WO2017059878A1 - Antibodies that potently neutralize hepatitis b virus and uses thereof - Google Patents
Antibodies that potently neutralize hepatitis b virus and uses thereof Download PDFInfo
- Publication number
- WO2017059878A1 WO2017059878A1 PCT/EP2015/001970 EP2015001970W WO2017059878A1 WO 2017059878 A1 WO2017059878 A1 WO 2017059878A1 EP 2015001970 W EP2015001970 W EP 2015001970W WO 2017059878 A1 WO2017059878 A1 WO 2017059878A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- antigen binding
- binding fragment
- hbsag
- hepatitis
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/081—DNA viruses
- C07K16/082—Hepadnaviridae (F), e.g. hepatitis B virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/42—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum viral
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2730/00—Reverse transcribing DNA viruses
- C12N2730/00011—Details
- C12N2730/10011—Hepadnaviridae
- C12N2730/10111—Orthohepadnavirus, e.g. hepatitis B virus
Definitions
- the present invention relates to the field of antibodies against hepatitis B virus (HBV) and against hepatitis delta virus (HDV) and uses thereof.
- the potent anti hepatitis B antibodies of the present invention bind to an epitope located in the antigenic loop region of the S domain of the HBV envelope proteins (HBsAg), as identified in the present invention.
- the invention also relates to nucleic acids that encode and immortalized B cells and cultured plasma cells that produce such antibodies and antibody fragments.
- the invention relates to the use of the antibodies and antibody fragments of the invention in screening methods as well as in the diagnosis, prophylaxis and treatment of diseases, in particular hepatitis B and hepatitis D.
- the hepatitis B virus consists of (i) an envelope containing three related surface proteins (hepatitis B surface antigen, HBsAg) and lipid and (ii) an icosahedral nucleocapsid enclosing the viral DNA genome and DNA polymerase.
- the HBV capsid is formed in the cytosol of the infected cell during packaging of an RNA pregenome replication complex and gains the ability to bud during synthesis of the viral DNA genome by reverse transcription of the pregenome in the lumen of the particle.
- the three HBV envelope proteins S-HBsAg, M- HBsAg, and L-HBsAg shape a complex transmembrane fold at the endoplasmic reticulum, and form disulfide-linked homo- and heterodimers.
- a short linear domain in the cytosolic preS region interacts with binding sites on the capsid surface.
- the virions are subsequently secreted into the blood.
- the surface proteins can bud in the absence of capsids and form subviral particles (SVP's) which are also secreted in 3-4 log excess over virions.
- High level of HBsAg can exhaust HBsAg- specific T-cell response, and is proposed as an important factor for viral immunotolerance in patients with chronic hepatitis B (CH B) (Chisari FV, Isogawa M, Wieland SF, Pathologie Biologie, 201 0;58:258-66).
- CH B chronic hepatitis B
- Hepatitis B virus causes potential ly life-threateni ng acute and chronic liver infections.
- Acute hepatitis B is characterized by viremia, with or without symptoms, with the risk of fulminant hepatitis occurrence (Liang TJ, Block TM, McMahon BJ, Ghany MG, Urban S, Guo JT, Locarnini S, Zoulim F, Chang KM, Lok AS.
- Present and future therapies of hepatitis B From discovery to cure. Hepatology. 201 5 Aug 3. doi: 10.1002/hep.28025. [Epub ahead of print]).
- the currently avai lable treatments for chronic hepatitis B include (pegylated) i nterferon-alpha (IFN- or peglFN-a) and nucleos(t)ide analogue Direct Acting Antivirals (DAAs) that inhibit the hepatitis B virus (HBV) DNA polymerase (“polymerase inhibitors").
- Polymerase inhibitors include Lamivudine, Adefovir, Entcavir, Telbivudine and Tenofovir.
- Polymerase inhibitors suppress the reverse transcriptase function of the H BV DNA polymerase and therefore interfere with the synthesis of vi ral DNA from pregenomic RNA.
- This treatment does not prevent viral spread, formation of cccDNA and does not affect H BsAg release.
- polymerase inhibitors limit disease progression but rarely clear the virus.
- viral relapse is commonly observed after stoppi ng the treatment and, therefore, polymerase inhibitors should be used for the l ifetime.
- drug-resistant mutants emerge after prolonged treatment.
- PEG-I FN-ct i nhibits HBV indirectly through immune modulatory effects and directly by reducing steady-state levels of H BV transcripts (increased acetylation of cccDNA-bound histones).
- PEG-IFN-a has l imited efficacy and causes serious side effects.
- peglFN- ⁇ is effective in approximately one-third of the treated patients, the polymerase inhibitors significantly reduce viral load in the vast majority of those treated (Timothy M. Block, Robert Gish, Haitao Guo, Anand Mehta, Andrea Cuconati, W. Thomas London, Ju- Tao Guo Chronic hepatitis B: What should be the goal for new therapies?
- Interferon a is associated with many adverse reactions and cannot be used in patients with advanced cirrhosis or medical/psychiatric contraindications (Liang TJ, Block TM, McMahon BJ, Ghany MG, Urban S, Guo JT, Locarnini S, Zoulim F, Chang KM, Lok AS.
- Present and future therapies of hepatitis B From discovery to cure. Hepatology. 201 5 Aug 3. doi: 1 0.1 002/hep.28025. [Epub ahead of print]).
- HBV patients with acute hepatitis or hepatocellular carcinoma are indicated for orthotopic liver transplantation (OLT).
- OLT orthotopic liver transplantation
- HBIG hepatitis B immunoglobulin
- nucleoside analogue treatment combined hepatitis B immunoglobulin (HBIG) and nucleoside analogue treatment.
- HBIG hepatitis B immunoglobulins
- HBIG are polyclonal immunoglobulins purified from vaccinated donors.
- long-term HBIG administration is associated with several unresolved issues, including limited availability and extremely high cost (Takaki A, Yasunaka T, Yagi T.
- HDV hepatitis delta virus
- HDV is a defective virus that requires coinfection with HBV for its replication since it utilizes the hepatitis B envelope proteins (HBsAg) as its own virion coat.
- HBV envelope proteins hepatitis B envelope proteins
- the HDV RNA genome replicates and associates with multiple copies of the HDV-encoded proteins to assemble a ribonucleoprotein (RNP) complex.
- the RNP is exported from the cell by the HBV envelope proteins, which are able to assemble lipoprotein vesicles that bud into the lumen of a pre- Golgi compartment before being secreted.
- the HBV envelope proteins also provide a mechanism for the targeting of HDV to an uninfected cell, thereby ensuring the spread of HDV.
- the complications caused by HDV include a greater likelihood of experiencing liver failure in acute infections and a rapid progression to liver cirrhosis, with an increased chance of developing liver cancer in chronic infections.
- hepatitis D In combination with hepatitis B virus, hepatitis D has the highest fatality rate of all the hepatitis infections, at 20% (Fattovich G, Giustina G, Christensen E, Pantalena M, Zagni I, Realdi G, Schalm SW. Influence of hepatitis delta virus infection on morbidity and mortality in compensated cirrhosis type B. Gut. 2000 Mar;46(3):420-6). The only approved therapy for chronic HDV infection is interferon-alpha.
- an antibody-based product which is capable of neutralizing both, hepatitis B virus (HBV) and hepatitis delta virus (HDV). That enables an improved prevention and treatment of hepatitis B.
- HBV hepatitis B virus
- HDV hepatitis delta virus
- one single antibody-based product acts in different ways by (i) potently neutralizing HBV, (ii) promoting clearance of HBsAg and HBV and (iii) inducing seroconversion, i.e. an immune response to the virus.
- antibodies may advantageously also promote an improved presentation of the antigen, thereby faci litating the restoration of an anti-HBV T-cell response.
- disease as used herein is intended to be generally synonymous, and is used interchangeably with, the terms “disorder” and “condition” (as in medical condition), in that all reflect an abnormal condition of the human or animal body or of one of its parts that impairs normal functioning, is typically manifested by distinguishing signs and symptoms, and causes the human or animal to have a reduced duration or quality of life.
- treatment of a subject or patient is intended to include prevention, prophylaxis, attenuation, amelioration and therapy.
- subject or patient are used interchangeably herein to mean all mammals including humans. Examples of subjects include humans, cows, dogs, cats, horses, goats, sheep, pigs, and rabbits. In one embodiment, the patient is a human.
- peptide As used herein, the terms “peptide”, “polypeptide”, and “protein” and variations of these terms refer to a molecule, in particular a peptide, oligopeptide, polypeptide or protein including fusion protein, respectively, comprising at least two amino acids joined to each other by a normal peptide bond, or by a modified peptide bond, such as for example in the cases of isosteric peptides.
- a peptide, polypeptide or protein is preferably composed of amino acids selected from the 20 amino acids defined by the genetic code, linked to each other by a normal peptide bond ("classical" polypeptide).
- a peptide, polypeptide or protein can be composed of L-amino acids and/or D-amino acids.
- peptide also include “peptidomimetics” which are defined as peptide analogs containing non-peptidic structural elements, which peptides are capable of mimicking or antagonizing the biological action(s) of a natural parent peptide.
- a peptidomimetic lacks classical peptide characteristics such as enzymatically scissile peptide bonds.
- a peptide, polypeptide or protein may comprise amino acids other than the 20 amino acids defined by the genetic code in addition to these amino acids, or it can be composed of amino acids other than the 20 amino acids defined by the genetic code.
- a peptide, polypeptide or protein in the context of the present invention can equally be composed of amino acids modified by natural processes, such as post-translational maturation processes or by chemical processes, which are well known to a person skilled in the art. Such modifications are fully detailed in the literature. These modifications can appear anywhere in the polypeptide: in the peptide skeleton, in the amino acid chain or even at the carboxy- or amino-terminal ends.
- a peptide or polypeptide can be branched following an ubiquitination or be cyclic with or without branching. This type of modification can be the result of natural or synthetic post-trans lational processes that are well known to a person skilled in the art.
- peptide in the context of the present invention in particular also include modified peptides, polypeptides and proteins.
- peptide, polypeptide or protein modifications can include acetylation, acylation, ADP-ribosylation, amidation, covalent fixation of a nucleotide or of a nucleotide derivative, covalent fixation of a lipid or of a lipidic derivative, the covalent fixation of a phosphatidylinositol, covalent or non-covalent cross- linking, cyclization, disulfide bond formation, demethylation, glycosylation including pegylation, hydroxylation, iodization, methylation, myristoylation, oxidation, proteolytic processes, phosphorylation, prenylation, racemization, seneloylation, sulfatation, amino acid addition such as arginylation or ubiquitination.
- a “(poly)peptide” comprises a single chain of amino acid monomers linked by peptide bonds as explained above.
- a “protein”, as used herein, comprises one or more, e.g. 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 1 0 (poly)peptides, i.e. one or more chains of amino acid monomers linked by peptide bonds as explained above.
- a protein according to the present invention comprises 1 , 2, 3, or 4 polypeptides.
- nucleic acid refers to any molecule (antibody, protein, nucleic acid etc.) which is prepared, expressed, created or isolated by recombinant means, and which is not naturally occurring.
- nucleic acid refers to any molecule (antibody, protein, nucleic acid etc.) which is prepared, expressed, created or isolated by recombinant means, and which is not naturally occurring.
- nucleic acid refers to any molecule (antibody, protein, nucleic acid etc.) which is prepared, expressed, created or isolated by recombinant means, and which is not naturally occurring.
- nucleic acid refers to any molecule (antibody, protein, nucleic acid etc.) which is prepared, expressed, created or isolated by recombinant means, and which is not naturally occurring.
- nucleic acid refers to any molecule (antibody, protein, nucleic acid etc.) which is prepared, expressed, created or isolated by recombinant means, and which is not naturally occurring.
- nucleic acid refers to any
- the terms “cell,” “cell line,” and “cell culture” are used interchangeably and all such designations include progeny.
- the words “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that all progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Variant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.
- the terms “antigen binding fragment,” “fragment,” and “antibody fragment” are used interchangeably to refer to any fragment of an antibody of the invention that retains the antigen-binding activity of the antibody.
- antibody fragments include, but are not limited to, a single chain antibody, Fab, Fab', F(ab') 2 , Fv or scFv.
- antibody as used herein includes both antibodies and antigen binding fragments thereof.
- neutralizing antibody is one that can neutralize, i.e., prevent, inhibit, reduce, impede or interfere with, the ability of a pathogen to initiate and/or perpetuate an infection in a host.
- neutralizing antibody and “an antibody that neutralizes” or “antibodies that neutralize” are used interchangeably herein. These antibodies can be used alone, or in combination, as prophylactic or therapeutic agents upon appropriate formulation, in association with active vaccination, as a diagnostic tool, or as a production tool as described herein.
- Doses are often expressed in relation to the bodyweight.
- a dose which is expressed as [g, mg, or other unit]/kg (or g, mg etc.) usually refers to [g, mg, or other unit] "per kg (or g, mg etc.) bodyweight", even if the term “bodyweight” is not explicitly mentioned.
- binding and “specifically binding” and similar reference do not encompass nonspecific sticking.
- the term "vaccine” as used herein is typically understood to be a prophylactic or therapeutic material providing at least one antigen, preferably an immunogen.
- the antigen or immunogen may be derived from any material that is suitable for vaccination.
- the antigen or immunogen may be derived from a pathogen, such as from bacteria or virus particles etc., or from a tumor or cancerous tissue.
