherapeutic agents e.g., At 211 , l 131 , l 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 and radioactive isotopes of Lu
- chemotherapeutic agents e.g.
- methotrexate adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunombicin or other intercalating agents, enzymes and fragments thereof such as nucleolytic enzymes, antibiotics, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof, and the various antitumor or anticancer agents disclosed below. Other cytotoxic agents are described below.
- a tumoricidal agent causes destruction of tumor cells.
- a chemotherapeutic agent is a chemical compound useful in the treatment of cancer.
- chemotherapeutic agents include alkylating agents such as thiotepa and CYTOXAN® cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa;
- ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine;
- acetogenins especially bullatacin and bullatacinone
- dronabinol, MARINOL® beta-lapachone
- lapachol colchicines
- betulinic acid a camptothecin (including the synthetic analogue topotecan (HYCAMTIN®), CPT-11
- spongistatin nitrogen mustards such as chlorambucil, chlornaphazine, cyclophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard;
- nitrogen mustards such as chlorambucil, chlornaphazine, cyclophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard;
- nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Agnew, Chem Intl. Ed. Engl., 33 : 183-186 (1994)); dynemicin, including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic
- antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Agnew, Chem Intl. Ed. Engl., 33 : 183-186 (1994)
- chromophores aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunombicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN® doxombicin (including morpholino-doxombicin, cyanomorpholino-doxombicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenim
- NAVELBINE® novantrone
- edatrexate daunomycin
- aminopterin ibandronate
- retinoids such as retinoic acid; capecitabine (XELODA®); pharmaceutically acceptable salts, acids or derivatives of any of the above; as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone, and FOLFOX, an abbreviation for a treatment regimen with oxaliplatin (ELOXATINTM) combined with 5-FU and leucovovin.
- anti-hormonal agents that act to regulate, reduce, block, or inhibit the effects of hormones that can promote the growth of cancer, and are often in the form of systemic, or whole-body treatment. They may be hormones themselves.
- Examples include anti -estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX® tamoxifen), EVISTA® raloxifene, droloxifene, 4- hydroxytamoxifen, trioxifene, keoxifene, LY1 17018, onapristone, and FARESTON® toremifene; anti-progesterones; estrogen receptor down-regulators (ERDs); agents that function to suppress or shut down the ovaries, for example, luteinizing hormone-releasing hormone (LHRH) agonists such as LUPRON® and ELIGARD® leuprolide acetate, goserelin acetate, buserelin acetate and tripterelin; other anti -androgens such as flutamide, nilutamide and bicalutamide; and aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen
- chemotherapeutic agents includes bisphosphonates such as clodronate (for example, BONEFOS® or OSTAC®), DIDROC AL® etidronate, NE-58095, ZOMET A® zoledronic acid/zoledronate, FOSAMAX® alendronate, AREDIA®
- telomeres 1,3-dioxolane nucleoside cytosine analog
- antisense oligonucleotides particularly those that inhibit expression of genes in signaling pathways implicated in aberrant cell proliferation, such as, for example, PKC-alpha, Raf, H-Ras, and epidermal growth factor receptor (EGF- R)
- vaccines such as THERATOPE® vaccine and gene therapy vaccines, for example, ALLOVECTIN® vaccine, LEUVECTIN® vaccine, and VAXID® vaccine;
- LURTOTECAN® topoisomerase 1 inhibitor ABARELIX® rmRH
- lapatinib ditosylate an ErbB-2 and EGFR dual tyrosine kinase small-molecule inhibitor also known as GW572016
- pharmaceutically acceptable salts, acids or derivatives of any of the above include
- a growth inhibitory agent generally refers to a compound or composition which inhibits growth of a cell either in vitro or in vivo.
- the growth inhibitory agent may be one which significantly reduces the percentage of cells in S phase.
- growth inhibitory agents include agents that block cell cycle progression (at a place other than S phase), such as agents that induce Gl arrest and M-phase arrest.
- Classical M-phase blockers include the vincas (vincristine and vinblastine), taxanes, and topoisomerase II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin.
- DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
- DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
- DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
- TAXOTERE® Rhone -Poulenc Rorer
- TAXOL® Bristol-Myers Squibb
- Paclitaxel and docetaxel promote the assembly of microtubules from tubulin dimers and stabilize microtubules by preventing depolymerization, which results in the inhibition of mitosis in cells.
- an ActRIIB antagonist and an additional active agent can be administered in the same formulation or separately.
- the ActRIIB antagonist can be administered before, after, or concurrently with the additional active agent.
- One agent may precede or follow administration of the other agent by intervals ranging from minutes to weeks.
- two or more different kinds of therapeutic agents are applied separately to a subject, one would generally ensure that a significant period of time did not expire between the time of each delivery, such that these different kinds of agents would still be able to exert an advantageously combined effect on the target tissues or cells.
- the present disclosure provides methods for managing a patient that has been treated with, or is a candidate to be treated with, one or more one or more ActRIIB antagonist agents of the disclosure by measuring one or more hematologic parameters in the patient.
- the hematologic parameters may be used to evaluate appropriate dosing for a patient who is a candidate to be treated with the antagonist of the present disclosure, to monitor the hematologic parameters during treatment, to evaluate whether to adjust the dosage during treatment with one or more antagonist of the disclosure, and/or to evaluate an appropriate maintenance dose of one or more antagonists of the disclosure. If one or more of the hematologic parameters are outside the normal level, dosing with one or more ActRIIB antagonists may be reduced, delayed or terminated.
- Hematologic parameters that may be measured in accordance with the methods provided herein include, for example, red blood cell levels, blood pressure, iron stores, and other agents found in bodily fluids that correlate with increased red blood cell levels, using art recognized methods. Such parameters may be determined using a blood sample from a patient. Increases in red blood cell levels, hemoglobin levels, and/or hematocrit levels may cause increases in blood pressure.
- hematologic parameters are outside the normal range or on the high side of normal in a patient who is a candidate to be treated with one or more ActRIIB antagonists, then onset of administration of the one or more antagonists of the disclosure may be delayed until the hematologic parameters have returned to a normal or acceptable level either naturally or via therapeutic intervention.
- a candidate patient is hypertensive or pre-hypertensive, then the patient may be treated with a blood pressure lowering agent in order to reduce the patient's blood pressure.
- Any blood pressure lowering agent appropriate for the individual patient's condition may be used including, for example, diuretics, adrenergic inhibitors (including alpha blockers and beta blockers), vasodilators, calcium channel blockers, angiotensin-converting enzyme (ACE) inhibitors, or angiotensin II receptor blockers.
- Blood pressure may alternatively be treated using a diet and exercise regimen.
- the patient may be treated with an appropriate regimen of diet and/or iron supplements until the patient's iron stores have returned to a normal or acceptable level.
- administration of the one or more antagonists of the disclosure may be delayed until the levels have returned to a normal or acceptable level.
- hematologic parameters are outside the normal range or on the high side of normal in a patient who is a candidate to be treated with one or more ActRIIB antagonists, then the onset of administration may not be delayed.
- the dosage amount or frequency of dosing of the one or more antagonists of the disclosure may be set at an amount that would reduce the risk of an unacceptable increase in the hematologic parameters arising upon administration of the one or more antagonists of the disclosure.
- a therapeutic regimen may be developed for the patient that combines one or more ActRIIB antagonists with a therapeutic agent that addresses the undesirable level of the hematologic parameter. For example, if the patient has elevated blood pressure, then a therapeutic regimen may be designed involving administration of one or more ActRIIB antagonist agents of the and a blood pressure lowering agent. For a patient having lower than desired iron stores, a therapeutic regimen may be developed involving one or more ActRIIB antagonists of the disclosure and iron supplementation.
- baseline parameter(s) for one or more hematologic parameters may be established for a patient who is a candidate to be treated with one or more ActRIIB antagonists of the disclosure and an appropriate dosing regimen established for that patient based on the baseline value(s).
- established baseline parameters based on a patient's medical history could be used to inform an appropriate antagonist dosing regimen for a patient. For example, if a healthy patient has an established baseline blood pressure reading that is above the defined normal range it may not be necessary to bring the patient's blood pressure into the range that is considered normal for the general population prior to treatment with the one or more antagonist of the disclosure.
- a patient's baseline values for one or more hematologic parameters prior to treatment with one or more ActRIIB antagonists of the disclosure may also be used as the relevant comparative values for monitoring any changes to the hematologic parameters during treatment with the one or more antagonists of the disclosure.
- one or more hematologic parameters are measured in patients who are being treated with a one or more ActRIIB antagonists.
- the hematologic parameters may be used to monitor the patient during treatment and permit adjustment or termination of the dosing with the one or more antagonists of the disclosure or additional dosing with another therapeutic agent. For example, if administration of one or more ActRIIB
- the dose of the one or more antagonists of the disclosure may be reduced in amount or frequency in order to decrease the effects of the one or more antagonists of the disclosure on the one or more hematologic parameters. If administration of one or more ActRIIB antagonists results in a change in one or more hematologic parameters that is adverse to the patient, then the dosing of the one or more antagonists of the disclosure may be terminated either temporarily, until the hematologic parameter(s) return to an acceptable level, or permanently.
- the dosing may be terminated.
- the patient may be dosed with an additional therapeutic agent that addresses the undesirable level in the hematologic parameter(s), such as, for example, a blood pressure lowering agent or an iron supplement.
- dosing with the one or more antagonists of the disclosure may continue at the same level and a blood-pressure- lowering agent is added to the treatment regimen, dosing with the one or more antagonist of the disclosure may be reduced (e.g., in amount and/or frequency) and a blood-pressure- lowering agent is added to the treatment regimen, or dosing with the one or more antagonist of the disclosure may be terminated and the patient may be treated with a blood-pressure- lowering agent.
- administration refers to any form of administration such that additional therapies (e.g., second, third, fourth, etc.) are still effective in the body (e.g., multiple compounds are simultaneously effective in the patient, which may include synergistic effects of those compounds). Effectiveness may not correlate to measurable concentration of the agent in blood, serum, or plasma.
- the different therapeutic compounds can be administered either in the same formulation or in separate formulations, either concomitantly or sequentially, and on different schedules. Thus, an individual who receives such treatment can benefit from a combined effect of different therapies.