- the antigen or immunogen stimulates the body's adaptive immune system to provide an adaptive immune response.
- an "antigen” or an “immunogen” refers typically to a substance which may be recognized by the immune system, preferably by the adaptive immune system, and which is capable of triggering an antigen-specific immune response, e.g. by formation of antibodies and/or antigen-specific T cells as part of an adaptive immune response.
- an antigen may be or may comprise a peptide or protein which may be presented by the MHC to T-cells.
- sequence variant refers to any sequence having one or more alterations in comparison to a reference sequence, whereby a reference sequence is any of the sequences listed in the "Table of Sequences and SEQ ID Numbers" (sequence listing), i.e. SEQ ID NO: 1 to SEQ ID NO: 57.
- sequence variant includes nucleotide sequence variants and amino acid sequence variants.
- the reference sequence is also a nucleotide sequence, whereas for sequence variant in the context of an amino acid sequence, the reference sequence is also an amino acid sequence.
- sequence variant is at least 80%, preferably at least 85 %, more preferably at least 90%, even more preferably at least 95% and particularly preferably at least 98% or 99% identical to the reference sequence.
- a "sequence variant" in the context of a nucleic acid (nucleotide) sequence has an altered sequence i n which one or more of the nucleotides in the reference sequence is deleted, or substituted, or one or more nucleotides are inserted i nto the sequence of the reference nucleotide sequence. Nucleotides are referred to herein by the standard one-letter designation (A, C, G, or T). Due to the degeneracy of the genetic code, a "sequence variant" of a nucleotide sequence can either result i n a change i n the respective reference amino acid sequence, i.e. in an amino acid "sequence variant" or not.
- nucleotide sequence variants which do not result i n amino acid sequence variants are preferred (silent mutations). However, nucleotide sequence variants leadi ng to "non-si lent" mutations are also within the scope, in particular such nucleotide sequence variants, which result in an amino acid sequence, which is at least 80%, preferably at least 85 %, more preferably at least 90%, even more preferably at least 95% and particularly preferably at least 98% or 99% identical to the reference amino acid sequence.
- a "sequence variant" in the context of an amino acid sequence has an altered sequence in which one or more of the amino acids is deleted, substituted or inserted i n comparison to the reference ami no acid sequence.
- such a sequence variant has an amino acid sequence which is at least 80%, preferably at least 85 %, more preferably at least 90%, even more preferably at least 95% and particularly preferably at least 98% or 99% identical to the reference amino acid sequence.
- a variant sequence has no more than 1 0 alterations, i .e. any combination of deletions, insertions or substitutions, is "at least 90% identical" to the reference sequence.
- the substitutions be conservative amino acid substitutions, in which the substituted amino acid has simi lar structural or chemical properties with the corresponding amino acid in the reference sequence.
- conservative amino acid substitutions involve substitution of one al iphatic or hydrophobic amino acids, e.g. alanine, valine, leucine and isoleuci ne, with another; substitution of one hydoxyl-contai ning amino acid, e.g. serine and threonine, with another; substitution of one acidic residue, e.g. glutamic acid or aspartic acid, with another; replacement of one amide-containing residue, e.g.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include the fusion to the N- or C-terminus of an amino acid sequence to a reporter molecule or an enzyme.
- the alterations in the sequence variants do not abolish the functionality of the respective reference sequence, in the present case, for example the functionality of a sequence of an antibody, or antigen binding fragment thereof, to bind to the same epitope and/or to sufficiently neutralize infection of HBV and HDV.
- Guidance in determining which nucleotides and amino acid residues, respectively, may be substituted, inserted or deleted without abolishing such functionality can be found by using computer programs well known in the art.
- nucleic acid sequence or an amino acid sequence "derived from” a designated nucleic acid, peptide, polypeptide or protein refers to the origin of the nucleic acid, peptide, polypeptide or protein.
- the nucleic acid sequence or amino acid sequence which is derived from a particular sequence has an amino acid sequence that is essentially identical to that sequence or a portion thereof, from which it is derived, whereby "essentially identical” includes sequence variants as defined above.
- nucleic acid sequence or amino acid sequence which is derived from a particular peptide or protein is derived from the corresponding domain in the particular peptide or protein.
- “corresponding" refers in particular to the same functionality.
- an "extracellular domain” corresponds to another "extracellular domain” (of another protein), or a “transmembrane domain” corresponds to another “transmembrane domain” (of another protein).
- “Corresponding” parts of peptides, proteins and nucleic acids are thus easily identifiable to one of ordinary skill in the art.
- sequences "derived from” other sequence are usually easily identifiable to one of ordinary skill in the art as having its origin i n the sequence.
- a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may be identical to the starting nucleic acid, peptide, polypeptide or protein (from which it is derived).
- a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may also have one or more mutations relative to the starting nucleic acid, peptide, polypeptide or protei n (from which it is derived), in particular a nucleic acid sequence or an amino acid sequence derived from another nucleic acid, peptide, polypeptide or protein may be a functional sequence variant as described above of the starting nucleic acid, peptide, polypeptide or protein (from which it is derived).
- one or more amino acid residues may be substituted with other ami no acid residues or one or more ami no acid residue i nsertions or deletions may occur.
- mutation relates to a change i n the nucleic acid sequence and/or in the ami no acid sequence in comparison to a reference sequence, e.g. a corresponding genomic sequence.
- a mutation e.g. in comparison to a genomic sequence, may be, for example, a (naturally occurring) somatic mutation, a spontaneous mutation, an induced mutation, e.g. induced by enzymes, chemicals or radiation, or a mutation obtai ned by site- directed mutagenesis (molecular biology methods for making specific and intentional changes in the nucleic acid sequence and/or in the ami no acid sequence).
- mutation or “mutati ng" shal l be understood to also i nclude physically maki ng a mutation, e.g. in a nucleic acid sequence or in an amino acid sequence.
- a mutation includes substitution, deletion and insertion of one or more nucleotides or amino acids as well as i nversion of several successive nucleotides or amino acids.
- a mutation may be introduced into the nucleotide sequence encodi ng said ami no acid sequence i n order to express a (recombi nant) mutated polypeptide.
- a mutation may be achieved e.g., by altering, e.g., by site-directed mutagenesis, a codon of a nucleic acid molecule encoding one ami no acid to result in a codon encoding a different amino acid, or by synthesizi ng a sequence variant, e.g., by knowing the nucleotide sequence of a nucleic acid molecule encoding a polypeptide and by designi ng the synthesis of a nucleic acid molecule comprising a nucleotide sequence encoding a variant of the polypeptide without the need for mutating one or more nucleotides of a nucleic acid molecule.
- the present invention is based, amongst other findings, on the discovery and isolation of antibodies that are highly potent in neutralizing hepatitis B and hepatitis delta viruses, as well as of epitopes to which the antibodies of the invention bind. Such antibodies are desirable, as only small quantities of the antibodies are required in order to neutralize hepatitis B virus. Moreover, there is currently no treatment available for hepatitis D.
- the antibodies according to the present invention are highly effective in preventing as well as treating or attenuating HBV and HDV.
- the antibodies according to the present invention bind to different - preferably all known - genotypes of hepatitis B virus surface antigen and to different - preferably all known - infectious mutants of hepatitis B virus surface antigen.
- the present invention provides an isolated antibody, or an antigen binding fragment thereof, that binds to the antigenic loop region of HBsAg and neutralizes infection with hepatitis B virus and hepatitis delta virus.
- antibody encompasses various forms of antibodies including, without being limited to, whole antibodies, antibody fragments, in particular antigen binding fragments, human antibodies, chimeric antibodies, humanized antibodies, recombinant antibodies and genetically engineered antibodies (variant or mutant antibodies) as long as the characteristic properties according to the invention are retained.
- Human antibodies and monoclonal antibodies are preferred and especially preferred are human monoclonal antibodies, in particular as recombinant human monoclonal antibodies.
- Human antibodies are well-known in the state of the art (van Dijk, M. A., and van de Winkel, J. C, Curr. Opin. Chem. Biol. 5 (2001 ) 368-374).
- Human antibodies can also be produced in transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire or a selection of human antibodies in the absence of endogenous immunoglobulin production. Transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge (see, e.g., Jakobovits, A., et al., Proc. Natl. Acad. Sci. USA 90 (1993) 2551 -2555; Jakobovits, A., et al., Nature 362 (1 993) 255-258; Bruggemann, M., et al., Year Immunol. 7 (1 993) 3340).
- transgenic animals e.g., mice
- Human antibodies can also be produced in phage display libraries (Hoogenboom, H. R., and Winter, C. . Mol. Biol. 227 (1992) 381 -388; Marks, J. D., et al., / Mol. Biol. 222 (1991 ) 581 - 597).
- the techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); and Boerner, P., et al., / Immunol. 147 (1 991 ) 86-95).
- human monoclonal antibodies are prepared by using improved EBV-B cell immortalization as described in Traggiai E, Becker S, Subbarao K, Kolesnikova L, Uematsu Y, Gismondo MR, Murphy BR, Rappuoli R, Lanzavecchia A. (2004): An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus. Nat Med. 10(8):871 -5.
- the term "human antibody” as used herein also comprises such antibodies which are modified, e.g. in the variable region, to generate the properties according to the invention as described herein.
- variable region (variable region of a light chain (V L ), variable region of a heavy chain (V H )) denotes each of the pair of light and heavy chains which is involved directly in binding the antibody to the antigen.
- Antibodies of the invention can be of any isotype ⁇ e.g., IgA, IgG, IgM i.e. an ⁇ , ⁇ or ⁇ heavy chain), but will preferably be IgG. Within the IgG isotype, antibodies may be lgG1 , lgG2, lgG3 or lgG4 subclass, whereby lgG1 is preferred. Antibodies of the invention may have a ⁇ or a ⁇ light chain.
- HBsAg-specific antibodies of the IgG-type may advantageously also block the release of HBV and HBsAg from infected cells - based on antigen-independent uptake of IgG through FcRN-lgG receptors into hepatocytes. Therefore, HBsAg-specific antibodies of the IgG-type can bind intracellularly and thereby block the release of HBV virions and HBsAg.
- the antibody according to the present invention is a purified antibody, a single chain antibody, Fab, Fab', F(ab')2, Fv or scFv.
- the antibodies of the invention may thus preferably be human antibodies, monoclonal antibodies, human monoclonal antibodies, recombinant antibodies or purified antibodies.
- the i nvention also provides fragments of the antibodies of the i nvention, particularly fragments that retain the antigen-bindi ng activity of the antibodies. Such fragments include, but are not l imited to, single chain antibodies, Fab, Fab', F(ab')2, Fv or scFv.
- antibody or “antibody of the i nvention” includes all categories of antibodies, namely, antigen binding fragment(s), antibody fragment(s), variant(s) and derivative(s) of antibodies.
- Fragments of the antibodies of the i nvention can be obtained from the antibodies by methods that include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by chemical reduction. Alternatively, fragments of the antibodies can be obtained by cloning and expression of part of the sequences of the heavy or light chains.
- Antibody "fragments" i n clude Fab, Fab', F(ab')2 and Fv fragments.
- the invention also encompasses single-chain Fv fragments (scFv) derived from the heavy and light chains of an antibody of the invention.
- the i nvention i n cludes a scFv comprisi ng the CDRs from an antibody of the i nvention.
- heavy or light chain monomers and dimers include heavy or light chain monomers and dimers, single domain heavy chai n antibodies, single domain light chai n antibodies, as well as si ngle chain antibodies, e.g., single chain Fv i n which the heavy and light chain variable domai ns are joined by a peptide linker.
- Antibody fragments of the invention may impart monovalent or multivalent interactions and be contained in a variety of structures as described above.
- scFv molecules may be synthesized to create a trivalent "triabody” or a tetravalent "tetrabody.”
- the scFv molecules may include a domain of the Fc region resulting in bivalent minibodies.
- sequences of the i nvention may be a component of multispecific molecules i n which the sequences of the invention target the epitopes of the invention and other regions of the molecu le bind to other targets.
- Exemplary molecules include, but are not limited to, bispecific Fab2, trispecific Fab3, bispecific scFv, and diabodies (Hol liger and Hudson, 2005, Nature Biotechnology 9: 1 1 26-1 1 36).
- Antibodies according to the present invention may be provided in purified form. Typically, the antibody will be present in a composition that is substantially free of other polypeptides e.g., where less than 90% (by weight), usually less than 60% and more usually less than 50% of the composition is made up of other polypeptides.
- Antibodies according to the present invention may be immunogenic in human and/or in non-human (or heterologous) hosts e.g., in mice.
- the antibodies may have an idiotope that is immunogenic in non-human hosts, but not in a human host.
- Antibodies of the invention for human use include those that cannot be easily isolated from hosts such as mice, goats, rabbits, rats, non-primate mammals, etc. and cannot generally be obtained by humanization or from xeno-mice.
- the antibody, and the antigen binding fragment thereof, according to the present invention binds to the antigenic loop region of HBsAg.
- the envelope of the hepatitis B virus contains three "HBV envelope proteins" (also known as "HBsAg", “hepatitis B surface antigen"): S protein (for "small”, also referred to as S-HBsAg), M protein (for “middle”, also referred to as M-HBsAg) and L protein (for "large”, also referred to as L-HBsAg).
- S-HBsAg, M-HBsAg and L- HBsAg share the same C-terminal extremity (also referred to as "S domain", 226 amino acids), which corresponds to the S protein (S-HBsAg) and which is crucial for virus assembly and infectivity.
- S-HBsAg, M-HBsAg and L-HBsAg are synthesized in the endoplasmic reticulum (ER), assembled, and secreted as particles through the Golgi apparatus.
- the S domain comprises four predicted transmembrane (TM) domains, whereby both, the N-terminus as well as the C-terminus of the S domain are exposed to the lumen.
- the transmembrane domains TM1 and TM2 are both necessary for cotranslational protein integration into the ER membrane and the transmembrane domains TM3 and TM4 are located in the C-terminal third of the S domain.
- the "antigenic loop region" of HBsAg is located between the predicted TM3 and TM4 transmembrane domains of the S domain of HBsAg, whereby the antigenic loop region comprises amino acids 1 01 - 1 72 of the S domain, which contains 226 amino acids in total (Salisse J. and Sureau C, 2009, Journal of Virology 83: 9321 -9328). It is important to note that a determinant of infectivity resides in the antigenic loop region of HBV envelope proteins.
- residues between 1 19 and 125 of the HBsAg contained a CXXC motif, which had been demonstrated to be the most important sequence required for the infectivity of HBV and HDV Gaoude GA, Sureau C, Journal of Virology, 2005;79:10460-6).
- amino acid sequence of the S domain of HBsAg When it is herein referred to positions in the amino acid sequence of the S domain of HBsAg, it is referred to an amino acid sequence as set forth in SEQ ID NO: 3 (shown below) or to natural or artificial sequence variants thereof.
- amino acids 101 - 1 72 of the S domain refers to the amino acid residues from positions 101 - 1 72 of the polypeptide according to SEQ ID NO: 3.
- mutations or variations including, but not limited to, substitution, deletion and/or addition, for example, HBsAg of a different genotype or a different HBsAg mutant as described herein may occur naturally in the amino acid sequence of the S domain of HBsAg or be introduced artificially into the amino acid sequence of the S domain of HBsAg without affecting its biological properties.
- the term " S domain of HBsAg” intends to comprise all such polypeptides, for example, including the polypeptide according to SEQ ID NO: 3 and its natural or artificial mutants.
- sequence fragments of the S domain of HBsAg are described herein (e.g. amino acids 101 - 1 72 or amino acids 120 -1 30 of the S domain of HBsAg), they include not only the corresponding sequence fragments of SEQ ID NO: 3, but also the corresponding sequence fragments of its natural or artificial mutants.
- amino acid residues from positions 101 - 1 72 of the S domain of HBsAg comprises amino acid residues from positions 1 01 - 1 72 of SEQ ID NO: 3 and the corresponding fragments of its mutants (natural or artificial mutants).
- corresponding sequence fragments or “corresponding fragments” refers to fragments that are located in equal positions of sequences when the sequences are subjected to optimized alignment, namely, the sequences are aligned to obtain a highest percentage of identity.
- the M protein corresponds to the S protein extended by an N-terminal domain of 55 amino acids called "pre-S2".
- the L protein corresponds to the M protein extended by an N-terminal domain of 108 amino acids called "pre-S1 " (genotype D).
- pre-S1 and pre-S2 domains of the L protein can be present either at the inner face of viral particles (on the cytoplasmic side of the ER), playing a crucial role in virus assembly, or on the outer face (on the luminal side of the ER), available for the interaction with target cells and necessary for viral infectivity.
- HBV surface proteins HBsAgs
- SVPs empty "subviral particles”
- all three HBV envelope proteins S-HBsAg, M-HBsAg and L-HBsAg comprise the S domain
- all three HBV envelope proteins S-HBsAg, M-HBsAg and L-HBsAg also comprise the "antigenic loop region". Accordingly, an antibody, or an antigen binding fragment thereof, according to the present invention, which neutralizes HBV and binds to the antigenic loop region of HBsAg, binds to all three HBV envelope proteins S-HBsAg, M-HBsAg and L-HBsAg.
- an antibody, or an antigen binding fragment thereof, according to the present invention neutralizes infection with hepatitis B virus and hepatitis delta virus.
- the antibody, or the antigen binding fragment thereof, according to the present invention reduces viral infectivity of hepatitis B virus and hepatitis delta virus.
- neutralization virus infectivity
- animal viruses are typically propagated in cells and/or cell lines.
- a neutralization assay is preferred, wherein cultered cells are incubated with a fixed amount of HBV or HDV in the presence (or absence) of the antibody to be tested.
- HBV or HDV hepatitis B surface antigen
- HBeAg staining may be assessed.
- cultered cells for example HepaRG cells, in particular differentiated HepaRG cells, are incubated with a fixed amount of HBV in the presence or absence of the antibody to be tested, for example for 1 6 hours at 37°C. That incubation is preferably performed in a medium (e.g. supplemented with 4% PEG 8000). After incubation, cells may be washed and further cultivated.
- a medium e.g. supplemented with 4% PEG 8000.
- hepatitis B surface antigen (HBsAg) and hepatitis B e antigen (HBeAg) secreted into the culture supernatant may be determined by enzyme-linked immunosorbent assay (ELISA). Additionally, HBcAg staining may be assessed in an immunofluorescence assay.
- a HDV neutralization assay essentially the same assay as for HBV may be used, with the difference that sera from HDV carriers may be used as HDV infection inoculum on differentiated HepaRg cells (instead of HBV). For detection, delta antigen immunofluorescence staining may be used as a readout.
- the antibody and antigen binding fragment of the invention have high neutralizing potency.
- the concentration of the antibody of the invention required for 50% neutralization of hepatitis B virus (HBV) and hepatitis delta virus (HDV) is, for example, about 10 pg/ml or less.
- the concentration of the antibody of the invention required for 50% neutralization of HBV and HDV is about 5 pg/ml, more preferably the concentration of the antibody of the invention required for 50% neutralization of HBV and HDV is about 1 pg/ml, even more preferably, the concentration of the antibody of the invention required for 50% neutralization of HBV and HDV is about 750 ng/ml.
- the concentration of the antibody of the invention required for 50% neutralization of HBV and HDV is 500 ng/ml or less, e.g. 450, 400, 350, 300, 250, 200, 1 75, 1 50, 125, 100, 90, 80, 70, 60 or about 50 ng/ml or less. This means that only low concentrations of the antibody are required for 50% neutralization of HBV and HDV. Specificity and potency can be measured using standard assays as known to one of skill in the art.
- the antibody, or the antigen binding fragment thereof, according to the present invention which potently neutralizes both, HBV and HDV, is useful in the prevention and treatment of hepatitis B and hepatitis D.
- infection with HDV typically occurs simultaneously or subsequently to infection with HBV (inoculation with HDV in the absence of HBV does not cause hepatitis D since HDV requires the support of HBV for its own replication) and hepatitis D is typical ly observed in chronic HBV carriers.
- the antibody according to the present invention promotes clearance of HBsAg and HBV.
- the antibody according to the present invention, or an antigen binding fragment thereof promotes clearance of both, HBV and subviral particles of hepatitis B virus (SVP's).
- Clearance of HBsAg or of subviral particles may be assessed by measuring the level of HBsAg for example in a blood sample, e.g. from a hepatitis B patient.
- clearance of HBV may be assessed by measuring the level of HBV for example in a blood sample, e.g. from a hepatitis B patient.
- hepatitis B surface antigen (HBsAg) loss is thus considered to be an ideal endpoint of treatment and the closest outcome to cure chronic hepatitis B (CHB).
- CHB chronic hepatitis B
- the antibody according to the present invention, or an antigen binding fragment thereof, which preferably promotes clearance of HBsAg, in particular clearance of subviral particles of hepatitis B virus, and HBV enables improved treatment of hepatitis B, in particular in the context of chronic hepatitis B.
- the antibody according to the present invention can exert its neutralization properties even more potent since less of the antibody is absorbed by SVP's acting as a decoy.
- the antibody according to the present invention, or an antigen binding fragment thereof which preferably promotes clearance of subviral particles of hepatitis B virus, decreases infectivity of sera containing HBV.
- the antibody according to the present invention comprises an Fc moiety.
- the Fc moiety is derived from human origin, e.g. from human lgG1 , lgG2, lgG3, and/or lgG4, whereby human lgG1 is particularly preferred.
- an Fc moiety refers to a sequence derived from the portion of an immunoglobulin heavy chain beginning in the hinge region just upstream of the papain cleavage site (e.g., residue 21 6 in native IgG, taking the first residue of heavy chain constant region to be 1 14) and ending at the C-terminus of the immunoglobulin heavy chain. Accordingly, an Fc moiety may be a complete Fc moiety or a portion (e.g., a domain) thereof. A complete Fc moiety comprises at least a hinge domain, a CH2 domain, and a CH3 domain (e.g., EU amino acid positions 21 6-446).
- an Fc moiety comprises at least one of: a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant, portion, or fragment thereof.
- a hinge e.g., upper, middle, and/or lower hinge region
- a CH2 domain e.g., a CH2 domain
- a CH3 domain e.g., a variant, portion, or fragment thereof.
- an Fc moiety comprises at least a hinge domain, a CH2 domain or a CH3 domain. More preferably, the Fc moiety is a complete Fc moiety.
- the Fc moiety may also comprises one or more amino acid insertions, deletions, or substitutions relative to a naturally-occurring Fc moiety. For example, at least one of a hinge domain, CH2 domain or CH3 domain (or portion thereof) may be deleted.
- an Fc moiety may comprise or consist of: (i) hinge domain (or portion thereof) fused to a CH2 domain (or portion thereof), (ii) a hinge domain (or portion thereof) fused to a CH3 domain (or portion thereof), (iii) a CH2 domain (or portion thereof) fused to a CH3 domain (or portion thereof), (iv) a hinge domain (or portion thereof), (v) a CH2 domain (or portion thereof), or (vi) a CH3 domain or portion thereof.
- the Fc moiety may be modified such that it varies in amino acid sequence from the complete Fc moiety of a naturally occurring immunoglobulin molecule, while retaining at least one desirable function conferred by the naturally-occurring Fc moiety.
- Such functions include Fc receptor (FcR) binding, antibody half-life modulation, ADCC function, protein A binding, protein G binding, and complement binding.
- FcR Fc receptor
- ADCC antibody half-life modulation
- protein A binding protein G binding
- complement binding complement binding.
- the portions of naturally occurring Fc moieties, which are responsible and/or essential for such functions are well known by those skilled in the art.
- to activate the complement cascade C1 q binds to at least two molecules of IgGI or one molecule of IgM, attached to the antigenic target (Ward, E.
- FcR binding can be mediated by the interaction of the Fc moiety (of an antibody) with Fc receptors (FcRs), which are specialized cell surface receptors on hematopoietic cells.
- Fc receptors belong to the immunoglobulin superfamily, and were shown to mediate both the removal of antibody-coated pathogens by phagocytosis of immune complexes, and the lysis of erythrocytes and various other cellular targets (e.g. tumor cells) coated with the corresponding antibody, via antibody dependent cell mediated cytotoxicity (ADCC; Van de Winkel, J. G., and Anderson, C. L, Leukoc. Biol. 49 (1 991 ) 51 1 -524).
- ADCC antibody dependent cell mediated cytotoxicity
- FcRs are defined by their specificity for immunoglobulin classes; Fc receptors for IgG antibodies are referred to as FcyR, for IgE as FCER, for IgA as FcaR and so on and neonatal Fc receptors are referred to as FcRn. Fc receptor binding is described for example in Ravetch, J. V., and Kinet, J. P., Annu. Rev. Immunol. 9 (1 991 ) 457-492; Capel, P. J., et al., Immunomethods 4 (1994) 25-34; de Haas, M., et a ⁇ . Lab. Clin. Med. 126 (1 995) 330-341 ; and Gessner, J.
- FcyR Fc domain of native IgG antibodies
- FcyR In humans, three classes of FcyR have been characterized, which are: (i) FcyRI (CD64), which binds monomeric IgG with high affinity and is expressed on macrophages, monocytes, neutrophi ls and eosinophils; (ii) FcyRII (CD32), which binds complexed IgG with medium to low affinity, is widely expressed, in particular on leukocytes, is known to be a central player in antibody-mediated immunity, and which can be divided into FcyRIIA, FcyRIIB and FcyRIIC, which perform different functions in the immune system, but bind with similar low affinity to the IgG-Fc, and the ectodomains of these receptors are highly homologuous; and (iii) FcyRIII (CD1 6), which binds IgG with medium to low affinity and exists as two types: FcyRIIIA found on NK cells, macrophages, eosinophil
- FcyRIIA is found on many cells involved in killing (e.g. macrophages, monocytes, neutrophils) and seems able to activate the killing process.
- FcyRIIB seems to play a role in inhibitory processes and is found on B-cells, macrophages and on mast cells and eosinophils. Importantly, 75% of all FcyRIIB is found in the liver (Ganesan, L. P. et al., 2012: FcyRIIb on liver sinusoidal endothelium clears small immune complexes. Journal of Immunology 1 89: 4981 -4988).
- FcyRIIB is abundantly expressed on Liver Sinusoidal Endothelium, called LSEC, and in Kupffer cells in the liver and LSEC are the major site of small immune complexes clearance (Ganesan, L. P. et al., 2012: FcyRIIb on liver sinusoidal endothelium clears small immune complexes. Journal of Immunology 1 89: 4981 -4988). Accordingly, in the present invention such antibodies, and antigen binding fragments thereof, are preferred, which are able to bind to FcyRllb, for example antibodies comprising an Fc moiety for binding to FcyRllb, in particular an Fc region, such as, for example IgG-type antibodies.