- One or more ActRIIB antagonists, or combinations of such polypeptides, of the disclosure can be administered concurrently with, prior to, or subsequent to, one or more other additional agents or supportive therapies.
- each therapeutic agent will be administered at a dose and/or on a time schedule determined for that particular agent.
- the particular combination to employ in a regimen will take into account compatibility of the antagonist of the present disclosure with the therapy and/or the desired.
- compositions for use in accordance with the present disclosure may be formulated in conventional manner using one or more physiologically acceptable carriers or excipients. Such formulations will generally be substantially pyrogen-free, in compliance with most regulatory requirements.
- the therapeutic method of the disclosure includes administering the composition systemically, or locally as an implant or device.
- the therapeutic composition for use in this disclosure is in a pyrogen-free, physiologically acceptable form.
- Therapeutically useful agents other than the ActRIIB signaling antagonists which may also optionally be included in the composition as described above, may be administered simultaneously or sequentially with the subject compounds (e.g., ActRIIB polypeptides) in the methods disclosed herein.
- protein therapeutic agents disclosed herein will be administered parentally, and particularly intravenously or subcutaneously.
- compositions suitable for parenteral administration may comprise one or more ActRIIB antagonist in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
- aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- compositions and formulations may, if desired, be presented in a pack or dispenser device which may contain one or more unit dosage forms containing the active ingredient.
- the pack may for example comprise metal or plastic foil, such as a blister pack.
- the pack or dispenser device may be accompanied by instructions for administration
- compositions of the present invention may include a matrix capable of delivering one or more therapeutic compounds (e.g., ActRIIB
- polypeptides to a target tissue site, providing a structure for the developing tissue and optimally capable of being resorbed into the body.
- the matrix may provide slow release of the ActRIIB antagonist.
- Such matrices may be formed of materials presently in use for other implanted medical applications. The choice of matrix material is based on biocompatibility, biodegradability, mechanical properties, cosmetic appearance and interface properties. The particular application of the subject compositions will define the appropriate formulation.
- Potential matrices for the compositions may be biodegradable and chemically defined calcium sulfate, tricalcium phosphate, hydroxyapatite, polylactic acid and polyanhydrides. Other potential materials are biodegradable and biologically well defined, such as bone or dermal collagen. Further matrices are comprised of pure proteins or extracellular matrix components. Other potential matrices are non-biodegradable and chemically defined, such as sintered
- Matrices may be comprised of combinations of any of the above mentioned types of material, such as polylactic acid and hydroxyapatite or collagen and tricalcium phosphate.
- the bioceramics may be altered in composition, such as in calcium-aluminate-phosphate and processing to alter pore size, particle size, particle shape, and biodegradability.
- methods of the invention can be administered for orally, e.g., in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of an agent as an active ingredient.
- inert base such as gelatin and glycerin, or sucrose and acacia
- an agent may also be administered as a bolus, electuary or paste.
- one or more therapeutic compounds of the present invention may be mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators,
- compositions may also comprise buffering agents.
- Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
- Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
- the liquid dosage forms may contain inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
- inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as eth
- the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming, and preservative agents.
- Suspensions in addition to the active compounds, may contain suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- compositions of the invention may also contain adjuvants, such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption, such as aluminum monostearate and gelatin.
- the dosage regimen will be determined by the attending physician considering various factors which modify the action of the subject compounds of the invention (e.g., ⁇ polypeptides).
- the various factors include, but are not limited to, the patient's age, sex, and diet, the severity disease, time of administration, and other clinical factors.
- the dosage may vary with the type of matrix used in the reconstitution and the types of compounds in the composition.
- the addition of other known growth factors to the final composition may also affect the dosage. Progress can be monitored by periodic assessment of bone growth and/or repair, for example, X-rays (including DEXA),
- the present invention also provides gene therapy for the in vivo production of ActRIIB antagonist.
- Such therapy would achieve its therapeutic effect by introduction of the ActRIIB polynucleotide sequences into cells or tissues having the disorders as listed above.
- Delivery of ActRIIB polynucleotide sequences can be achieved using a recombinant expression vector such as a chimeric virus or a colloidal dispersion system.
- Preferred for therapeutic delivery of ActRIIB polynucleotide sequences is the use of targeted liposomes.
- viral vectors which can be utilized for gene therapy as taught herein include adenovirus, herpes virus, vaccinia, or, preferably, an RNA virus such as a retrovirus.
- the retroviral vector is a derivative of a murine or avian retrovirus.
- retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), and Rous Sarcoma Virus (RSV).
- MoMuLV Moloney murine leukemia virus
- HaMuSV Harvey murine sarcoma virus
- MuMTV murine mammary tumor virus
- RSV Rous Sarcoma Virus
- retroviral vectors can incorporate multiple genes. All of these vectors can transfer or incorporate a gene for a selectable marker so that transduced cells can be identified and generated.
- Retroviral vectors can be made target-specific by attaching, for example, a sugar, a glycolipid, or a protein.
- Preferred targeting is accomplished by using an antibody.
- specific polynucleotide sequences can be inserted into the retroviral genome or attached to a viral envelope to allow target specific delivery of the retroviral vector containing the ActRIIB polynucleotide.
- the vector is targeted to bone or cartilage.
- tissue culture cells can be directly transfected with plasmids encoding the retroviral structural genes gag, pol and env, by conventional calcium phosphate transfection. These cells are then transfected with the vector plasmid containing the genes of interest. The resulting cells release the retroviral vector into the culture medium.
- Another targeted delivery system for ActRIIB antagonist polynucleotides is a colloidal dispersion system. Colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. The preferred colloidal system of this invention is a liposome.
- Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo. RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (see e.g., Fraley, et al., Trends Biochem. Sci., 6:77, 1981). Methods for efficient gene transfer using a liposome vehicle, are known in the art, see e.g., Mannino, et al., Biotechniques, 6:682, 1988.
- the composition of the liposome is usually a combination of phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used.
- the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations.
- lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine,
- phosphatidylethanolamine sphingolipids
- cerebrosides sphingolipids
- gangliosides phosphatidylethanolamine
- Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidyl choline, and distearoylphosphatidyl choline.
- the targeting of liposomes is also possible based on, for example, organ-specificity, cell-specificity, and organelle-specificity and is known in the art.
- the disclosure provides formulations that may be varied to include acids and bases to adjust the pH; and buffering agents to keep the pH within a narrow range.
- the constructs are referred to as ActRIIB-hFc and ActRIIB-Fc, respectively.
- ActRIIB-hFc is shown below as purified from CHO cell lines (SEQ ID NO: 24): GRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKK GCWLDDFNCYDRQECVATEE PQVYFCCCEG FC ERFTHLPEAGGPEVTYEPPPT APTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS KAL PVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK
- Tissue plasminogen activator TP A: MDAMKRGLCCVLLLCGAVFVSP (SEQ ID NO: 22), and (iii) Native:
- the selected form employs the TPA leader and has the following unprocessed amino acid sequence (SEQ ID NO: 25):
- MDAMKRGLCCVLLLCGA VSPGASGRGEAETRECIYYNANWELERTNQSGLERCE GEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCE GNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPOVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSPGK
- This polypeptide is encoded by the following nucleic acid sequence (SEQ ID NO:
- N-terminal sequencing of the CHO-cell-produced material revealed a major sequence of -GRGEAE (SEQ ID NO: 27). Notably, other constructs reported in the literature begin with an -SGR... sequence.
- Purification could be achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenyl sepharose chromatography, size exclusion
- ActRIIB-Fc fusion proteins were also expressed in HEK293 cells and COS cells. Although material from all cell lines and reasonable culture conditions provided protein with muscle-building activity in vivo, variability in potency was observed perhaps relating to cell line selection and/or culture conditions.
- the background ActRIIB-Fc fusion has the sequence of SEQ ID NO: 24.
- HEK293T cells were produced in HEK293T cells by transient transfection.
- HEK293T cells were set up at 6xl0 5 cells/ml in Freestyle (Invitrogen) media in 250ml volume and grown overnight. Next day, these cells were treated with DNA:PEI (1 : 1) complex at 0.5 ug/ml final DNA concentration. After 4 hrs, 250 ml media was added and cells were grown for 7 days. Conditioned media was harvested by spinning down the cells and concentrated.
- Mutants were purified using a variety of techniques, including, for example, a protein A column, and eluted with low pH (3.0) glycine buffer. After neutralization, these were dialyzed against PBS.
- Mutants were also produced in CHO cells by similar methodology. Mutants were tested in binding assays and/or bioassays described in WO 2008/097541 and WO
- Applicant generated an ActRIIB(25-131)-hFc fusion protein, which comprises the human ActRIIB extracellular domain with N-terminal and C-terminal truncations (residues 25-131 of the native protein SEQ ID NO: 1) fused N-terminally with a TPA leader sequence substituted for the native ActRIIB leader and C-terminally with a human Fc domain via a minimal linker (three glycine residues) ( Figure 12).
- a nucleotide sequence encoding this fusion protein is shown in Figure 13. Applicants modified the codons and found a variant nucleic acid encoding the ActRIIB(25-131)-hFc protein that provided substantial
- the mature protein has an amino acid sequence as follows (N-terminus confirmed by
- Amino acids 1-107 are derived from ActRIIB.
- the expressed molecule was purified using a series of column chromatography steps, including for example, three or more of the following, in any order: Protein A
- a polypeptide having a modified extracellular domain of ActRIIB amino acids 20-134 of SEQ ID NO: 1 with an L79D substitution
- myostatin as a consequence of a leucine-to-aspartate substitution at position 79 in SEQ ID NO: 1
- the constructs are referred to as ActRIIB(L79D 20-134)-hFc and ActRIIB(L79D 20-134)-Fc, respectively.
- the GDF trap ActRIIB(L79D 20-134)-hFc is shown below as purified from CHO cell lines (SEQ ID NO: 29).
- GRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKK GCWDDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPT APTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS KAL PVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK
- the ActRIIB -derived portion of the GDF trap has an amino acid sequence set forth below (SEQ ID NO: 30), and that portion could be used as a monomer or as a non-Fc fusion protein as a monomer, dimer, or greater-order complex.