- antibodies, or antigen binding fragments thereof are preferred, which comprise an engineered Fc moiety with the mutations S267E and L328F, in particular as described by Chu, S. Y. et al., 2008: Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD19 and FcgammaRllb with Fc-engineered antibodies.
- FcyRIIB acts to inhibit phagocytosis as mediated through FcyRIIA.
- eosinophi ls and mast cells the b form may help to suppress activation of these cells through IgE binding to its separate receptor.
- FcyRI binding modification in native IgG of at least one of E233-G236, P238, D265, N297, A327 and P329 reduces binding to FcyRI.
- FcyRII binding reduced binding for FcyRIIA is found e.g.
- FcyRMI binding reduced binding to FcyRIIIA is found e.g. for mutation of at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, S239, E269, E293, Y296, V303, A327, K338 and D376.
- two regions of native IgG Fc appear to be critical for interactions of FcyRlls and IgGs, namely (i) the lower hinge site of IgG Fc, in particular amino acid residues L, L, G, G (234 - 237, EU numbering), and (ii) the adjacent region of the CH2 domain of IgG Fc, in particular a loop and strands in the upper CH2 domain adjacent to the lower hinge region, e.g. in a region of P331 (Wines, B.D., et al ., J. Immunol. 2000; 1 64: 531 3 - 531 8).
- FcyRI appears to bi nd to the same site on IgG Fc, whereas FcRn and Protein A bind to a different site on IgG Fc, which appears to be at the CH2-CH3 interface (Wines, B.D., et al., J. Immunol. 2000; 1 64: 531 3 - 531 8).
- the Fc moiety may comprise or consist of at least the portion of an Fc moiety that is known in the art to be required for FcRn bi nding or extended half-life.
- the Fc moiety of the antibody of the invention comprises at least the portion of known i n the art to be required for Protein A binding and/or the Fc moiety of the antibody of the i nvention comprises at least the portion of an Fc molecule known in the art to be required for protein G binding.
- the retained function is the clearance of HBsAg and HBV, which is assumed to be mediated by FcyR bi nding.
- a preferred Fc moiety comprises at least the portion known in the art to be required for FcyR bi nding.
- a preferred Fc moiety may thus at least comprise (i) the lower hinge site of native IgG Fc, in particular amino acid residues L, L, G, G (234 - 237, EU numbering), and (i i) the adjacent region of the CH2 domain of native IgG Fc, in particular a loop and strands i n the upper CH2 domain adjacent to the lower hinge region, e.g.
- a region of P331 for example a region of at least 3, 4, 5, 6, 7, 8, 9, or 1 0 consecutive ami no acids in the upper CH2 domain of native IgG Fc around P331 , e.g. between ami no acids 320 and 340 (EU numbering) of native IgG Fc.
- the antibody, or antigen bi nding fragment thereof, according to the present i nvention comprises an Fc region.
- Fc region refers to the portion of an immunoglobulin formed by two or more Fc moieties of antibody heavy chains.
- the Fc region may be monomeric or "si ngle-chain" Fc region (i .e., a scFc region).
- Single chain Fc regions are comprised of Fc moieties linked within a si ngle polypeptide chain (e.g., encoded in a single contiguous nucleic acid sequence). Exemplary scFc regions are disclosed in WO 2008/1 43954 A2.
- the Fc region is a dimeric Fc region.
- a "dimeric Fc region” or “dcFc” refers to the dimer formed by the Fc moieties of two separate immunoglobulin heavy chains.
- the dimeric Fc region may be a homodimer of two identical Fc moieties (e.g., an Fc region of a natural ly occurring immunoglobulin) or a heterodimer of two non-identical Fc moieties.
- the Fc moieties of the Fc region may be of the same or different class and/or subclass.
- the Fc moieties may be derived from an immunoglobuli n (e.g., a human immunoglobulin) of an lgG1 , lgG2, lgG3 or lgG4 subclass.
- the Fc moieties of Fc region are of the same class and subclass.
- the Fc region (or one or more Fc moieties of an Fc region) may also be chimeric, whereby a chimeric Fc region may comprise Fc moieties derived from different immunoglobulin classes and/or subclasses.
- the Fc moieties of a dimeric or single-chain Fc region may be from different immunoglobuli n classes and/or subclasses.
- the chimeric Fc regions may comprise one or more chimeric Fc moieties.
- the chimeric Fc region or moiety may comprise one or more portions derived from an immunoglobulin of a first subclass (e.g., an lgG1 , lgG2, or lgG3 subclass) whi le the remainder of the Fc region or moiety is of a different subclass.
- an Fc region or moiety of an Fc polypeptide may comprise a CH2 and/or CH3 domain derived from an immunoglobulin of a first subclass (e.g., an IgGI , lgG2 or lgG4 subclass) and a hinge region from an immunoglobulin of a second subclass (e.g., an lgG3 subclass).
- a first subclass e.g., an IgGI , lgG2 or lgG4 subclass
- a hinge region from an immunoglobulin of a second subclass e.g., an lgG3 subclass
- the Fc region or moiety may comprise a hinge and/or CH2 domain derived from an immunoglobulin of a first subclass (e.g., an lgG4 subclass) and a CH3 domai n from an immunoglobulin of a second subclass (e.g., an IgGI , lgG2, or lgG3 subclass).
- a first subclass e.g., an lgG4 subclass
- a CH3 domai n from an immunoglobulin of a second subclass
- the chimeric Fc region may comprise an Fc moiety (e.g., a complete Fc moiety) from an immunoglobulin for a first subclass (e.g., an lgG4 subclass) and an Fc moiety from an immunoglobulin of a second subclass (e.g., an IgGI , lgG2 or lgG3 subclass).
- the Fc region or moiety may comprise a CH2 domain from an lgG4 immunoglobulin and a CH3 domain from an IgGI immunoglobulin.
- the Fc region or moiety may comprise a CH 1 domain and a CH2 domain from an lgG4 molecule and a CH3 domain from an IgGI molecule.
- the Fc region or moiety may comprise a portion of a CH2 domai n from a particular subclass of antibody, e.g., EU positions 292-340 of a CH2 domai n.
- an Fc region or moiety may comprise amino acids a positions 292-340 of CH2 derived from an lgG4 moiety and the remainder of CH2 derived from an IgGI moiety (alternatively, 292-340 of CH2 may be derived from an IgGI moiety and the remai nder of CH2 derived from an lgG4 moiety).
- an Fc region or moiety may (additional ly or alternatively) for example comprise a chimeric hinge region.
- the chimeric hinge may be derived, e.g. in part, from an IgGI , lgG2, or lgG4 molecule (e.g., an upper and lower middle hinge sequence) and, in part, from an lgG3 molecule (e.g., an middle hinge sequence).
- an Fc region or moiety may comprise a chimeric hinge derived, in part, from an IgGI molecule and, in part, from an lgG4 molecule.
- the chimeric hinge may comprise upper and lower hinge domains from an lgG4 molecule and a middle hinge domain from an IgGI molecule.
- Such a chimeric hinge may be made, for example, by introducing a proline substitution (Ser228Pro) at EU position 228 in the middle hinge domain of an lgG4 hinge region.
- the chimeric hinge can comprise amino acids at EU positions 233-236 are from an lgG2 antibody and/or the Ser228Pro mutation, wherein the remaining amino acids of the hinge are from an lgG4 antibody (e.g., a chimeric hinge of the sequence ESKYGPPCPPCPAPPVAGP).
- the Fc moiety, or the Fc region comprises or consists of an amino acid sequence derived from a human immunoglobulin sequence (e.g., from an Fc region or Fc moiety from a human IgG molecule).
- polypeptides may comprise one or more amino acids from another mammalian species.
- a primate Fc moiety or a primate binding site may be included in the subject polypeptides.
- one or more murine amino acids may be present in the Fc moiety or in the Fc region.
- the antibody according to the present invention comprises, in particular in addition to an Fc moiety as described above, other parts derived from a constant region, in particular from a constant region of IgG, preferably from a constant region of IgGI , more preferably from a constant region of human IgGI . More preferably, the antibody according to the present invention comprises, in particular in addition to an Fc moiety as described above, all other parts of the constant regions, in particular all other parts of the constant regions of IgG, preferably all other parts of the constant regions of IgGI , more preferably all other parts of the constant regions of human IgGI .
- a particularly preferred antibody according to the present invention comprises a (complete) Fc region derived from human IgGI . More preferably, the antibody according to the present invention comprises, in particular in addition to a (complete) Fc region derived from human IgGI also all other parts of the constant regions of IgG, preferably all other parts of the constant regions of IgGI , more preferably all other parts of the constant regions of human IgGI .
- the antibody according to the present invention binds to 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 10 of the HBsAg genotypes A, B, C, D, E, F, G, H, I, and J.
- Examples for the different genotypes of HBsAg include the following: GenBank accession number J02203 (HBV-D, ayw3), GenBank accession number FJ899792.1 (HBV-D, adw2), GenBank accession number AM282986 (HBV-A), GenBank accession number D23678 (HBV-B1 Japan), GenBank accession number AB1 1 7758 (HBV-C1 Cambodia), GenBank accession number AB2051 92 (HBV-E Ghana), GenBank accession number X69798 (HBV-F4 Brazil), GenBank accession number AF1 60501 (HBV-G USA), GenBank accession number AY090454 (HBV-H Portugal), GenBank accession number AF241409 (HBV-I Vietnam) and GenBank accession number AB486012 (HBV-J Borneo).
- GenBank accession number J02203 HBV-D, ayw3
- GenBank accession number FJ899792.1 HBV
- the antibody according to the present invention binds to at least 6, even more preferably to at least 8, and particularly preferably to all 1 0 of the HBsAg genotypes A, B, C, D, E, F, G, H, I, and J.
- HBV is differentiated into many genotypes, according to genome sequence. To date, eight well- known genotypes (A-H) of the HBV genome have been defined. Moreover, two new genotypes, I and J, have also been identified (Sunbul M., 2014, World J Gastroenterol 20(1 8): 5427-5434). The genotype is known to affect the progression of the disease and differences between genotypes in response to antiviral treatment have been determined.
- genotype A has a tendency for chronicity, whereas viral mutations are frequently encountered in genotype C. Both chronicity and mutation frequency are common in genotype D.
- genotypes of HBV are differentially distributed over the world (Sunbul M., 2014, World J Gastroenterol 20(1 8): 5427-5434).
- an antibody according to the present invention or an antigen binding fragment thereof, which preferably binds to at least 6, preferably to at least 8, more preferably to all 1 0 of the HBsAg genotypes A, B, C, D, E, F, G, H, I, and J, an antibody is provided, which binds very broadly to the different genotypes.
- the antibody according to the present invention binds to 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, 1 1 , 12, 1 3, 14, 1 5, 1 6, 1 7 or 1 8 of the HBsAg mutants having mutations in the antigenic loop region: HBsAg Y100C/P120T, HBsAg P120T, HBsAg P120T/S143L, HBsAg C121 S, HBsAg R122D, HBsAg R122I, HBsAg T123N, HBsAg Q129H, HBsAg Q129L, HBsAg M1 33H, HBsAg M1 33L, HBsAg M133T, HBsAg K141 E, HBsAg P142S, HBsAg S143K, HBsAg D144A, HBsAg G145R and HBsAg N146A.
- Those mutants are naturally occurring mutants
- amino acid sequences of the antigenic loop region of the S domain of HBsAg of the different mutants is shown in Table 1 (SEQ ID NO's: 1 6 - 33).
- the antibody according to the present invention binds to at least 12, even more preferably to at least 1 5, and particularly preferably to all 1 8 of the infectious HBsAg mutants having mutations in the antigenic loop region: HBsAg Y1 00C/P120T, HBsAg P120T, HBsAg P120T/S143L, HBsAg C121 S, HBsAg R122D, HBsAg R122I, HBsAg T123N, HBsAg Q129H, HBsAg Q129L, HBsAg M1 33H, HBsAg M1 33L, HBsAg M1 33T, HBsAg K141 E, HBsAg P142S, HBsAg S143K, HBsAg D144A, HBsAg G145R and HBsAg N1 46A.
- the antibody according to the present invention binds to an epitope comprising at least one, preferably at least two, more preferably at least three amino acids, even more preferably at least four amino acids of the antigenic loop region of HBsAg, wherein the at least two, preferably the at least three, more preferably the at least four amino acids are selected from amino acids 1 15 - 133 of the S domain of HBsAg, preferably from amino acids 120 - 1 33 of the S domain of HBsAg, more preferably from amino acids 120 - 130 of the S domain of HBsAg.
- the position of the amino acids e.g.
- 1 1 5 - 1 33, 120 - 1 33, 120 - 1 30 refers to the S domain of HBsAg as described above, which is present in all three HBV envelope proteins S-HBsAg, M-HBsAg, and L- HBsAg, whereby S-HBsAg typically corresponds to the S domain of HBsAg.
- the antibody according to the present invention binds to an epitope in the antigenic loop region of HBsAg, whereby the epitope is typically formed by one or more amino acids located at positions selected from amino acid positions 1 15 -133, preferably selected from amino acid positions 120 -133, more preferably selected from amino acid positions 120 -130 of the S domain of HBsAg.
- epitope formed by means, that the epitope to which the antibody of the invention, or an antigen binding fragment thereof, binds to may be linear (continuous) or conformational (discontinuous).