- the GDF trap protein was expressed in CHO cell lines. Three different leader sequences were considered:
- HBML Honey bee melittin
- TP A Tissue plasminogen activator
- Native Native.
- the selected form employs the TPA leader and has the following unprocessed amino acid sequence:
- MDAMKRGLCCVLLLCGA VSPGASGRGEAETRECIYYNANWELERTNQSGLERCE GEQDKRLHC YASWRNS SGTIELVKKGCWDDDFNC YDRQEC VATEENPQ VYFCCCE GNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPOVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 31)
- This polypeptide is encoded by the following nucleic acid sequence (SEQ ID NO:
- Purification could be achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenyl sepharose chromatography, size exclusion
- the cell culture medium is passed over a protein A column, washed in 150 mM Tris/NaCl (pH 8.0), then washed in 50 mM Tris/NaCl (pH 8.0) and eluted with 0.1 M glycine, pH 3.0.
- the low pH eluate is kept at room temperature for 30 minutes as a viral clearance step.
- the eluate is then neutralized and passed over a Q-sepharose ion-exchange column and washed in 50 mM Tris pH 8.0, 50 mM NaCl, and eluted in 50 mM Tris pH 8.0, with an NaCl concentration between 150 mM and 300 mM.
- the eluate is then changed into 50 mM Tris pH 8.0, 1.1 M ammonium sulfate and passed over a phenyl sepharose column, washed, and eluted in 50 mM Tris pH 8.0 with ammonium sulfate between 150 and 300 mM.
- the eluate is dialyzed and filtered for use.
- A-204 reporter gene assay was used to evaluate the effects of ActRIIB-Fc proteins and GDF traps on signaling by GDF-1 1 and activin A.
- Cell line human rhabdomyosarcoma (derived from muscle).
- Reporter vector pGL3(CAGA)12 (described in Dennler et al, 1998, EMBO 17: 3091-3100).
- the CAGA12 motif is present in TGF-beta responsive genes (e.g., PAI-1 gene), so this vector is of general use for factors signaling through SMAD2 and 3.
- Day 1 Split A-204 cells into 48-well plate.
- activin A showed 10-fold stimulation of reporter gene expression and an ED50 ⁇ 2 ng/ml.
- GDF-1 1 16 fold stimulation, ED50: ⁇ 1.5 ng/ml.
- ActRIIB(20-134) is a potent inhibitor of activin A, GDF-8, and GDF-1 1 activity in this assay. As described below, ActRIIB variants were also tested in this assay.
- Example 4 ActRIIB-Fc Variants, Cell-Based Activity Activity of ActRIIB-Fc proteins and GDF traps was tested in a cell-based assay as described above. Results are summarized in the table below. Some variants were tested in different C-terminal truncation constructs. As discussed above, truncations of five or fifteen amino acids caused reduction in activity. The GDF traps (L79D and L79E variants) showed substantial loss of activin A inhibition while retaining almost wild-type inhibition of GDF-1 1. Soluble ActRIIB-Fc binding to GDF 11 and Activin A:
- ActRIIB(20-134)-Fc has a serum half-life of approximately 70 hours.
- ActRIIB(A24N 20-134)-Fc has a serum half-life of approximately 100-150 hours. Any of the variants tested above, may be combined with the GDF trap molecules.
- Example 5 GDF-11 and Activin A Binding.
- the ActRIIB-Fc variants or wild-type protein were captured onto the system using an anti-hFc antibody. Ligands were injected and flowed over the captured receptor proteins. Results are summarized in the tables below.
- Soluble ActRIIB-Fc variants binding to GDF11 and Activin A (BiacoreTM assa;
- a GDF trap referred to as ActRIIB(L79D 20-134)-hFc was generated by N-terminal fusion of TPA leader to the ActRIIB extracellular domain (residues 20-134 in SEQ ID NO: 1) containing a leucine-to-aspartate substitution (at residue 79 in SEQ ID NO: 1) and C-terminal fusion of human Fc domain with minimal linker (three glycine residues) (Figure 3).
- Figure 4 A nucleotide sequence corresponding to this fusion protein is shown in Figure 4.
- a GDF trap with truncated ActRIIB extracellular domain referred to as
- ActRIIB(L79D 25-13 l)-hFc was generated by N-terminal fusion of TPA leader to truncated extracellular domain (residues 25-131 in SEQ ID NO: 1) containing a leucine-to-aspartate substitution (at residue 79 in SEQ ID NO: 1) and C-terminal fusion of human Fc domain with minimal linker (three glycine residues) (Figure 5, SEQ ID NO: 50).
- Figure 6 SEQ ID NO: 51
- an alternative nucleotide sequence encoding exactly the same fusion protein is shown in Figure 9 (SEQ ID NO:
- ActRIIB(L79 20-134)-hFc also retains strong to intermediate binding to the Smad 2/3 signaling ligand GDF8 and the Smad 1/5/8 ligands BMP6 and BMP10.
- ActRIIB 5 an alternate, soluble form of ActRIIB (designated ActRIIB 5), in which exon 4, including the ActRIIB transmembrane domain, has been replaced by a different C-terminal sequence (see, e.g., WO 2007/053775).
- This variant may be connected to human Fc (double underlined with a TGGG linker (single underline) to generate a human ActRIIB5(L79D)-hFc fusion protein with the following sequence: GRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVK KGCWDDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEGPWAST TIPSGGPEATAAAGDOGSGALWLCLEGPAHETGGGTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEOYN STYRVVSVLTVLHODWLNGKEYKCKVSNKALPAPIEKTISKAKGOPREPOVYTLP PSREEMTKNOVSLTCLVKGFYPSDIAVEWESNGOPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWOOGNVFS
- This construct may be expressed in CHO cells.
- Example 9 Effect of a GDF Trap in in a JAK2V617F Animal Model Transgenic JAK2V617F mutant mice [the A line as described in Xing et al. (2008)
- JAK2V617F mice To understand the onset and progression of myelofibrosis disease, the complete blood counts and degree of fibrosis in JAK2V617F mice was compared, at various ages, to data obtained from control animals (age-matched wild-type mice). Red blood cell (RBC) and platelet levels were elevated in JAK2V617F mice at all ages compared to wild-type, with a trend toward increased levels in mutant animals between 2 to 5 months followed by a progressive decrease between 8 to 12 months. Fibrosis was detectable in bone marrow of JAK2V617F mice starting around 5 months, which worsened with age. JAK2V617F mice also displayed splenomegaly around 3 to 4 months, which also worsened with age.
- RBC Red blood cell
- platelet levels were elevated in JAK2V617F mice at all ages compared to wild-type, with a trend toward increased levels in mutant animals between 2 to 5 months followed by a progressive decrease between 8 to 12 months
- mice were placed into one of two groups: i) treatment oiJAK2V617F mice with ActRIIB(L79D 25-131)-Fc on a dosing schedule of 10 mg/kg twice weekly; and ii) treatment of JAK2V617F mice with vehicle (TBS) twice weekly (i.e., control animals).
- TBS vehicle
- ActRIIB(L79D 25-131)-Fc treated animals displayed reduced spleen size (-12.5%) compared to control animals.
- histopathology revealed a decrease of extramedullary hematopoiesis in the spleens of ActRIIB(L79D 25-131)-Fc treated mice compared to control animals.
- treatment with a GDF trap is effective at ameliorating various complications of myelofibrosis in this JAK2V617F model, particularly in decreasing splenomegaly, extramedullary hematopoiesis, and fibrosis.
- ActRIIB antagonists may be used for treating myelofibrosis.
- ActRIIB antagonists may be particularly useful in the treatment of various complications of myelofibrosis including, for example, decreasing splenomegaly, decreasing extramedullary hematopoiesis, increasing red blood cell levels, and/or decreasing fibrosis (e.g., bone marrow fibrosis).
- Ruxolitinib is a Janus kinase inhibitor that has been approved for the treatment of intermediate or high-risk myelofibrosis.
- ruxolitinib shows significant effects in reduction of spleen size and ameliorating symptoms associated with splenomegaly in myelofibrosis patients.
- hematological side effects have been observed in patients treated with ruxolitinib including, for example, anemia.
- ActRIIB(L79D 25-131)-Fc treatment were used to understand the effects of ActRIIB(L79D 25-131)-Fc treatment on various hematological parameters in ruxolitinib treated mice.
- mice were placed into one of four groups: i) treatment with ActRIIB(L79D 25-131)-Fc on a dosing schedule of 10 mg/kg twice weekly; ii) treatment with ruxolitinib on a dosing schedule of 60 mg/kg twice daily; iii) treatment with ActRIIB(L79D 25-131)-Fc on a dosing schedule of 10 mg/kg twice weekly and ruxolitinib on a dosing schedule of 60 mg/kg twice daily; and iv) treatment with vehicle (TBS) twice weekly (i.e., control animals). Following four weeks of treatment, ActRIIB(L79D 25-131)-Fc mice were observed to have increased red blood cell (-15%) and hemoglobin (-13%) levels compared to control (TBS treated) mice, demonstrating
- ActRIIB(L79D 25-131)-Fc increases erythropoietic activity in C57BL/6 mice.
- ruxolitinib treatment resulted in a decrease of red blood cell (-4%) and hemoglobin (-4%) levels compared to control animals.
- ActRIIB(L79D 25-131)-Fc and ruxolitinib conjointly treated mice displayed an increase in red blood cell (-8%) and hemoglobin (-5%) levels compared to control animals.