- a linear or a sequential epitope is an epitope that is recognized by antibodies by its linear sequence of amino acids, or primary structure.
- a conformational epitope has a specific three-dimensional shape and protein structure.
- the epitope is a linear epitope and comprises more than one amino acid located at positions selected from amino acid positions 1 1 5 -1 33, preferably selected from amino acid positions 120 -133 of the S domain of HBsAg
- the amino acids comprised by the epitope are typically located in adjacent positions of the primary structure (i.e. consecutive amino acids in the amino acid sequence).
- the amino acid sequence typically forms a 3D structure as epitope and, thus, the amino acids forming the epitope (or the amino acids "comprised by" the epitope) may be or may be not located in adjacent positions of the primary structure (i.e. maybe or may be not consecutive amino acids in the amino acid sequence).
- the epitope to which the antibody of the invention, or an antigen binding fragment thereof, binds to is only formed by amino acid(s) selected from amino acid positions 1 1 5 - 1 33, preferably selected from amino acid positions 120 -1 33, more preferably selected from amino acid positions 120 -1 30 of the S domain of HBsAg.
- amino acid(s) selected from amino acid positions 1 1 5 - 1 33, preferably selected from amino acid positions 120 -1 33, more preferably selected from amino acid positions 120 -1 30 of the S domain of HBsAg.
- the epitope in the antigenic loop region of HBsAg to which the antibody of the invention, or an antigen binding fragment thereof, bind are formed by two or more amino acids located at positions selected from amino acid positions 1 1 5 -133, preferably selected from amino acid positions 120 -1 33, more preferably selected from amino acid positions 120 -1 30 of the S domain of HBsAg. More preferably, the epitope in the antigenic loop region of HBsAg to which the antibody of the invention, or an antigen binding fragment thereof, bind are formed by three or more amino acids located at positions selected from amino acid positions 1 1 5 -1 33, preferably selected from amino acid positions 120 -1 33, more preferably selected from amino acid positions 120 -130 of the S domain of HBsAg.
- the epitope in the antigenic loop region of HBsAg to which the antibody of the invention, or an antigen binding fragment thereof, bind are formed by four or more amino acids located at positions selected from amino acid positions 1 1 5 -133, preferably selected from amino acid positions 120 -133, more preferably selected from amino acid positions 120 - 1 30 of the S domain of HBsAg.
- the antibody according to the present invention binds to at least one, preferably at least two, more preferably at least three, even more preferably to at least four amino acids of the antigenic loop region of HBsAg selected from amino acid 1 15 - amino acid 1 33 of the S domain of HBsAg, preferably from amino acid 120 - amino acid 1 33 of the S domain of HBsAg, more preferably selected from amino acids 120 -1 30 of the S domain of HBsAg.
- the antibody according to the present invention binds to an epitope comprising at least two, preferably at least three, more preferably at least four amino acids of the antigenic loop region of HBsAg, wherein the at least two, preferably the at least three, more preferably the at least four amino acids are selected from amino acid 120 - amino acid 1 3, preferably from amino acids 1 20 - 1 30 of The S domain of HBsAg and wherein the at least two, preferably the at least three, more preferably the at least four amino acids are located in adjacent positions (i.e. are consecutive amino acids in the amino acid sequence/primary structure).
- the epitope to which the antibody according to the present i nvention, or an antigen bi nding fragment thereof, bi nds to, is preferably a conformational epitope. Accordingly, it is preferred that the antibody according to the present invention, or an antigen bindi ng fragment thereof, binds to an epitope comprising at least two, preferably at least three, more preferably at least four amino acids of the antigenic loop region of HBsAg, wherein the at least two, preferably the at least three, more preferably the at least four amino acids are selected from amino acids 1 20 - 1 33, preferably from amino acids 120 - 1 30, of the S domain of HBsAg and wherein at least two, preferably at least three, of the at least two, preferably the at least three, more preferably the at least four amino acids are not located in adjacent positions (of the primary structure).
- the ami no acids forming the epitope), which are not located in adjacent positions of the primary structure, are typically spaced apart by one or more ami no acids, to which the antibody does not bi nd to.
- at least one, more preferably at least two, even more preferably at least three, most preferably at least four, particularly preferably at least five ami no acids may be located between the at least two, preferably at least three, ami no acids, which are comprised by the epitope and which are not located in adjacent positions.
- the epitope to which the antibodies of the invention binds to may be linear (continuous) or conformational (discontinuous).
- the antibody and antibody fragments of the i nvention binds to a conformational epitope, more preferably the conformational epitope is present only under non-reducing conditions.
- the antibody according to the present invention binds to a linear epitope, more preferably the linear epitope is present under both, non-reduci ng conditions and reducing conditions.
- the antibody according to the present invention, or an antigen bindi ng fragment thereof binds to an epitope in the antigenic loop of H BsAg formed by an amino acid sequence accordi ng to SEQ ID NO: 1 :
- ⁇ ⁇ , X 2 , X 3 , X4, X5, Xe and X 7 may be any amino acid (SEQ I D NO: 1 ).
- Xi, X 2 , X3, X4, X5, e and X 7 are amino acids, which are conservatively substituted in comparison to amino acids 1 20 - 1 30 of SEQ ID NO: 3. It is also preferred that Xi, X 2 , X3, X 4 , X5, e and X 7 are ami no acids, which are conservatively substituted in comparison to amino acids 20 - 30 of any of SEQ ID NO's 5 - 33 (cf. Table 1 ; referring to the antigenic loop region sequences, i .e. aa 1 01 - 1 72 of the S domain of different variants of HBsAC).
- Xi is a smal l amino acid.
- a "smal l" amino acid refers to any amino acid selected from the group consisting of alani ne, aspartic acid, asparagine, cysteine, glycine, proli ne, serine, threonine and vali ne. More preferably, Xi is proline, serine or threonine.
- X 2 is a smal l amino acid. More preferably, X 2 is cystein or threonine.
- X 3 is a charged amino acid or an aliphatic amino acid.
- a “charged” amino acid refers to any amino acid selected from the group consisting of arginine, lysine, aspartic acid, glutamic acid and histidine.
- a “aliphatic” amino acid refers to any amino acid selected from the group consisting of alanine, glycine, isoleucine, leucine, and valine. More preferably, X3 is arginine, lysine, aspartic acid or isoleucine.
- X 4 is a small amino acid and/or a hydrophobic amino acid.
- a "hydrophobic" amino acid refers to any amino acid selected from the group consisting of alanine, isoleucine, leucine, phenylalanine, valine, tryptophan, tyrosin, methionine, proline and glycine. More preferably, X 4 is methionine or threonine.
- X 5 is a small amino acid and/or a hydrophobic amino acid. More preferably, X5 is threonine, alanine or isoleucine.
- Xe is a small amino acid and/or a hydrophobic amino acid. More preferably, Xe is threonine, proline or leucine.
- X 7 is a polar amino acid or an aliphatic amino acid.
- a "polar" amino acid refers to any amino acid selected from the group consisting of aspartic acid, asparagine, arginine, glutamic acid, histidine, lysine, glutamine, tryptophan, tyrosine, serine, and threonine. More preferably, X 7 is glutamine, histidine or leucine.
- the antibody according to the present invention or an antigen binding fragment thereof, binds to an epitope in the antigenic loop of HBsAg formed by an amino acid sequence, according to SEQ ID NO: 2:
- X 3 is R, K, D or I
- X 4 is M or T
- Xs is T, A or I
- Xe is T, P or L, and X 7 is Q, H or L
- the term "formed by” as used herein is in particular not intended to imply that the antibody necessarily binds to each and every amino acid of SEQ ID NO: 1 or 2.
- the antibody may bind only to some of the amino acids of SEQ ID NO: 1 or 2, whereby other amino acid residues may merely act as "spacers", thereby providing the 3D structure of the epitope.
- the antibody according to the present invention binds to an epitope in the antigenic loop of HBsAg formed by one or more, preferably by two or more, more preferably by three or more and even more preferably by four or more amino acids of an amino acid sequence selected from SEQ ID NO's 5 - 33 shown below in Table 1 .
- the antibody according to the present invention, or an antigen binding fragment thereof binds to an antigenic loop region of HBsAg having an amino acid sequence according to any of SEQ ID NO's 5 - 33 shown below in Table 1 or to a sequence variant thereof. Even more preferably, the antibody according to the present invention, or an antigen binding fragment thereof, binds to all of the antigenic loop variants of HBsAg having an amino acid sequence according to any of SEQ ID NO's 5 - 33 shown below in Table 1 .
- the antibody according to the present invention is able to bind to all of the different antigenic loop regions of HBsAg having an amino acid sequence according to any of SEQ ID NO's 5 - 33.
- Table 1 Exemplary amino acid sequences of the antigenic loop region of the S domain of HBsAg (residues 101 -1 72 of the S domain of HBsAg - except for SEQ ID NO: 1 6 which refers to residues 1 00-1 72 of the S domain of HBsAg in order to include the relevant mutation) of the different genotypes and mutants as used herein.
- SEQ Amino acid sequence SEQ Amino acid sequence
- J02203 (D, ayw3) 5 QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPS
- FJ899792 (D, 6 QGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSMYPS adw2) CCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSW
- the antibody according to the present invention preferably comprises (at least) three complementarity determining regions (CDRs) on a heavy chain and (at least) three CDRs on a light chain.
- complementarity determining regions (CDRs) are the hypervariable regions present in heavy chain variable domains and light chain variable domains.
- the CDRs of a heavy chain and the connected light chain of an antibody together form the antigen receptor.
- the three CDRs (CDR1 , CDR2, and CDR3) are arranged non-consecutively in the variable domain.
- antigen receptors are typically composed of two variable domains (on two different polypeptide chains, i.e. heavy and light chain), there are six CDRs for each antigen receptor (heavy chain: CDRH1 , CDRH2, and CDRH3; light chain: CDRL1 , CDRL2, and CDRL3).
- a single antibody molecule usually has two antigen receptors and therefore contains twelve CDRs.
- the CDRs on the heavy and/or light chain may be separated by framework regions, whereby a framework region (FR) is a region in the variable domain which is less "variable" than the CDR.
- FR framework region
- a chain or each chain, respectively
- the sequences of the heavy chains and light chains of an exemplary antibody of the invention, comprising three different CDRs on the heavy chain and three different CDRs on the light chain were determined.
- the position of the CDR amino acids are defined according to the IMGT numbering system (IMGT: http://www.imgt.org/; cf. Lefranc, M.-P. et al. (2009) Nucleic Acids Res. 37, D1 006-D1012).
- Table 2 shows the amino acid sequences of the CDR's and the heavy chain variable region (VH) and the light chain variable region (VL) of an exemplary antibody according to the present invention (“HBC34”):
- CDRL2 39 VIYEVKYRP
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises amino acid sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to at least one of the CDR sequences, the VH sequence and/or the VL sequence shown in Table 2.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein at least one CDR, preferably the at least one heavy chain CDRH3, comprises or consists of an amino acid sequence according to SEQ ID NO: 36 or a functional sequence variant thereof as described herein.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein the at least one heavy chain CDRH1 comprises an amino acid sequence according to SEQ ID NO: 34 or a functional sequence variant thereof, the at least one CDRH2 comprises an amino acid sequence according to SEQ ID NO: 35 or a functional sequence variant thereof and/or the at least one heavy chain CDRH3 comprises an amino acid sequence according to SEQ ID NO: 36 or a functional sequence variant thereof.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain comprising at least one CDRH1 , at least one CDRH2 and at least one CDRH3 and a light chain comprising at least one CDRL1 , at least one CDRL2 and at least one CDRL3, wherein the at least one CDRL1 comprises an amino acid sequence according to SEQ ID NO: 37 or a functional sequence variant thereof, the at least one CDRL2 comprises an amino acid sequence according to SEQ ID NO: 38 or 39 or a functional sequence variant thereof, and/or the at least one CDRL3 amino comprises an amino acid sequence according to SEQ ID NO: 40 or a functional sequence variant thereof.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises CDRH1 , CDRH2, and CDRH3 amino acid sequences and CDRL1 , CDRL2, and CDRL3 amino acid sequences according to SEQ ID NOs: 34 - 38 and 40 or functional sequence variants thereof or according to SEQ ID NOs: 34 - 37 and 39 - 40 or functional sequence variants thereof, respectively.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises a heavy chain variable region (VH) amino acid sequence according to SEQ ID NO: 41 or a functional sequence variant thereof and/or a light chain variable region (VL) amino acid sequence according to SEQ ID NO: 42 or a functional sequence variant thereof.
- VH heavy chain variable region
- VL light chain variable region
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises at least one heavy chain CDRH1 , CDRH2 and CDRH3 and light chain CDRL1 , CDRL2, and CDRL3 amino acid sequences that are at least 80%, for example, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 1 00% identical to the amino acid sequences of SEQ ID NO's: 34 - 38 and 40 or to the amino acid sequences of SEQ ID NOs: 34 - 37 and 39 - 40, respectively.
- the antibody, or the antigen binding fragment thereof, according to the present invention comprises at least one heavy chain variable region (VH) and at least one light chain variable region (VL) amino acid sequence that is at least 80%, for example, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 1 00% identical to the amino acid sequences of SEQ ID NOs: 41 - 42.
- the antibody, or the antigen binding fragment thereof, according to the present invention is gHBC34, in particular, the antibody, or the antigen binding fragment thereof, according to the present invention is HBC34.
- the present inventors have isolated a monoclonal antibody (mAb) according to the present invention, which is referred to herein as HBC34 (cf. Example 1 ). Based on that antibody HBC34, in particular on the VH and VL genes of HBC34, the term "gHBC34", as used herein, refer to a respective "generic" antibody, or antigen binding fragments thereof.
- gHBC34 refers to an antibody, or antigen binding fragment thereof, having a CDRH1 amino acid sequence according to SEQ ID NO: 34, a CDRH2 amino acid sequence according to SEQ ID NO: 35, a CDRH3 amino acid sequence according to SEQ ID NO: 36, a CDRL1 amino acid sequence according to SEQ ID NO: 37, a CDRL2 amino acid sequence according to SEQ ID NO: 38 or 39, and a CDRL3 amino acid sequence according to SEQ ID NO: 40.
- the heavy chain variable region (VH) of "gHBC34” has an amino acid sequence according to SEQ ID NO: 41 and the light chain variable region (V L ) of "gHBC34" has an amino acid sequence according to SEQ ID NO: 42.
- the antibody according to the present invention is a human antibody, a monoclonal antibody, a human monoclonal antibody, a purified antibody, a single chain antibody, Fab, Fab', F(ab')2, Fv or scFv.
- the antibodies of the invention may thus be human antibodies, monoclonal antibodies, human monoclonal antibodies, recombinant antibodies or purified antibodies.
- the invention also provides fragments of the antibodies of the invention, particularly fragments that retain the antigen-binding activity of the antibodies. Such fragments include, but are not limited to, single chain antibodies, Fab, Fab', F(ab')2, Fv or scFv. Fragments of the antibodies of the invention can be obtained from the antibodies by methods that include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by chemical reduction. Alternatively, fragments of the antibodies can be obtained by cloning and expression of part of the sequences of the heavy or light chains.
- Antibody "fragments” include Fab, Fab', F(ab')2 and Fv fragments.
- the invention also encompasses single-chain Fv fragments (scFv) derived from the heavy and light chains of an antibody of the invention.
- scFv single-chain Fv fragments
- the invention includes a scFv comprising the CDRs from an antibody of the invention.
- heavy or light chain monomers and dimers single domain heavy chain antibodies, single domain light chain antibodies, as well as single chain antibodies, e.g., single chain Fv in which the heavy and light chain variable domains are joined by a peptide linker.
- Antibody fragments of the invention may impart monovalent or multivalent interactions and be contained in a variety of structures as described above.
- scFv molecules may be synthesized to create a trivalent "triabody” or a tetravalent "tetrabody”.
- the scFv molecules may include a domain of the Fc region resulting in bivalent minibodies.
- the sequences of the invention may be a component of multispecific molecules in which the sequences of the invention target the epitopes of the invention and other regions of the molecule bind to other targets.
- Exemplary molecules include, but are not limited to, bispecific Fab2, trispecific Fab3, bispecific scFv, and diabodies (Holliger and Hudson, 2005, Nature Biotechnology 9: 1 126-1 1 36).
- the present invention provides the antibody, or the antigen binding fragment thereof, according to the present invention as described herein for use as a medicament.
- the antibody, or the antigen binding fragment thereof, according to the present invention as described herein is for use in the prophylaxis, treatment or attenuation of hepatitis B and/or hepatitis D.
- hepatitis B and/or hepatitis D are examples of hepatitis B and/or hepatitis D.
- the invention also provides a nucleic acid molecule comprising a polynucleotide encoding the antibody, or the antigen binding fragment thereof, according to the present invention as described above.
- Nucleic acid sequences encoding part or all of the light and heavy chains and CDRs of the antibodies of the present invention are preferred.
- Preferably provided herein are thus nucleic acid sequences encoding part or all of the light and heavy chains, in particular VH and VL sequences and CDRs of the exemplary antibodies of the invention.
- Table 3 below provides the SEQ ID numbers for the nucleic acid sequences encoding the CDRs and VH and VL an exemplified antibody according to the present invention.
- nucleic acid molecule is a molecule comprising, preferably consisting of nucleic acid components.
- nucleic acid molecule preferably refers to DNA or RNA molecules.
- it is used synonymous with the term "polynucleotide".
- a nucleic acid molecule is a polymer comprising or consisting of nucleotide monomers which are covalently linked to each other by phosphodiester-bonds of a sugar/phosphate-backbone.
- nucleic acid molecule also encompasses modified nucleic acid molecules, such as base- modified, sugar-modified or backbone-modified etc. DNA or RNA molecules.
- Table 3 shows the nucleic acid sequences of the CDR's and the heavy chain variable region (VH) and the light chain variable region (VL) of an exemplary antibody according to the present invention (“HBC34”):
- HBC34 SEQ ID NO. Nucleic acid sequence
- CDRH2 44 ATAAACCAAGATGGAAGTGAGAAA
- CDRL2 48 gtcatctatGAGGTTAAAtaccgcccc
- CDRL3 49 CAGACGTGGGACAGCACCACTGTGGTG
- VL 51 TCCTATGAGCTGACTCAGCCACCCTCAGTGTCCGTGTCCC
- the sequence of the nucleic acid molecule according to the present invention comprises or consists of a nucleic acid sequence according to any one of SEQ ID NOs: 43 - 51 or a functional sequence variant thereof.
- nucleic acid sequences according to the invention include nucleic acid sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to the nucleic acid encoding a CDR, a VH sequence and/or a VL sequence used in an (exemplary) antibody according to the present invention, for example to the sequences shown in Table 3.
- a nucleic acid molecule is preferred, wherein the polynucleotide sequence comprises or consists of a nucleic acid sequence according to any one of SEQ ID NOs: 43 - 51 or a functional sequence variant thereof.
- the nucleic acid molecule may be manipulated to insert, delete or alter certain nucleic acid sequences. Changes from such manipulation include, but are not limited to, changes to introduce restriction sites, to amend codon usage, to add or optimize transcription and/or translation regulatory sequences, etc. It is also possible to change the nucleic acid to alter the encoded amino acids. For example, it may be useful to introduce one or more ⁇ e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, etc.) amino acid substitutions, deletions and/or insertions into the antibody's amino acid sequence.
- Such point mutations can modify effector functions, antigen-binding affinity, post-translational modifications, immunogenicity, etc., can introduce amino acids for the attachment of covalent groups (e.g., labels) or can introduce tags (e.g., for purification purposes). Mutations can be introduced in specific sites or can be introduced at random, followed by selection (e.g., molecular evolution). For instance, one or more nucleic acids encoding any of the CDR regions, a VH sequence and/or a VL sequence of an (exemplary) antibody of the invention can be randomly or directionally mutated to introduce different properties in the encoded amino acids. Such changes can be the result of an iterative process wherein initial changes are retained and new changes at other nucleotide positions are introduced. Further, changes achieved in independent steps may be combined. Different properties introduced into the encoded amino acids may include, but are not limited to, enhanced affinity.
- vectors for example, expression vectors, comprising a nucleic acid molecule according to the present invention.
- a vector comprises a nucleic acid molecule as described above.
- the term "vector” refers to a nucleic acid molecule, preferably to a recombinant nucleic acid molecule, i.e. a nucleic acid molecule which does not occur in nature.
- a vector in the context of the present invention is suitable for incorporating or harboring a desired nucleic acid sequence.
- Such vectors may be storage vectors, expression vectors, cloning vectors, transfer vectors etc.
- a storage vector is a vector which allows the convenient storage of a nucleic acid molecule.
- the vector may comprise a sequence corresponding, e.g., to a desired antibody or antibody fragment thereof according to the present invention.
- An expression vector may be used for production of expression products such as RNA, e.g. mRNA, or peptides, polypeptides or proteins.
- an expression vector may comprise sequences needed for transcription of a sequence stretch of the vector, such as a promoter sequence.
- a cloning vector is typically a vector that contains a cloning site, which may be used to incorporate nucleic acid sequences into the vector.
- a cloning vector may be, e.g., a plasmid vector or a bacteriophage vector.
- a transfer vector may be a vector which is suitable for transferring nucleic acid molecules into cells or organisms, for example, viral vectors.
- a vector in the context of the present invention may be, e.g., an RNA vector or a DNA vector.
- a vector is a DNA molecule.
- a vector in the sense of the present application comprises a cloning site, a selection marker, such as an antibiotic resistance factor, and a sequence suitable for multiplication of the vector, such as an origin of replication.
- a vector in the context of the present application is a plasmid vector.
- the present invention also provides cell expressing the antibody, or the antigen binding fragment thereof, according to the present invention; and/or comprising the vector according the present invention.
- examples of such cells include but are not limited to, eukaryotic cells, e.g., yeast cells, animal cells or plant cells.
- the cells are mammalian cells, more preferably a mammalian cell line.
- Preferred examples include human cells, CHO cells, HEK293T cells, PER.C6 cells, NSO cells, human liver cells, e.g. Hepa RG cells, myeloma cells or hybridoma cells.
- the cell may be transfected with a vector according to the present invention, preferably with an expression vector.
- transfection refers to the introduction of nucleic acid molecules, such as DNA or RNA (e.g. mRNA) molecules, into cells, preferably into eukaryotic cells.
- the term “transfection” encompasses any method known to the skilled person for introducing nucleic acid molecules into cells, preferably into eukaryotic cells, such as into mammalian cells. Such methods encompass, for example, electroporation, lipofection, e.g. based on cationic lipids and/or liposomes, calcium phosphate precipitation, nanoparticle based transfection, virus based transfection, or transfection based on cationic polymers, such as DEAE-dextran or polyethylenimine etc.
- the introduction is non-viral.
- the cells of the present invention may be transfected stably or transiently with the vector according to the present invention, e.g. for expressing the antibody, or the antigen binding fragment thereof, according to the present invention.
- the cells are stably transfected with the vector according to the present invention encoding the antibody, or the antigen binding fragment thereof, according to the present invention.
- the cells are transiently transfected with the vector according to the present invention encoding the antibody, or the antigen binding fragment thereof, according to the present invention.
- Antibodies of the invention may be coupled, for example, to a drug for delivery to a treatment site or coupled to a detectable label to faci litate imaging of a site comprising cells of interest.
- Methods for coupling antibodies to drugs and detectable labels are well known in the art, as are methods for imaging using detectable labels.
- Labeled antibodies may be employed in a wide variety of assays, employing a wide variety of labels. Detection of the formation of an antibody-antigen complex between an antibody of the invention and an epitope of interest on HBsAg, in particular on the antigenic loop region of HBsAg, can be facilitated by attaching a detectable substance to the antibody.
- Suitable detection means include the use of labels such as radionuclides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
- labels such as radionuclides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase;
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material is luminol;
- examples of bioluminescent materials include luciferase, luciferin, and aequorin; and
- suitable radioactive material include 1251, 131 1, 35S, or 3H.
- labeled reagents may be used in a variety of well-known assays, such as radioimmunoassays, enzyme immunoassays, e.g., ELISA, fluorescent immunoassays, and the like.
- Labeled antibodies according to the present invention may be thus be used in such assays for example as described in US 3,766,1 62; US 3,791 ,932; US 3,81 7,837; and US 4,233,402.
- An antibody according to the invention may be conjugated to a therapeutic moiety such as a cytotoxin, a therapeutic agent, or a radioactive metal ion or radioisotope.
- a therapeutic moiety such as a cytotoxin, a therapeutic agent, or a radioactive metal ion or radioisotope.
- radioisotopes include, but are not limited to, 1-1 31 , 1-123, 1-125, Y-90, Re-1 88, Re-186, At- 21 1 , Cu-67, Bi-212, Bi-213, Pd-109, Tc-99, ln-1 1 1 , and the like.
- Such antibody conjugates can be used for modifying a given biological response; the drug moiety is not to be construed as limited to classical chemical therapeutic agents.
- the drug moiety may be a protein or polypeptide possessing a desired biological activity.
- Such proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin.
- Techniques for conjugating such therapeutic moiety to antibodies are well known. See, for example, Arnon et al. (1 985) "Monoclonal Antibodies for Immunotargeting of Drugs in Cancer Therapy," in Monoclonal Antibodies and Cancer Therapy, ed. Reisfeld et al. (Alan R. Liss, Inc.), pp. 243-256; ed. Hellstrom et al. (1987) "Antibodies for Drug Delivery,” in Controlled Drug Delivery, ed. Robinson et al.
- an antibody, or antibody fragment thereof can be conjugated to a second antibody, or antibody fragment thereof, to form an antibody heteroconjugate as described in US 4,676,980.
- linkers may be used between the labels and the antibodies of the invention, e.g., as described in US 4,831 ,1 75.
- Antibodies or, antigen-binding fragments thereof may be directly labeled with radioactive iodine, indium, yttrium, or other radioactive particle known in the art, e.g., as described in US 5,595,721 .
- Treatment may consist of a combination of treatment with conjugated and non-conjugated antibodies administered simultaneously or subsequently e.g., as described in WO00/52031 ; WOOO/52473.
- Antibodies of the invention may also be attached to a solid support.
- antibodies of the invention, or functional antibody fragments thereof can be chemically modified by covalent conjugation to a polymer to, for example, increase their circulating half-life. Examples of polymers, and methods to attach them to peptides, are shown in US 4,766,1 06; US 4, 1 79,337; US 4,495,285 and US 4,609,546.
- the polymers may be selected from polyoxyethylated polyols and polyethylene glycol (PEG).