- ActRIIB antagonists may be useful in alleviating Janus kinase inhibitor induced-anemia in a variety of patient populations including, for example, myelofibrosis patients that have been or are undergoing treatment with one or more Janus kinase inhibitors. Accordingly, ActRIIB antagonists may be useful as part of a conjoint therapy with Janus kinase inhibitors to treat a variety of patient populations including, for example, myelofibrosis patients that have been or are undergoing treatment with one or more Janus kinase inhibitors, particularly those that present anemia.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Cell Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Hematology (AREA)
- Diabetes (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Endocrinology (AREA)
- Biochemistry (AREA)
- Toxicology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Neurology (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Priority Applications (19)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PL17835212.6T PL3490582T3 (pl) | 2016-07-27 | 2017-07-26 | Kompozycje do zastosowania w leczeniu mielofibrozy |
| DK17835212.6T DK3490582T3 (da) | 2016-07-27 | 2017-07-26 | Sammensætninger til anvendelse i behandling af myelofibrose |
| CA3031909A CA3031909A1 (en) | 2016-07-27 | 2017-07-26 | Methods and compositions for treating myelofibrosis |
| SI201731537T SI3490582T1 (sl) | 2016-07-27 | 2017-07-26 | Sestavki za uporabo proti zdravljenju mielofibroze |
| MX2019001043A MX2019001043A (es) | 2016-07-27 | 2017-07-26 | Metodos y composiciones para el tratamiento de la mielofibrosis. |
| SM20240299T SMT202400299T1 (it) | 2016-07-27 | 2017-07-26 | Composizioni per l'uso nel trattamento della mielofibrosi |
| HRP20240974TT HRP20240974T1 (hr) | 2016-07-27 | 2017-07-26 | Pripravci za uporabu u liječenju mijelofibroze |
| RS20240798A RS65735B1 (sr) | 2016-07-27 | 2017-07-26 | Kompozicije za upotrebu u lečenju mijelofibroze |
| EP17835212.6A EP3490582B1 (en) | 2016-07-27 | 2017-07-26 | Compositions for use in treating myelofibrosis |
| FIEP17835212.6T FI3490582T3 (fi) | 2016-07-27 | 2017-07-26 | Koostumuksia käytettäväksi myelofibroosin hoitamisessa |
| LTEPPCT/US2017/043967T LT3490582T (lt) | 2016-07-27 | 2017-07-26 | Kompozicijos, skirtos naudoti gydant mielofibrozę |
| JP2019503972A JP7264580B2 (ja) | 2016-07-27 | 2017-07-26 | 骨髄線維症を処置するための方法および組成物 |
| KR1020197005397A KR20190040972A (ko) | 2016-07-27 | 2017-07-26 | 골섬유증 치료 방법 및 조성물 |
| EA201990226A EA201990226A1 (ru) | 2016-07-27 | 2017-07-26 | Способы и композиции для лечения миелофиброза |
| CN201780057961.8A CN109789184A (zh) | 2016-07-27 | 2017-07-26 | 用于治疗骨髓纤维化的方法和组合物 |
| AU2017302282A AU2017302282B2 (en) | 2016-07-27 | 2017-07-26 | Methods and compositions for treating myelofibrosis |
| BR112019001615-5A BR112019001615A2 (pt) | 2016-07-27 | 2017-07-26 | métodos e composições para tratar mielofibrose |
| ES17835212T ES2984470T3 (es) | 2016-07-27 | 2017-07-26 | Composiciones para su uso en el tratamiento de la mielofibrosis |
| JP2022194095A JP2023014373A (ja) | 2016-07-27 | 2022-12-05 | 骨髄線維症を処置するための方法および組成物 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662367289P | 2016-07-27 | 2016-07-27 | |
| US62/367,289 | 2016-07-27 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018022762A1 true WO2018022762A1 (en) | 2018-02-01 |
Family
ID=61017458
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/043967 Ceased WO2018022762A1 (en) | 2016-07-27 | 2017-07-26 | Methods and compositions for treating myelofibrosis |
Country Status (23)
| Country | Link |
|---|---|
| US (3) | US20180050085A1 (https=) |
| EP (1) | EP3490582B1 (https=) |
| JP (2) | JP7264580B2 (https=) |
| KR (1) | KR20190040972A (https=) |
| CN (1) | CN109789184A (https=) |
| AU (1) | AU2017302282B2 (https=) |
| BR (1) | BR112019001615A2 (https=) |
| CA (1) | CA3031909A1 (https=) |
| DK (1) | DK3490582T3 (https=) |
| EA (1) | EA201990226A1 (https=) |
| ES (1) | ES2984470T3 (https=) |
| FI (1) | FI3490582T3 (https=) |
| HR (1) | HRP20240974T1 (https=) |
| HU (1) | HUE067225T2 (https=) |
| LT (1) | LT3490582T (https=) |
| MA (1) | MA45811A (https=) |
| MX (1) | MX2019001043A (https=) |
| PL (1) | PL3490582T3 (https=) |
| PT (1) | PT3490582T (https=) |
| RS (1) | RS65735B1 (https=) |
| SI (1) | SI3490582T1 (https=) |
| SM (1) | SMT202400299T1 (https=) |
| WO (1) | WO2018022762A1 (https=) |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019217715A1 (en) | 2018-05-09 | 2019-11-14 | Keros Therapeutics, Inc. | Activin receptor type iia variants and methods of use thereof |
| US10548976B2 (en) | 2015-05-20 | 2020-02-04 | Celgene Corporation | In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps |
| EP3638243A4 (en) * | 2017-06-14 | 2021-03-17 | Celgene Corporation | METHOD OF TREATMENT OF MYELOPROLIFERATIVE NEOPLASM ASSOCIATED MYELOFIBROSIS AND ANEMIA |
| US11013785B2 (en) | 2016-11-10 | 2021-05-25 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
| US11484573B2 (en) | 2017-11-09 | 2022-11-01 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| WO2023023345A3 (en) * | 2021-08-19 | 2023-05-11 | Keros Therapeutics, Inc. | Methods of using activin receptor type ii signaling inhibitors |
| WO2023108137A1 (en) * | 2021-12-10 | 2023-06-15 | Biogen Ma Inc. | Modified actriib proteins and methods of use thereof |
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| EP4149441A4 (en) * | 2020-05-15 | 2024-03-13 | Celgene Corporation | METHODS AND COMPOSITIONS FOR TREATING ANEMIA WITH ACTRIIB LIGAND TRAP AND MTOR INHIBITORS |
| US12186370B1 (en) | 2020-11-05 | 2025-01-07 | Celgene Corporation | ACTRIIB ligand trap compositions and uses thereof |
| US12194076B2 (en) | 2016-07-27 | 2025-01-14 | Acceleron Pharma Inc. | Methods and compositions for treating myelofibrosis |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
| US12522646B2 (en) | 2020-03-20 | 2026-01-13 | Keros Therapeutics, Inc. | Activin receptor type II chimeras and methods of use thereof |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10195249B2 (en) | 2012-11-02 | 2019-02-05 | Celgene Corporation | Activin-ActRII antagonists and uses for treating bone and other disorders |
| EP3380121B1 (en) | 2015-11-23 | 2023-12-20 | Acceleron Pharma Inc. | Actrii antagonist for use in treating eye disorders |
| EP4041243A4 (en) * | 2019-09-27 | 2023-10-18 | Disc Medicine, Inc. | METHODS OF TREATMENT OF ANEMIA OF CHRONIC DISEASE |
| US20220372135A1 (en) * | 2019-09-27 | 2022-11-24 | Disc Medicine, Inc. | Methods for treating myelofibrosis and related conditions |
| US12441707B2 (en) | 2019-12-30 | 2025-10-14 | Tyra Biosciences, Inc. | Indazole compounds |
| US20230181690A1 (en) * | 2020-04-13 | 2023-06-15 | Celgene Corporation | Methods for treating anemia using an actriib ligand trap and fedratinib |
| KR20230012539A (ko) | 2020-05-13 | 2023-01-26 | 디스크 메디슨, 인크. | 골수섬유증을 치료하기 위한 항-헤모주벨린 (hjv) 항체 |
| WO2025184284A1 (en) * | 2024-02-27 | 2025-09-04 | Keros Therapeutics, Inc. | Methods of using activin receptor type ii signaling inhibitors |
Citations (68)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| US5096815A (en) | 1989-01-06 | 1992-03-17 | Protein Engineering Corporation | Generation and selection of novel dna-binding proteins and polypeptides |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5270163A (en) | 1990-06-11 | 1993-12-14 | University Research Corporation | Methods for identifying nucleic acid ligands |
| US5283317A (en) | 1987-08-03 | 1994-02-01 | Ddi Pharmaceuticals, Inc. | Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols |
| US5475096A (en) | 1990-06-11 | 1995-12-12 | University Research Corporation | Nucleic acid ligands |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5525490A (en) | 1994-03-29 | 1996-06-11 | Onyx Pharmaceuticals, Inc. | Reverse two-hybrid method |
| WO1996026432A1 (en) | 1995-02-23 | 1996-08-29 | University Of Utah Research Foundation | Composite waveguide for solid phase binding assays |
| US5567588A (en) | 1990-06-11 | 1996-10-22 | University Research Corporation | Systematic evolution of ligands by exponential enrichment: Solution SELEX |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5580737A (en) | 1990-06-11 | 1996-12-03 | Nexstar Pharmaceuticals, Inc. | High-affinity nucleic acid ligands that discriminate between theophylline and caffeine |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| US5677196A (en) | 1993-05-18 | 1997-10-14 | University Of Utah Research Foundation | Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays |
| US5707796A (en) | 1990-06-11 | 1998-01-13 | Nexstar Pharmaceuticals, Inc. | Method for selecting nucleic acids on the basis of structure |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5763177A (en) | 1990-06-11 | 1998-06-09 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: photoselection of nucleic acid ligands and solution selex |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5955280A (en) | 1995-04-11 | 1999-09-21 | The General Hospital Corporation | Reverse two-hybrid system |
| US6011577A (en) | 1997-06-30 | 2000-01-04 | Polaroid Corporation | Modular optical print head assembly |
| WO2000000823A1 (en) | 1998-06-26 | 2000-01-06 | Sunesis Pharmaceuticals, Inc. | Methods for rapidly identifying small organic ligands |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO2000039585A1 (en) | 1998-12-28 | 2000-07-06 | Sunesis Pharmaceuticals, Inc. | Identifying small organic molecule ligands for binding |
| WO2000043781A2 (en) | 1999-01-21 | 2000-07-27 | Metamorphix, Inc. | Growth differentiation factor inhibitors and uses therefor |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| US6537966B1 (en) | 1997-08-29 | 2003-03-25 | Human Genome Sciences, Inc. | Follistatin-3 |
| US6699843B2 (en) | 1995-06-07 | 2004-03-02 | Gilead Sciences, Inc. | Method for treatment of tumors using nucleic acid ligands to PDGF |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2005025601A1 (en) | 2003-09-15 | 2005-03-24 | Monash University | Follistatin isoforms and uses thereof |
| US20050079574A1 (en) | 2003-01-16 | 2005-04-14 | Genentech, Inc. | Synthetic antibody phage libraries |
| US20050119455A1 (en) | 2002-06-03 | 2005-06-02 | Genentech, Inc. | Synthetic antibody phage libraries |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| US20050266000A1 (en) | 2004-04-09 | 2005-12-01 | Genentech, Inc. | Variable domain library and uses |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US20060025576A1 (en) | 2000-04-11 | 2006-02-02 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| WO2006012627A2 (en) | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US7026283B2 (en) | 1996-12-13 | 2006-04-11 | Beth Israel Deaconess Medical Center, Inc. | Calcium-independent negative regulation by CD81 of receptor signalling |
| US7041870B2 (en) | 2000-11-30 | 2006-05-09 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| US20060148748A1 (en) | 1999-07-29 | 2006-07-06 | Gilead Sciences, Inc. | Nucleic acid ligands which bind to hepatocyte growth factor/scatter factor (HGF/SF) or its receptor c-met |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| US7189826B2 (en) | 1997-11-24 | 2007-03-13 | Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
| US20070061900A1 (en) | 2000-10-31 | 2007-03-15 | Murphy Andrew J | Methods of modifying eukaryotic cells |
| WO2007053775A1 (en) | 2005-11-01 | 2007-05-10 | Amgen Inc. | Novel activin receptor and uses thereof |
| US20070117126A1 (en) | 1999-12-15 | 2007-05-24 | Genentech, Inc. | Shotgun scanning |
| US20070160598A1 (en) | 2005-11-07 | 2007-07-12 | Dennis Mark S | Binding polypeptides with diversified and consensus vh/vl hypervariable sequences |
| US20070237764A1 (en) | 2005-12-02 | 2007-10-11 | Genentech, Inc. | Binding polypeptides with restricted diversity sequences |
| US20070292936A1 (en) | 2006-05-09 | 2007-12-20 | Genentech, Inc. | Binding polypeptides with optimized scaffolds |
| WO2008030367A2 (en) | 2006-09-01 | 2008-03-13 | The General Hospital Corporation | Selective myostatin inhibitors |
| WO2008097541A2 (en) | 2007-02-02 | 2008-08-14 | Acceleron Pharma Inc. | Variants derived from actriib and uses therefor |
| US20090002360A1 (en) | 2007-05-25 | 2009-01-01 | Innolux Display Corp. | Liquid crystal display device and method for driving same |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| US7612041B2 (en) | 2005-11-23 | 2009-11-03 | Acceleron Pharma Inc. | Isolated activin-binding ActRIIa polypeptide comprising the SEQ ID NO: 7 and uses for promoting bone growth |
| WO2015143403A1 (en) * | 2014-03-21 | 2015-09-24 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating ineffective erythropoiesis by inhibiting activin b and/or gdf11 |
| WO2015192111A1 (en) * | 2014-06-13 | 2015-12-17 | Acceleron Pharma, Inc. | Methods and compositions for treating ulcers |
| WO2017079591A2 (en) * | 2015-11-04 | 2017-05-11 | Acceleron Pharma Inc. | Methods for increasing red blood cell levels and treating ineffective erythropoiesis |
Family Cites Families (40)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0548276A4 (en) | 1990-09-13 | 1993-12-29 | Children's Hospital Medical Center Of Northern California | Method for increasing red blood cell production by treatment with activin or activin-related peptides |
| US5288931A (en) * | 1991-12-06 | 1994-02-22 | Genentech, Inc. | Method for refolding insoluble, misfolded insulin-like growth factor-I into an active conformation |
| US5885574A (en) | 1994-07-26 | 1999-03-23 | Amgen Inc. | Antibodies which activate an erythropoietin receptor |
| US6953662B2 (en) | 1997-08-29 | 2005-10-11 | Human Genome Sciences, Inc. | Follistatin-3 |
| GB9912350D0 (en) * | 1999-05-26 | 1999-07-28 | European Molecular Biology Lab Embl | Modified cytokine |
| BR0307871A (pt) | 2002-02-21 | 2005-04-12 | Wyeth Corp | Proteìnas contendo domìnio de folistatina |
| CN1713905A (zh) | 2002-10-15 | 2005-12-28 | 细胞基因公司 | 用于治疗骨髓增生异常综合征的选择性细胞因子抑制药 |
| US20040223966A1 (en) | 2002-10-25 | 2004-11-11 | Wolfman Neil M. | ActRIIB fusion polypeptides and uses therefor |
| WO2005028517A2 (en) | 2003-05-09 | 2005-03-31 | The General Hospital Corporation | SOLUBLE TGF-β TYPE III RECEPTOR FUSION PROTEINS |
| AU2005272646A1 (en) | 2004-08-12 | 2006-02-23 | Wyeth | Combination therapy for diabetes, obesity, and cardiovascular diseases using GDF-8 inhibitors |
| US7879569B2 (en) | 2004-11-09 | 2011-02-01 | The Trustees Of The University Of Pennsylvania | Methods for diagnosis of myelodysplastic syndromes (MDS) |
| US20100003190A1 (en) | 2006-12-08 | 2010-01-07 | Caritas St. Elizabeth's Medical Center Of Boston, Inc. | Method for protecting renal tubular epithelial cells from radiocontrast nephropathy (RCN) |
| US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| AU2013221910B2 (en) | 2006-12-18 | 2016-11-17 | Acceleron Pharma Inc. | Activin-ActRII antagonists and uses for increasing red blood cell levels |
| US20100028332A1 (en) | 2006-12-18 | 2010-02-04 | Acceleron Pharma Inc. | Antagonists of actriib and uses for increasing red blood cell levels |
| CN104524548A (zh) | 2006-12-18 | 2015-04-22 | 阿塞勒隆制药公司 | 活化素-actrii拮抗剂及在提高红细胞水平中的用途 |
| MX2009008222A (es) | 2007-02-01 | 2009-10-12 | Acceleron Pharma Inc | Antagonistas de activina-actriia y usos para tratar o prevenir cancer de mama. |
| CN102131822A (zh) | 2008-06-26 | 2011-07-20 | 阿塞勒隆制药公司 | 进行激活素-ActRIIa拮抗剂给药和监测受治疗患者的方法 |
| DK2318028T3 (da) | 2008-06-26 | 2020-05-04 | Acceleron Pharma Inc | Antagonister af opløselig activin-aktriia og anvendelser til øgning af røde blodcelleniveauer |
| US8216997B2 (en) | 2008-08-14 | 2012-07-10 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators |
| TW201803586A (zh) | 2008-08-14 | 2018-02-01 | 艾瑟勒朗法瑪公司 | 使用gdf阱以增加紅血球水平 |
| AU2010282361B2 (en) * | 2009-08-13 | 2015-03-19 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| WO2012027065A2 (en) * | 2010-08-27 | 2012-03-01 | Celgene Corporation | Combination therapy for treatment of disease |
| AU2010363329A1 (en) | 2010-11-07 | 2013-05-09 | Targegen, Inc. | Compositions and methods for treating myelofibrosis |
| JP6472999B2 (ja) | 2011-07-01 | 2019-02-20 | ノバルティス アーゲー | 代謝障害を治療するための方法 |
| KR20140084211A (ko) | 2011-10-17 | 2014-07-04 | 악셀레론 파마 인코포레이티드 | 효과가 없는 적혈구생성 치료를 위한 방법 및 조성물 |
| CN104968801B (zh) | 2012-10-24 | 2021-06-15 | 细胞基因公司 | 用于治疗贫血症的生物标志物 |
| HK1214504A1 (zh) | 2012-10-24 | 2016-07-29 | 细胞基因公司 | 用於治療貧血的方法 |
| AU2014212014A1 (en) | 2013-02-01 | 2015-08-27 | Amgen Inc. | Administration of an anti-activin-A compound to a subject |
| WO2015081127A2 (en) | 2013-11-26 | 2015-06-04 | Gilead Sciences, Inc. | Therapies for treating myeloproliferative disorders |
| EP3808778A1 (en) | 2014-04-18 | 2021-04-21 | Acceleron Pharma Inc. | Methods for increasing red blood cell levels and treating sickle-cell disease |
| JP2018501307A (ja) | 2014-12-03 | 2018-01-18 | セルジーン コーポレイション | アクチビン−ActRIIアンタゴニスト及び貧血を治療するための使用 |
| MA41119A (fr) | 2014-12-03 | 2017-10-10 | Acceleron Pharma Inc | Méthodes de traitement de syndromes myélodysplasiques et d'anémie sidéroblastique |