- PEG is soluble in water at room temperature and has the general formula: R(0-CH 2 -CH 2 ) n O-R, wherein R can be hydrogen, or a protective group such as an alkyl or alkanol group.
- the protective group may have between 1 and 8 carbons.
- the protective group is methyl.
- the symbol n is a positive integer. In one embodiment n is between 1 and 1 ,000. In another embodiment n is between 2 and 500.
- the PEG has an average molecular weight between 1 ,000 and 40,000, more preferably the PEG has a molecular weight between 2,000 and 20,000, even more preferably the PEG has a molecular weight between 3,000 and 12,000.
- PEG may have at least one hydroxy group, for example the PEG may have a terminal hydroxy group.
- the PEG is the terminal hydroxy group which is activated to react with a free amino group on the inhibitor.
- the type and amount of the reactive groups may be varied to achieve a covalently conjugated PEG/antibody of the present invention.
- Water-soluble polyoxyethylated polyols are also useful in the present invention. They include polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG), and the like. In one embodiment, POG is used. Without being bound by any theory, because the glycerol backbone of polyoxyethylated glycerol is the same backbone occurring naturally in, for example, animals and humans in mono-, di-, triglycerides, this branchi ng would not necessarily be seen as a foreign agent in the body. POG may have a molecular weight in the same range as PEG.
- liposome Another drug delivery system that can be used for i ncreasi ng circulatory half-life is the liposome.
- Methods of preparing liposome delivery systems are known to one of ski l l in the art.
- Other drug delivery systems are known in the art and are described in, for example, referenced in Poznansky et al. (1 980) and Poznansky (1 984).
- Antibodies of the i nvention may be provided in purified form. Typical ly, the antibody will be present in a composition that is substantial ly free of other polypeptides e.g., where less than 90% (by weight), usual ly less than 60% and more usually less than 50% of the composition is made up of other polypeptides.
- Antibodies of the invention may be immunogenic in non-human (or heterologous) hosts e.g., in mice.
- the antibodies may have an idiotope that is immunogenic in non-human hosts, but not in a human host.
- antibodies of the invention for human use include those that cannot be easi ly isolated from hosts such as mice, goats, rabbits, rats, non-primate mammals, etc. and cannot generally be obtai ned by humanization or from xeno-mice.
- Antibodies according to the invention can be made by any method known in the art.
- the general methodology for making monoclonal antibodies usi ng hybridoma technology is wel l known (Kohler, G. and Mi lstein, C,. 1 975; Kozbar et al. 1 983).
- the alternative EBV immortal ization method described in WO2004/076677 is used.
- B cells producing the antibody of the invention are transformed with EBV and a polyclonal B cell activator. Additional stimulants of cel lular growth and differentiation may optional ly be added during the transformation step to further enhance the efficiency. These stimulants may be cytokines such as IL-2 and 1L-1 5. In one aspect, IL-2 is added during the immortalization step to further improve the efficiency of immortalization, but its use is not essential.
- the immortalized B cells produced using these methods can then be cultured using methods known in the art and antibodies isolated therefrom.
- WO 2010/046775 plasma cells are cultured in limited numbers, or as single plasma cells in microwell culture plates.
- Antibodies can be isolated from the plasma cell cultures. Further, from the plasma cell cultures, RNA can be extracted and PCR can be performed using methods known in the art.
- the VH and VL regions of the antibodies can be amplified by RT-PCR (reverse transcriptase PCR), sequenced and cloned into an expression vector that is then transfected into HEK293T cells or other host cells.
- RT-PCR reverse transcriptase PCR
- the cloning of nucleic acid in expression vectors, the transfection of host cells, the culture of the transfected host cells and the isolation of the produced antibody can be done using any methods known to one of skill in the art.
- the antibodies may be further purified, if desired, using filtration, centrifugation and various chromatographic methods such as HPLC or affinity chromatography. Techniques for purification of antibodies, e.g., monoclonal antibodies, including techniques for producing pharmaceutical-grade antibodies, are well known in the art.
- Fragments of the antibodies of the invention can be obtained from the antibodies by methods that include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by chemical reduction. Alternatively, fragments of the antibodies can be obtained by cloning and expression of part of the sequences of the heavy or light chains.
- Antibody "fragments” include Fab, Fab', F(ab')2 and Fv fragments.
- the invention also encompasses single-chain Fv fragments (scFv) derived from the heavy and light chains of an antibody of the invention.
- the invention includes a scFv comprising the CDRs from an antibody of the invention.
- heavy or light chain monomers and dimers single domain heavy chain antibodies, single domain light chain antibodies, as well as single chain antibodies, e.g., single chain Fv in which the heavy and light chain variable domains are joined by a peptide linker.
- Antibody fragments of the invention may impart monovalent or multivalent interactions and be contained in a variety of structures as described above.
- scFv molecules may be synthesized to create a trivalent "triabody” or a tetravalent "tetrabody.”
- the scFv molecules may include a domain of the Fc region resulting in bivalent minibodies.
- sequences of the invention may be a component of multispecific molecules in which the sequences of the invention target the epitopes of the invention and other regions of the molecule bind to other targets.
- exemplary molecules include, but are not limited to, bispecific Fab2, trispecific Fab3, bispecific scFv, and diabodies (Holliger and Hudson, 2005, Nature Biotechnology 9: 1 126-1 136).
- Standard techniques of molecular biology may be used to prepare DNA sequences encoding the antibodies or antibody fragments of the present invention. Desired DNA sequences may be synthesized completely or in part using oligonucleotide synthesis techniques. Site-directed mutagenesis and polymerase chain reaction (PCR) techniques may be used as appropriate.
- PCR polymerase chain reaction
- Any suitable host cell/vector system may be used for expression of the DNA sequences encoding the antibody molecules of the present invention or fragments thereof.
- Bacterial, for example E. coli, and other microbial systems may be used, in part, for expression of antibody fragments such as Fab and F(ab')2 fragments, and especially Fv fragments and single chain antibody fragments, for example, single chain Fvs.
- Eukaryotic, e.g., mammalian, host cell expression systems may be used for production of larger antibody molecules, including complete antibody molecules.
- Suitable mammalian host cells include, but are not limited to, CHO, HEK293T, PER.C6, NS0, myeloma or hybridoma cells.
- the present invention also provides a process for the production of an antibody molecule according to the present invention comprising culturing a host cell comprising a vector encoding a nucleic acid of the present invention under conditions suitable for expression of protein from DNA encoding the antibody molecule of the present invention, and isolating the antibody molecule.
- the antibody molecule may comprise only a heavy or light chain polypeptide, in which case only a heavy chain or light chain polypeptide coding sequence needs to be used to transfect the host cells.
- the cell line may be transfected with two vectors, a first vector encoding a light chain polypeptide and a second vector encoding a heavy chain polypeptide.
- a single vector may be used, the vector including sequences encoding light chain and heavy chain polypeptides.
- antibodies according to the invention may be produced by (i) expressing a nucleic acid sequence according to the invention in a host cell, e.g.
- the method may include (iii) purifying the isolated antibody.
- Transformed B cells and cultured plasma cells may be screened for those producing antibodies of the desired specificity or function.
- the screening step may be carried out by any immunoassay, e.g., ELISA, by staining of tissues or cells (including transfected cells), by neutralization assay or by one of a number of other methods known in the art for identifying desired specificity or function.
- the assay may select on the basis of simple recognition of one or more antigens, or may select on the additional basis of a desired function e.g., to select neutralizing antibodies rather than just antigen- binding antibodies, to select antibodies that can change characteristics of targeted cells, such as their signaling cascades, their shape, their growth rate, their capability of influencing other cells, their response to the influence by other cells or by other reagents or by a change in conditions, their differentiation status, etc.
- Individual transformed B cell clones may then be produced from the positive transformed B cell culture.
- the cloning step for separating individual clones from the mixture of positive cells may be carried out using limiting dilution, micromanipulation, single cell deposition by cell sorting or another method known in the art.
- Nucleic acid from the cultured plasma cells can be isolated, cloned and expressed in HEK293T cells or other known host cells using methods known in the art.
- the immortalized B cell clones or the transfected host-cells of the invention can be used in various ways e.g., as a source of monoclonal antibodies, as a source of nucleic acid (DNA or mRNA) encoding a monoclonal antibody of interest, for research, etc.
- the invention also provides a composition comprising immortalized B memory cells or transfected host cells that produce antibodies according to the present invention.
- the immortalized B cell clone or the cultured plasma cells of the invention may also be used as a source of nucleic acid for the cloning of antibody genes for subsequent recombinant expression.
- Expression from recombinant sources is more common for pharmaceutical purposes than expression from B cells or hybridomas e.g., for reasons of stability, reproducibility, culture ease, etc.
- the invention also provides a method for preparing a recombinant cell, comprising the steps of: (i) obtaining one or more nucleic acids ⁇ e.g., heavy and/or light chain mRNAs) from the B cell clone or the cultured plasma cells that encodes the antibody of interest; (ii) inserting the nucleic acid into an expression vector and (iii) transfecting the vector into a host cell in order to permit expression of the antibody of interest in that host cell.
- nucleic acids ⁇ e.g., heavy and/or light chain mRNAs
- the invention provides a method for preparing a recombinant cell, comprising the steps of: (i) sequencing nucleic acid(s) from the B cell clone or the cultured plasma cells that encodes the antibody of interest; and (ii) using the sequence information from step (i) to prepare nucleic acid(s) for insertion into a host cell in order to permit expression of the antibody of interest in that host cell.
- the nucleic acid may, but need not, be manipulated between steps (i) and (ii) to introduce restriction sites, to change codon usage, and/or to optimize transcription and/or translation regulatory sequences.
- the invention also provides a method of preparing a transfected host cell, comprising the step of transfecting a host cell with one or more nucleic acids that encode an antibody of interest, wherein the nucleic acids are nucleic acids that were derived from an immortalized B cell clone or a cultured plasma cell of the invention.
- the procedures for first preparing the nucleic acid(s) and then using it to transfect a host cell can be performed at different times by different people in different places (e.g., in different countries).
- These recombinant cells of the invention can then be used for expression and culture purposes. They are particularly useful for expression of antibodies for large-scale pharmaceutical production. They can also be used as the active ingredient of a pharmaceutical composition.
- Any suitable culture technique can be used, including but not limited to static culture, roller bottle culture, ascites fluid, hollow-fiber type bioreactor cartridge, modular minifermenter, stirred tank, microcarrier culture, ceramic core perfusion, etc.
- the transfected host cell may be a eukaryotic cell, including yeast and animal cells, particularly mammalian cells (e.g., CHO cells, NS0 cells, human cells such as PER.C6 or HKB-1 1 cells, myeloma cells, or a human liver cell, such as Hepa RG), as well as plant cells, whereby mammalian cells are preferred.
- mammalian cells e.g., CHO cells, NS0 cells, human cells such as PER.C6 or HKB-1 1 cells, myeloma cells, or a human liver cell, such as Hepa RG
- Preferred expression hosts can glycosylate the antibody of the invention, particularly with carbohydrate structures that are not themselves immunogenic in humans.
- the transfected host cell may be able to grow in serum-free media.
- the transfected host cell may be able to grow in culture without the presence of animal-derived products.
- the transfected host cell may also be cultured to give a cell
- the invention also provides a method for preparing one or more nucleic acid molecules ⁇ e.g., heavy and light chain genes) that encode an antibody of interest, comprising the steps of:
- the invention provides a method for obtaining a nucleic acid sequence that encodes an antibody of interest, comprising the steps of: (i) preparing an immortalized B cell clone or culturing plasma cells according to the invention;
- the invention further provides a method of preparing nucleic acid molecule(s) that encode an antibody of i nterest, comprising the step of obtaining the nucleic acid that was obtai ned from a transformed B cell clone or cultured plasma cel ls of the invention.
- a method of preparing nucleic acid molecule(s) that encode an antibody of i nterest comprising the step of obtaining the nucleic acid that was obtai ned from a transformed B cell clone or cultured plasma cel ls of the invention.
- the invention also comprises a method for prepari ng an antibody (e.g., for pharmaceutical use) according to the present i nvention, comprising the steps of: (i) obtaining and/or sequencing one or more nucleic acids ⁇ e.g., heavy and light chai n genes) from the selected B cel l clone or the cultured plasma cel ls expressing the antibody of interest; (i i) inserting the nucleic acid(s) into or using the nucleic acid(s) sequence(s) to prepare an expression vector; (i i i) transfecting a host cell that can express the antibody of interest; (iv) culturing or sub- culturing the transfected host cel ls under conditions where the antibody of interest is expressed; and, optional ly, (v) purifying the antibody of interest.
- nucleic acids ⁇ e.g., heavy and light chai n genes
- the invention also provides a method of preparing an antibody comprising the steps of: culturing or sub-culturing a transfected host cel l population, e.g. a stably transfected host cell population, under conditions where the antibody of interest is expressed and, optionally, purifying the antibody of interest, wherein said transfected host cell population has been prepared by (i) providing nucleic acid(s) encoding a selected antibody of interest that is produced by a B cell clone or cultured plasma cel ls prepared as described above, (i i) inserting the nucleic acid(s) into an expression vector, (iii) transfecti ng the vector in a host cell that can express the antibody of interest, and (iv) culturing or sub-culturing the transfected host cell comprisi ng the inserted nucleic acids to produce the antibody of interest.