| CA2983440C (en) | 2015-04-22 | 2024-03-12 | Alivegen Usa Inc. | Novel hybrid actriib ligand trap proteins for treating muscle wasting diseases |
| US20180125928A1 (en) | 2015-05-13 | 2018-05-10 | Celgene Corporation | Treatment of beta-thalassemia using actrii ligand traps |
| CN108348578B (zh) | 2015-08-04 | 2022-08-09 | 阿塞勒隆制药公司 | 用于治疗骨髓增生性病症的方法 |
| EP3380121B1 (en) | 2015-11-23 | 2023-12-20 | Acceleron Pharma Inc. | Actrii antagonist for use in treating eye disorders |
| DK3496739T3 (da) | 2016-07-15 | 2021-05-10 | Acceleron Pharma Inc | Sammensætninger omfattende actriia-polypeptider til brug i behandlingen af pulmonal hypertension |
| MA45811A (fr) | 2016-07-27 | 2019-06-05 | Acceleron Pharma Inc | Méthodes et compositions de traitement de maladie. |
| PL3638243T3 (pl) * | 2017-06-14 | 2025-02-10 | Celgene Corporation | Sposoby leczenia mielofibrozy związanej z nowotworem mieloproliferacyjnym i niedokrwistości |
-
2017
- 2017-07-26 MA MA045811A patent/MA45811A/fr unknown
- 2017-07-26 EP EP17835212.6A patent/EP3490582B1/en active Active
- 2017-07-26 BR BR112019001615-5A patent/BR112019001615A2/pt unknown
- 2017-07-26 LT LTEPPCT/US2017/043967T patent/LT3490582T/lt unknown
- 2017-07-26 PT PT178352126T patent/PT3490582T/pt unknown
- 2017-07-26 PL PL17835212.6T patent/PL3490582T3/pl unknown
- 2017-07-26 HR HRP20240974TT patent/HRP20240974T1/hr unknown
- 2017-07-26 FI FIEP17835212.6T patent/FI3490582T3/fi active
- 2017-07-26 SI SI201731537T patent/SI3490582T1/sl unknown
- 2017-07-26 WO PCT/US2017/043967 patent/WO2018022762A1/en not_active Ceased
- 2017-07-26 SM SM20240299T patent/SMT202400299T1/it unknown
- 2017-07-26 JP JP2019503972A patent/JP7264580B2/ja active Active
- 2017-07-26 ES ES17835212T patent/ES2984470T3/es active Active
- 2017-07-26 AU AU2017302282A patent/AU2017302282B2/en active Active
- 2017-07-26 RS RS20240798A patent/RS65735B1/sr unknown
- 2017-07-26 CN CN201780057961.8A patent/CN109789184A/zh active Pending
- 2017-07-26 DK DK17835212.6T patent/DK3490582T3/da active
- 2017-07-26 MX MX2019001043A patent/MX2019001043A/es unknown
- 2017-07-26 HU HUE17835212A patent/HUE067225T2/hu unknown
- 2017-07-26 EA EA201990226A patent/EA201990226A1/ru unknown
- 2017-07-26 KR KR1020197005397A patent/KR20190040972A/ko not_active Ceased
- 2017-07-26 CA CA3031909A patent/CA3031909A1/en active Pending
- 2017-07-26 US US15/660,421 patent/US20180050085A1/en not_active Abandoned
-
2021
- 2021-03-23 US US17/210,037 patent/US12194076B2/en active Active
-
2022
- 2022-12-05 JP JP2022194095A patent/JP2023014373A/ja active Pending
-
2024
- 2024-12-06 US US18/971,571 patent/US20250222069A1/en active Pending
Patent Citations (72)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5283317A (en) | 1987-08-03 | 1994-02-01 | Ddi Pharmaceuticals, Inc. | Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
| US5096815A (en) | 1989-01-06 | 1992-03-17 | Protein Engineering Corporation | Generation and selection of novel dna-binding proteins and polypeptides |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5270163A (en) | 1990-06-11 | 1993-12-14 | University Research Corporation | Methods for identifying nucleic acid ligands |
| US5707796A (en) | 1990-06-11 | 1998-01-13 | Nexstar Pharmaceuticals, Inc. | Method for selecting nucleic acids on the basis of structure |
| US5475096A (en) | 1990-06-11 | 1995-12-12 | University Research Corporation | Nucleic acid ligands |
| US5567588A (en) | 1990-06-11 | 1996-10-22 | University Research Corporation | Systematic evolution of ligands by exponential enrichment: Solution SELEX |
| US5580737A (en) | 1990-06-11 | 1996-12-03 | Nexstar Pharmaceuticals, Inc. | High-affinity nucleic acid ligands that discriminate between theophylline and caffeine |
| US5763177A (en) | 1990-06-11 | 1998-06-09 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: photoselection of nucleic acid ligands and solution selex |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5677196A (en) | 1993-05-18 | 1997-10-14 | University Of Utah Research Foundation | Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays |
| US5525490A (en) | 1994-03-29 | 1996-06-11 | Onyx Pharmaceuticals, Inc. | Reverse two-hybrid method |
| WO1996026432A1 (en) | 1995-02-23 | 1996-08-29 | University Of Utah Research Foundation | Composite waveguide for solid phase binding assays |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5955280A (en) | 1995-04-11 | 1999-09-21 | The General Hospital Corporation | Reverse two-hybrid system |
| US5965368A (en) | 1995-04-11 | 1999-10-12 | The General Hospital Corporation | Reverse two-hybrid systems |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6699843B2 (en) | 1995-06-07 | 2004-03-02 | Gilead Sciences, Inc. | Method for treatment of tumors using nucleic acid ligands to PDGF |
| US7026283B2 (en) | 1996-12-13 | 2006-04-11 | Beth Israel Deaconess Medical Center, Inc. | Calcium-independent negative regulation by CD81 of receptor signalling |
| US6011577A (en) | 1997-06-30 | 2000-01-04 | Polaroid Corporation | Modular optical print head assembly |
| US6537966B1 (en) | 1997-08-29 | 2003-03-25 | Human Genome Sciences, Inc. | Follistatin-3 |
| US7189826B2 (en) | 1997-11-24 | 2007-03-13 | Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| WO2000000823A1 (en) | 1998-06-26 | 2000-01-06 | Sunesis Pharmaceuticals, Inc. | Methods for rapidly identifying small organic ligands |
| WO2000039585A1 (en) | 1998-12-28 | 2000-07-06 | Sunesis Pharmaceuticals, Inc. | Identifying small organic molecule ligands for binding |
| US7332581B2 (en) | 1999-01-15 | 2008-02-19 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2000043781A2 (en) | 1999-01-21 | 2000-07-27 | Metamorphix, Inc. | Growth differentiation factor inhibitors and uses therefor |
| US20060148748A1 (en) | 1999-07-29 | 2006-07-06 | Gilead Sciences, Inc. | Nucleic acid ligands which bind to hepatocyte growth factor/scatter factor (HGF/SF) or its receptor c-met |
| US20070117126A1 (en) | 1999-12-15 | 2007-05-24 | Genentech, Inc. | Shotgun scanning |
| US20060025576A1 (en) | 2000-04-11 | 2006-02-02 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| US20070061900A1 (en) | 2000-10-31 | 2007-03-15 | Murphy Andrew J | Methods of modifying eukaryotic cells |
| US7041870B2 (en) | 2000-11-30 | 2006-05-09 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| US20050119455A1 (en) | 2002-06-03 | 2005-06-02 | Genentech, Inc. | Synthetic antibody phage libraries |
| US20050079574A1 (en) | 2003-01-16 | 2005-04-14 | Genentech, Inc. | Synthetic antibody phage libraries |
| WO2005025601A1 (en) | 2003-09-15 | 2005-03-24 | Monash University | Follistatin isoforms and uses thereof |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| US20050266000A1 (en) | 2004-04-09 | 2005-12-01 | Genentech, Inc. | Variable domain library and uses |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| WO2006012627A2 (en) | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| US7709605B2 (en) | 2004-07-23 | 2010-05-04 | Acceleron Pharma Inc. | ActRII receptor polypeptides, methods and compositions |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| WO2007053775A1 (en) | 2005-11-01 | 2007-05-10 | Amgen Inc. | Novel activin receptor and uses thereof |
| US20070160598A1 (en) | 2005-11-07 | 2007-07-12 | Dennis Mark S | Binding polypeptides with diversified and consensus vh/vl hypervariable sequences |
| US7612041B2 (en) | 2005-11-23 | 2009-11-03 | Acceleron Pharma Inc. | Isolated activin-binding ActRIIa polypeptide comprising the SEQ ID NO: 7 and uses for promoting bone growth |
| US20070237764A1 (en) | 2005-12-02 | 2007-10-11 | Genentech, Inc. | Binding polypeptides with restricted diversity sequences |
| US20070292936A1 (en) | 2006-05-09 | 2007-12-20 | Genentech, Inc. | Binding polypeptides with optimized scaffolds |
| WO2008030367A2 (en) | 2006-09-01 | 2008-03-13 | The General Hospital Corporation | Selective myostatin inhibitors |
| WO2008097541A2 (en) | 2007-02-02 | 2008-08-14 | Acceleron Pharma Inc. | Variants derived from actriib and uses therefor |
| US7842663B2 (en) | 2007-02-02 | 2010-11-30 | Acceleron Pharma Inc. | Variants derived from ActRIIB and uses therefor |
| US20090002360A1 (en) | 2007-05-25 | 2009-01-01 | Innolux Display Corp. | Liquid crystal display device and method for driving same |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2015143403A1 (en) * | 2014-03-21 | 2015-09-24 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating ineffective erythropoiesis by inhibiting activin b and/or gdf11 |
| WO2015192111A1 (en) * | 2014-06-13 | 2015-12-17 | Acceleron Pharma, Inc. | Methods and compositions for treating ulcers |
| WO2017079591A2 (en) * | 2015-11-04 | 2017-05-11 | Acceleron Pharma Inc. | Methods for increasing red blood cell levels and treating ineffective erythropoiesis |
Non-Patent Citations (175)
| Title |
|---|
| " Myelofibrosis:Biology and treatment options", EUROPEAN JOURNAL OF HAEMATOLOGY, vol. 79, 2007, pages 13 - 17 |
| "Uniprot", Database accession no. P01859 |
| AGNEW, CHEM INTL. ED. ENGL, vol. 33, 1994, pages 183 - 186 |
| ALLENDORPH ET AL., PNAS, vol. 103, no. 20, 2006, pages 7643 - 7648 |
| ALMAGRO, FRANSSON, FRONT. BIOSCI, vol. 13, 2008, pages 1619 - 1633 |
| ASHMORE ET AL., GROWTH, vol. 38, 1974, pages 501 - 507 |
| ATTISANO ET AL., CELL, vol. 68, no. 1, 1992, pages 97 - 108 |
| BACA ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684 |
| BALINT ET AL., GENE, vol. 137, 1993, pages 109 - 118 |
| BAROSI ET AL., EXPERT OPIN PHARMACOTHER, vol. 12, no. 10, 2011, pages 1597 - 1611 |
| BAROSI G ET AL., LEUKEMIA, vol. 22, 2008, pages 437 - 438 |
| BARTEL ET AL., BIOTECHNIQUES, vol. 14, 1993, pages 920 - 924 |
| BAXTER ET AL., LANCET, vol. 365, 2005, pages 1054 - 1061 |
| BOERNER ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 |
| BRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42 |
| BROWN ET AL., GROWTH FACTORS, vol. 3, 1990, pages 35 - 43 |
| BROWN ET AL., MOL. CELL BIOL, vol. 12, 1992, pages 2644 - 2652 |
| BRUGGEMANN, M ET AL., J. EXP. MED., vol. 166, 1987, pages 1351 - 1361 |
| BUNN, N ENGL J MED, vol. 346, no. 7, 2002, pages 522 - 523 |
| CAO ET AL., PEDIATR REP, vol. 3, no. 2, 2011, pages 17 |
| CARBUCCIA NET, LEUKEMIA, vol. 23, 2009, pages 2183 - 2186 |
| CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285 |
| CERVANTES F ET AL., BLOOD, vol. 113, 2009, pages 2895 - 2901 |
| CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881 |
| CHOWDHURY, METHODS MOL. BIOL, vol. 207, 2008, pages 179 - 196 |
| CLYNES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656 |
| COONEY ET AL., SCIENCE, vol. 241, 1988, pages 456 |
| CRAGG, M. S ET AL., BLOOD, vol. 102, 2003, pages 2670 - 2677 |
| CRAGG, M. SM. J. GLENNIE, BLOOD, vol. 103, 2004, pages 2738 - 2743 |
| CUNNINGHAM ET AL., SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| CWIRLA ET AL., PNAS USA, vol. 87, 1990, pages 6378 - 6382 |
| DALL'ACQUA ET AL., METHODS, vol. 36, 2005, pages 61 - 68 |
| DELANTY ET AL., NEUROLOGY, vol. 49, 1997, pages 686 - 689 |
| DELHOMMEAU F ET AL., N ENGL J MED, vol. 360, 2009, pages 2289 - 2301 |
| DENNLER ET AL., EMBO, vol. 17, 1998, pages 3091 - 3100 |
| DEPAOLO ET AL., PROC SOC EP BIOL MED, vol. 198, 1991, pages 500 - 512 |
| DERVAN ET AL., SCIENCE, vol. 251, 1991, pages 1300 |
| DONZEET ET AL., NUCLEIC ACIDS RES, vol. 30, 2002, pages e46 |
| DYSON ET AL., CURR BIOL, vol. 7, 1997, pages 81 - 84 |
| ERNST T ET AL., NAT GENET., vol. 42, pages 722 - 726 |
| FAORO ET AL., EUR J HAEMATOL, vol. 74, no. 2, 2005, pages 117 - 120 |
| FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472 |
| FLATMAN ET AL., J. CHROMATOGR. B, vol. 848, 2007, pages 79 - 87 |
| FRALEY ET AL., TRENDS BIOCHEM. SCI, vol. 6, 1981, pages 77 |
| GALANELLO ET AL., ANN NY ACAD SCI, vol. 1202, 2010, pages 79 - 86 |
| GAMER ET AL., DEV BIOL, vol. 208, 1999, pages 222 - 32 |
| GAMER ET AL., DEV BIOL, vol. 229, 2001, pages 407 - 20 |
| GAMER, DEV. BIOL, vol. 208, 1999, pages 222 - 232 |
| GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163 |
| GOEDDEL: "Gene Expression Technology: Methods in Enzymology", 1990, ACADEMIC PRESS |
| GONZALEZ-CADAVID, PNAS, vol. 95, 1998, pages 14938 - 43 |
| GREEN A ET AL., N ENGL J MED, vol. 362, 2010, pages 369 - 370 |
| GREENER ET AL., STRATEGIES IN MOL BIOL, vol. 7, 1994, pages 32 - 34 |
| GREENWALD ET AL., NAT STRUCT BIOL, vol. 6, 1999, pages 18 - 22 |
| GREENWALD ET AL., NATURE STRUCTURAL BIOLOGY, vol. 6, no. 1, 1999, pages 18 - 22 |
| GRIFFITHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734 |
| GROBET ET AL., NAT GENET, vol. 17, no. 1, 1997, pages 71 - 4 |
| GRODBERG ET AL., EUR. J. BIOCHEM., vol. 218, 1993, pages 597 - 601 |
| GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368 |
| GUSTIN ET AL., VIROLOGY, vol. 193, 1993, pages 653 - 660 |
| HELLSTROM, I ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502 |
| HELLSTROM, I ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063 |
| HILDEN ET AL., BLOOD, vol. 83, no. 8, 1994, pages 2163 - 2170 |
| HINCK, FEBS LETT, vol. 586, 2012, pages 1860 - 1870 |
| HOCHULI ET AL., J. CHROMATOGRAPHY, vol. 411, 1987, pages 177 |
| HOHJOH, FEBS LETT, vol. 521, 2002, pages 195 - 199 |
| HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOM ET AL., METHODS IN MOLECULAR BIOLOGY, vol. 178, 2001, pages 1 - 37 |
| HOOGENBOOM ET AL.: "Methods in Molecular Biology", vol. 244, 1989, pages: 1081 - 1085 |
| HOOGENBOOMWINTER, J. MOL. BIOL., vol. 227, 1992, pages 381 - 388 |
| HUDSON ET AL., NAT. MED, vol. 9, 2003, pages 129 - 134 |
| HUSSEIN ET AL., BLOOD, vol. 115, 2010, pages 1703 - 1708 |
| HUSSEIN ET AL., EUR J HAEMATOL, vol. 82, 2009, pages 329 - 338 |
| IKE ET AL., NUCLEIC ACID RES., 1983, pages 477 |
| ITAKURA ET AL., SCIENCE, vol. 198, 1984, pages 1056 |
| ITAKURA: "Proc. 3rd Cleveland Sympos. Macromolecules", 1981, ELSEVIER, article "Recombinant DNA", pages: 273 - 289 |
| IWABUCHI ET AL., ONCOGENE, vol. 8, 1993, pages 1693 - 1696 |
| JACOBS ET AL., NEPHROL DIAL TRANSPLANT, vol. 15, 2000, pages 51 - 56 |
| JAKOBY WB ET AL., METHODS IN ENZYMOLOGY, vol. 46, 1974, pages 1 |
| JAMES C ET AL., NATURE, vol. 434, 2005, pages 1144 - 1148 |
| JANKNECHT ET AL., PNAS USA, vol. 88, 1991, pages 8972 |
| KALINOWSKI ET AL., PHARMACOL REV, vol. 57, 2005, pages 547 - 583 |
| KAMBADUR ET AL., GENOME RES, vol. 7, 1997, pages 910 - 915 |
| KLIMKA ET AL., BR. J. CANCER, vol. 83, 2000, pages 252 - 260 |
| KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553 |
| KOZBAR ET AL.: "4", IMMUNOLOGY TODAY, 1983, pages 72 |
| KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001 |
| KRALOVICS ET AL., N ENGLJMED, vol. 352, 2005, pages 1779 - 1790 |
| KVASNICKA ET AL., AM J HEMATOL, vol. 85, 2010, pages 62 - 69 |
| LASHO ET AL., BLOOD, vol. 120, 2012, pages 4168 - 4171 |
| LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132 |
| LEEMCPHERRON, PROC. NATL. ACAD. SCI. USA, vol. 98, 2001, pages 9306 - 9311 |
| LEUNG ET AL., METHOD CELL MOL BIOL, vol. 1, 1989, pages 11 - 19 |
| LEVINE ET AL., CANCER CELL, vol. 7, 2005, pages 387 - 397 |
| LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 3557 - 3562 |
| LONBERG, CURR. OPIN. IMMUNOL, vol. 20, pages 450 - 459 |
| LONBERG, NAT. BIOTECH, vol. 23, 2005, pages 1117 - 1125 |
| LOWMAN ET AL., BIOCHEMISTRY, vol. 30, 1991, pages 10832 - 10838 |
| MADURA ET AL., J BIOL CHEM, vol. 268, 1993, pages 12046 - 12054 |
| MANNINO ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 682 |
| MANOHARAN ET AL., BR J HAEMATOL, vol. 43, 1979, pages 185 - 190 |
| MARTINEZ-TRILLOS ET AL., ANN HEMATOL, vol. 89, no. 12, 2010, pages 1233 - 1237 |
| MASCARENHAS ET AL., CURR MED CHEM, vol. 19, 2012, pages 4399 - 4413 |
| MASCARENHAS ET AL., HAEMATOLOGICA, vol. 98, no. 10, 2013, pages 1499 - 1509 |
| MASSAGUE, NAT. REV. MOL. CELL BIOL, vol. 1, 2000, pages 169 - 178 |
| MATHEWSVALE, CELL, vol. 65, 1991, pages 973 - 982 |
| MCCAFFERTY ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| MCKNIGHT ET AL., SCIENCE, vol. 232, 1982, pages 316 |
| MCPHERRON ET AL., NAT. GENET, vol. 22, 1999, pages 260 - 264 |
| MCPHERRON ET AL., NATURE, vol. 387, 1997, pages 83 - 90 |
| MCPHERRONLEE, PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 12457 - 12461 |
| MEYERS ET AL., SCIENCE, vol. 232, 1986, pages 613 |
| MILSTEINCUELLO, NATURE, vol. 305, 1983, pages 537 |
| MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855 |
| MURATA ET AL., PNAS, vol. 85, 1988, pages 2434 |
| NAGASHIMA ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 2888 - 2892 |
| NAKASHIMA ET AL., MECH. DEV, vol. 80, 1999, pages 185 - 189 |
| NARANG, SA, TETRAHEDRON, vol. 39, 1983, pages 3 |
| NEURON, vol. 37, 2003, pages 197 - 207 |
| O'CONNOR, J. NEUROCHEM, vol. 56, 1991, pages 560 |
| OH ET AL., GENES DEV, vol. 16, 2002, pages 2749 - 54 |
| PADDISON ET AL., GENES & DEV, vol. 16, 2002, pages 948 - 958 |
| PADLAN, MOL. IMMUNOL, vol. 28, 1991, pages 489 - 498 |
| PATNAIK ET AL., EUR J HAEMATOL, vol. 84, 2010, pages 105 - 108 |
| PETKOVA, S. B ET AL., INTL. IMMUNOL, vol. 18, no. 12, 2006, pages 1759 - 1769 |
| PIKMAN Y ET AL., PLOS MED, vol. 3, 2006, pages e270 |
| PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599 |
| PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623 |
| QUEEN ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 86, 1989, pages 10029 - 10033 |
| QUINTAS-CARDAMA ET AL., NAT REV DRUG DISCOV, vol. 10, 2011, pages 127 - 140 |
| RAVETCHKINET, ANNU. REV. IMMUNOL, vol. 9, 1991, pages 457 - 492 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329 |
| ROBERTS ET AL., PNAS USA, vol. 89, 1992, pages 2429 - 2433 |
| ROSOK ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 22611 - 22618 |
| RUF, BIOCHEMISTRY, vol. 33, 1994, pages 1565 - 1572 |
| SCHUELKE ET AL., N ENGL J MED, vol. 350, 2004, pages 2682 - 8 |
| SCOTT ET AL., SCIENCE, vol. 249, 1990, pages 404 - 406 |
| SCOTT L M ET AL., N ENGL J MED, vol. 356, 2007, pages 459 - 468 |
| SIDHU ET AL., J. MOL. BIOL., vol. 340, no. 5, 2004, pages 1073 - 1093 |
| SINGIBARTI, J. CLIN INVESTIG, vol. 72, 1994, pages S36 - S43 |
| STENGELMANN F. ET AL.: "Database Biosis", 3 December 2015, BIOSCIENCES INFORMATION SERVICE |
| SWATLANDKIEFFER, J. ANIM. SCI, vol. 38, 1994, pages 752 - 757 |
| TEFFERI A ET AL., BLOOD, vol. 110, 2007, pages 1092 - 1097 |
| TEFFERI A ET AL., LEUKEMIA, vol. 24, 2010, pages 1290 - 1298 |
| TEFFERI A, BLOOD, vol. 117, no. 13, 2011, pages 3949 - 3504 |
| TEFFERI A, N ENGL J MED, vol. 342, 2000, pages 1255 - 1265 |
| TEFFERI ET AL., AM J HEMATOL, vol. 85, 2009, pages 14 - 17 |
| TEFFERI ET AL., LEUKEMIA, 2014 |
| TEFFERI ET AL., LEUKEMIA, vol. 21, no. 8, 2007, pages 1827 - 1828 |
| TEFFERI ET AL., LEUKEMIA, vol. 26, 2012, pages 475 - 480 |
| TEFFERI, AYALEW, AM. J. HEMATOL, vol. 89, 2014, pages 916 - 925 |
| THAPALIYA ET AL., AM JHEMATOL, vol. 86, no. 1, 2011, pages 86 - 98 |
| THIELE ET AL., HAEMATOLOGICA, vol. 90, 2005, pages 1128 - 1132 |
| THOMPSON ET AL., THE EMBO JOURNAL, vol. 22, no. 7, 2003, pages 1555 - 1566 |
| TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 |
| VANNUCCHI, HEMATOL AM SOC HEMATOL EDUC PROG 2011, 2011, pages 222 - 230 |
| VIDALLEGRAIN, NUCLEIC ACIDS RES, vol. 27, 1999, pages 919 - 29 |
| VIDALLEGRAIN, TRENDS BIOTECHNOL, vol. 17, 1999, pages 374 - 81 |
| VOLLMERSBRANDLEIN, HISTOL. HISTOPATHOL, vol. 20, no. 3, 2005, pages 927 - 937 |
| VOLLMERSBRANDLEIN, METHODS FIND EXP. CLIN. PHARMACOL, vol. 27, no. 3, 2005, pages 185 - 91 |
| WAGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 290, 1981, pages 1441 - 1445 |
| WAKEFIELD ET AL., J. BIOL. CHEM., vol. 263, 1988, pages 7646 - 7654 |
| WANG ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 3095 - 3099 |
| WINKEL, CURR. OPIN. PHARMACOL, vol. 5, 2001, pages 368 - 74 |
| WINTER ET AL., ANN. REV. IMMUNOL, vol. 113, 1994, pages 433 - 455 |
| WOODRUFF, BIOCHEM PHARMACOL, vol. 55, 1998, pages 953 - 963 |
| WYNN ET AL., J CLIN INVEST, vol. 117, 2007, pages 524 - 529 |
| XING ET AL., BLOOD, vol. 111, 2008, pages 5109 - 5117 |
| YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 797 |
| YAMASHITA ET AL., J. CELL BIOL., vol. 130, 1995, pages 217 - 226 |
| YANG ET AL., PROC NATL ACAD SCI USA, vol. 99, 2002, pages 6047 - 6052 |
| YEOWHITMAN, MOL. CELL, vol. 7, 2001, pages 949 - 957 |
| ZERVOS ET AL., CELL, vol. 72, 1993, pages 223 - 232 |
Cited By (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
| US10548976B2 (en) | 2015-05-20 | 2020-02-04 | Celgene Corporation | In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps |
| US12194076B2 (en) | 2016-07-27 | 2025-01-14 | Acceleron Pharma Inc. | Methods and compositions for treating myelofibrosis |
| US11013785B2 (en) | 2016-11-10 | 2021-05-25 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US11090361B2 (en) | 2016-11-10 | 2021-08-17 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US12582700B2 (en) | 2016-11-10 | 2026-03-24 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12350313B2 (en) | 2016-11-10 | 2025-07-08 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11717558B2 (en) | 2016-11-10 | 2023-08-08 | Keros Therapeutics, Inc. | Nucleic acid molecules encoding activin receptor type IIA variants |
| EP3638243B1 (en) | 2017-06-14 | 2024-08-07 | Celgene Corporation | Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia |
| EP3638243A4 (en) * | 2017-06-14 | 2021-03-17 | Celgene Corporation | METHOD OF TREATMENT OF MYELOPROLIFERATIVE NEOPLASM ASSOCIATED MYELOFIBROSIS AND ANEMIA |
| EP4454707A3 (en) * | 2017-06-14 | 2024-12-25 | Celgene Corporation | Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia |
| US11484573B2 (en) | 2017-11-09 | 2022-11-01 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12269858B2 (en) | 2018-01-12 | 2025-04-08 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| WO2019217715A1 (en) | 2018-05-09 | 2019-11-14 | Keros Therapeutics, Inc. | Activin receptor type iia variants and methods of use thereof |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| CN112601538A (zh) * | 2018-05-09 | 2021-04-02 | 科乐斯疗法公司 | 激活素受体iia型变体及其使用方法 |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
| US12522646B2 (en) | 2020-03-20 | 2026-01-13 | Keros Therapeutics, Inc. | Activin receptor type II chimeras and methods of use thereof |
| EP4149441A4 (en) * | 2020-05-15 | 2024-03-13 | Celgene Corporation | METHODS AND COMPOSITIONS FOR TREATING ANEMIA WITH ACTRIIB LIGAND TRAP AND MTOR INHIBITORS |
| EP4649961A3 (en) * | 2020-05-15 | 2026-02-25 | Celgene Corporation | Methods and compositions for treating anemia using actriib ligand traps and mtor inhibitors |
| US12186370B1 (en) | 2020-11-05 | 2025-01-07 | Celgene Corporation | ACTRIIB ligand trap compositions and uses thereof |
| WO2023023345A3 (en) * | 2021-08-19 | 2023-05-11 | Keros Therapeutics, Inc. | Methods of using activin receptor type ii signaling inhibitors |
| WO2023108137A1 (en) * | 2021-12-10 | 2023-06-15 | Biogen Ma Inc. | Modified actriib proteins and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP7264580B2 (ja) | 2023-04-25 |
| PL3490582T3 (pl) | 2024-09-23 |
| RS65735B1 (sr) | 2024-08-30 |
| CN109789184A (zh) | 2019-05-21 |
| JP2019522022A (ja) | 2019-08-08 |
| MA45811A (fr) | 2019-06-05 |
| US20250222069A1 (en) | 2025-07-10 |
| US20180050085A1 (en) | 2018-02-22 |
| DK3490582T3 (da) | 2024-07-29 |
| EP3490582A4 (en) | 2020-04-01 |
| BR112019001615A2 (pt) | 2019-04-30 |
| LT3490582T (lt) | 2024-07-25 |
| HUE067225T2 (hu) | 2024-10-28 |
| US12194076B2 (en) | 2025-01-14 |
| CA3031909A1 (en) | 2018-02-01 |
| PT3490582T (pt) | 2024-08-21 |
| ES2984470T3 (es) | 2024-10-29 |
| AU2017302282A1 (en) | 2019-02-07 |
| JP2023014373A (ja) | 2023-01-26 |
| EA201990226A1 (ru) | 2019-08-30 |
| HRP20240974T1 (hr) | 2024-10-25 |
| EP3490582A1 (en) | 2019-06-05 |
| SMT202400299T1 (it) | 2024-09-16 |
| FI3490582T3 (fi) | 2024-08-01 |
| SI3490582T1 (sl) | 2024-09-30 |
| MX2019001043A (es) | 2019-09-26 |
| AU2017302282B2 (en) | 2024-07-25 |
| KR20190040972A (ko) | 2019-04-19 |
| EP3490582B1 (en) | 2024-06-12 |
| US20210322514A1 (en) | 2021-10-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12194076B2 (en) | Methods and compositions for treating myelofibrosis | |
| US11260107B2 (en) | Methods and compositions for treating ulcers | |
| US10829531B2 (en) | Methods for treating myelodysplastic syndromes and sideroblastic anemias | |
| US20220233697A1 (en) | Methods for increasing red blood cell levels and treating ineffective erythropoiesis | |
| US20210188955A1 (en) | Methods for increasing red blood cell levels and treating sickle-cell disease | |
| AU2015231022A1 (en) | Methods for increasing red blood cell levels and treating ineffective erythropoiesis by inhibiting activin B and/or GDF11 | |
| EA043914B1 (ru) | Способы увеличения уровней эритроцитов и/или гемоглобина и лечения миелофиброза |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17835212 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3031909 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019503972 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019001615 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2017302282 Country of ref document: AU Date of ref document: 20170726 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20197005397 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017835212 Country of ref document: EP Effective date: 20190227 |
|
| ENP | Entry into the national phase |
Ref document number: 112019001615 Country of ref document: BR Kind code of ref document: A2 Effective date: 20190125 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: P-2024/0798 Country of ref document: RS |