- a transfected host cel l population e.g. a stably transfected host cell population
- the present invention also provides a pharmaceutical composition comprising one or more of:
- the present invention also provides a pharmaceutical composition comprising the antibody, or the antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention and/or the cell according to the present invention.
- the pharmaceutical composition may preferably also contain a pharmaceutically acceptable carrier, diluent and/or excipient.
- a pharmaceutically acceptable carrier may facilitate administration, it should not itself induce the production of antibodies harmful to the individual receiving the composition. Nor should it be toxic.
- Suitable carriers may be large, slowly metabolized macromolecules such as proteins, polypeptides, liposomes, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers and inactive virus particles.
- pharmaceutically acceptable carriers in a pharmaceutical composition according to the present invention may be active components or inactive components.
- the pharmaceutically acceptable carrier in a pharmaceutical composition according to the present invention is not an active component in respect to hepatitis B or D.
- Pharmaceutically acceptable salts can be used, for example mineral acid salts, such as hydrochlorides, hydrobromides, phosphates and sulphates, or salts of organic acids, such as acetates, propionates, malonates and benzoates.
- Pharmaceutical ly acceptable carriers in a pharmaceutical composition may additionally contain liquids such as water, sal ine, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents or pH buffering substances, may be present in such compositions. Such carriers enable the pharmaceutical compositions to be formulated as tablets, pil ls, dragees, capsules, liquids, gels, syrups, slurries and suspensions, for ingestion by the subject.
- compositions of the invention may be prepared in various forms.
- the compositions may be prepared as i njectables, either as l iquid solutions or suspensions.
- Sol id forms suitable for solution i n, or suspension in, liquid vehicles prior to injection can also be prepared (e.g., a lyophilized composition, similar to SynagisTM and HerceptinTM, for reconstitution with steri le water containing a preservative).
- the composition may be prepared for topical administration e.g., as an ointment, cream or powder.
- the composition may be prepared for oral administration e.g., as a tablet or capsule, as a spray, or as a syrup (optional ly flavored).
- the composition may be prepared for pulmonary admi nistration e.g., as an i nhaler, using a fine powder or a spray.
- the composition may be prepared as a suppository or pessary.
- the composition may be prepared for nasal, aural or ocular administration e.g., as drops.
- the composition may be in kit form, designed such that a combined composition is reconstituted just prior to administration to a subject.
- a lyophi lized antibody may be provided in kit form with sterile water or a steri le buffer.
- the active i ngredient in the composition is an antibody molecule, an antibody fragment or variants and derivatives thereof, in particular the active ingredient in the composition is an antibody, an antibody fragment or variants and derivatives thereof, according to the present invention.
- the composition may be susceptible to degradation in the gastrointestinal tract.
- the composition may contain agents which protect the antibody from degradation but which release the antibody once it has been absorbed from the gastrointestinal tract.
- compositions of the invention generally have a pH between 5.5 and 8.5, in some embodiments this may be between 6 and 8, and in other embodiments about 7.
- the pH may be maintained by the use of a buffer.
- the composition may be sterile and/or pyrogen free.
- the composition may be isotonic with respect to humans.
- pharmaceutical compositions of the invention are supplied in hermetically-sealed containers.
- compositions present in several forms of administration include, but are not limited to, those forms suitable for parenteral administration, e.g., by injection or infusion, for example by bolus injection or continuous infusion.
- parenteral administration e.g., by injection or infusion, for example by bolus injection or continuous infusion.
- the product may take the form of a suspension, solution or emulsion in an oily or aqueous vehicle and it may contain formulatory agents, such as suspending, preservative, stabilizing and/or dispersing agents.
- the antibody molecule may be in dry form, for reconstitution before use with an appropriate sterile liquid.
- a vehicle is typically understood to be a material that is suitable for storing, transporting, and/or administering a compound, such as a pharmaceutically active compound, in particular the antibodies according to the present invention.
- the vehicle may be a physiologically acceptable liquid, which is suitable for storing, transporting, and/or administering a pharmaceutically active compound, in particular the antibodies according to the present invention.
- compositions of this invention may be administered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intra-arterial, intramedullary, intraperitoneal, intrathecal, intraventricular, transdermal, transcutaneous, topical, subcutaneous, intranasal, enteral, sublingual, intravaginal or rectal routes. Hyposprays may also be used to administer the pharmaceutical compositions of the invention.
- the pharmaceutical composition may be prepared for oral administration, e.g. as tablets, capsules and the like, for topical administration, or as injectable, e.g. as liquid solutions or suspensions, whereby it is particularly preferred that the pharmaceutical composition is an injectable.
- Solid forms suitable for solution in, or suspension i n, liquid vehicles prior to injection are also be preferred, e.g. that the pharmaceutical composition is i n lyophi lized form.
- the active ingredient wi l l preferably be in the form of a parenteral ly acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- a parenteral ly acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- Those of relevant ski l l i n the art are wel l able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
- Preservatives, stabi lizers, buffers, antioxidants and/or other additives may be i ncluded, as required.
- administration is preferably in a "prophylactically effective amount” or a "therapeutical ly effective amount” (as the case may be), this being sufficient to show benefit to the individual.
- the actual amount administered, and rate and time-course of administration, wi ll depend on the nature and severity of what is being treated.
- the pharmaceutical composition according to the present invention may be provided for example in a pre-fil led syri nge.
- inventive pharmaceutical composition as defined above may also be administered orally in any oral ly acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions.
- carriers commonly used include lactose and corn starch.
- Lubricating agents such as magnesium stearate, are also typically added.
- useful diluents include lactose and dried cornstarch.
- the active ingredient i.e. the inventive transporter cargo conjugate molecule as defined above, is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
- the inventive pharmaceutical composition may also be administered topically, especially when the target of treatment includes areas or organs readi ly accessible by topical application, e.g. includi ng diseases of the skin or of any other accessible epithelial tissue. Suitable topical formulations are readi ly prepared for each of these areas or organs.
- the inventive pharmaceutical composition may be formulated in a suitable ointment, containing the inventive pharmaceutical composition, particularly its components as defined above, suspended or dissolved in one or more carriers.
- Carriers for topical administration include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water.
- the inventive pharmaceutical composition can be formulated in a suitable lotion or cream.
- suitable carriers include, but are not limited to, mineral oi l, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
- Dosage treatment may be a single dose schedule or a multiple dose schedule, whereby in the context of the present invention a multiple dose schedule is preferred.
- Known antibody-based pharmaceuticals in particular anti-HBV based pharmaceuticals, e.g. Hepatect ® CP, provide guidance relating to frequency of administration in particular in respect to different indications, e.g., whether a pharmaceutical should be delivered daily, weekly, monthly, etc.. Frequency and dosage may also depend on the severity of symptoms.
- the pharmaceutical composition according to the present invention may be administered daily, e.g. once or several times per day, e.g. once, twice, three times or four times per day, preferably once or twice per day, more preferable once per day, for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, 1 1 , 12, 13, 14, 1 5, 1 6, 1 7, 18, 1 9, 20 or 21 or more days, e.g. daily for 1 , 2, 3, 4, 5, 6 months.
- the pharmaceutical composition according to the present invention may be administered weekly, e.g. once or twice per week, for 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 1 , 12, 1 3, 14, 1 5, 1 6, 1 7, 1 8, 1 9, 20 or 21 or more weeks, e.g.
- the pharmaceutical composition according to the present invention may be preferably administered monthly, e.g. once per month or, more preferably, every second month for 1 , 2, 3, 4, or 5 or more years.
- a preferred endpoint of administration is when seroconversion is reached, preferably the endpoint of therapy is the persistent disappearance of HBsAg from serum, accompanied by seroconversion to anti-HBV antibodies. It is also preferred that the administration continues for the lifetime.
- one single administration only is also envisaged, in particular in respect to certain indications, e.g. for prevention of hepatitis B in case of accidental exposure in non-immunised subjects.
- the amount of the antibody, or the antigen binding fragment thereof, in the pharmaceutical composition according to the present invention does not exceed 1 g, preferably does not exceed 500 mg, more preferably does not exceed 250 mg, even more preferably does not exceed 100 mg, and particularly preferably does not exceed 50 mg.
- compositions typically include an "effective" amount of one or more antibodies of the invention, i.e. an amount that is sufficient to treat, ameliorate, attenuate or prevent a desired disease or condition, or to exhibit a detectable therapeutic effect.
- Therapeutic effects also include reduction or attenuation in pathogenic potency or physical symptoms.
- the precise effective amount for any particular subject will depend upon their size, weight, and health, the nature and extent of the condition, and the therapeutics or combination of therapeutics selected for administration. The effective amount for a given situation is determined by routine experimentation and is within the judgment of a clinician.
- an effective dose will generally be from about 0.005 to about 100 mg/kg, preferably from about 0.0075 to about 50 mg/kg, more preferably from about 0.01 to about 10 mg/kg, and even more preferably from about 0.02 to about 5 mg/kg, of the antibody of the present invention (e.g. amount of the antibody in the pharmaceutical composition) in relation to the bodyweight (e.g., in kg) of the individual to which it is administered.
- the antibody of the present invention e.g. amount of the antibody in the pharmaceutical composition
- bodyweight e.g., in kg
- the amount of the antibody, or the antigen binding fragment thereof, in the pharmaceutical composition according to the present invention may preferably not exceed 50 mg, more preferably not more than 10 mg, for a single dose on the day of transplantation, peri-operatively then not more than 1 0 - 50 mg, preferably not more than 2 - 1 0 mg, per day for seven days and not more than 1 0 - 50 mg, preferably not more than 2 - 1 0 mg, per single dose administered every 1 - 3 months to maintain anti-HBs serum levels about 100 IU/L.
- the antibody, or the antigen binding fragment thereof, or the pharmaceutical composition according to the present invention is preferably administered subcutaneously, with a single dose of up to 500 mg, preferably of up to 250 mg, more preferably of up to 1 00 mg of the antibody according to the present invention.
- a single dose may be administered daily, weekly or monthly as described above.
- the pharmaceutical composition according to the present invention may also comprise an additional active component, which may be a further antibody or a component, which is not an antibody.
- the additional active component is preferably selected from polymerase inhibitors, interferons and/or checkpoint inhibitors.
- Preferred polymerase inhibitors include Lamivudine, Adefovir, Entecavir, Telbivudine and Tenofovir.
- Polymerase inhibitors suppress reverse transcription and synthesis of the DNA-plus strand. Polymerase inhibitors do not prevent viral spread, formation of cccDNA and does not affect HBsAg release.
- Interferons include IFNalpha and IFNbeta, whereby IFNbeta is preferred.
- Preferred checkpoint inhibitors are directed to a blockade of PD-1 /PD-L1 and/or of CTLA4 and, thus, include anti-PD-1 antibodies, anti-PD-L1 antibodies and anti-CTLA4 antibodies.
- the pharmaceutical composition according to the present invention may comprise one or more of the additional active components.
- the antibody, or the antigen binding fragment, according to the present invention can be present either in the same pharmaceutical composition as the additional active component or, preferably, the antibody, or the antigen binding fragment, according to the present invention is comprised by a first pharmaceutical composition and the additional active component is comprised by a second pharmaceutical composition different from the first pharmaceutical composition. Accordingly, if more than one additional active component is envisaged, each additional active component and the antibody, or the antigen binding fragment, according to the present invention is preferably comprised by a different pharmaceutical composition. Such different pharmaceutical compositions may be administered either combined/simultaneously or at separate times or at separate locations (e.g. separate parts of the body).
- antibody, or the antigen binding fragment, according to the present invention and the additional active component provide an additive therapeutic effect or, preferably, a synergistic therapeutic effect.
- the term “synergy” is used to describe a combined effect of two or more active agents that is greater than the sum of the individual effects of each respective active agent.
- the combined effect of two or more agents results in “synergistic inhibition” of an activity or process, it is intended that the inhibition of the activity or process is greater than the sum of the inhibitory effects of each respective active agent.
- the term “synergistic therapeutic effect” refers to a therapeutic effect observed with a combination of two or more therapies wherein the therapeutic effect (as measured by any of a number of parameters) is greater than the sum of the individual therapeutic effects observed with the respective individual therapies.
- a pharmaceutical composition comprising the antibody according to gHCB34 or an antigen binding fragment thereof, and a pharmaceutically acceptable carrier is preferred.
- a composition of the invention may include antibodies of the invention, wherein the antibodies may make up at least 50% by weight [e.g., 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more) of the total protein in the composition.
- the antibodies are preferably in purified form.
- the present invention also provides a method of preparing a pharmaceutical composition comprising the steps of: (i) preparing an antibody of the invention; and (ii) admixing the purified antibody with one or more pharmaceutically-acceptable carriers.
- a method of preparing a pharmaceutical composition comprises the step of: admixing an antibody with one or more pharmaceutically-acceptable carriers, wherein the antibody is a monoclonal antibody that was obtained from a transformed B cell or a cultured plasma cell of the invention.
- nucleic acid typically DNA
- Suitable gene therapy and nucleic acid delivery vectors are known in the art.
- compositions may include an antimicrobial, particularly if packaged in a multiple dose format. They may comprise detergent e.g., a Tween (polysorbate), such as Tween 80. Detergents are generally present at low levels e.g., less than 0.01 %. Compositions may also include sodium salts (e.g., sodium chloride) to give tonicity. For example, a concentration of 10+2mg/ml NaCI is typical.
- a concentration of 10+2mg/ml NaCI is typical.
- compositions may comprise a sugar alcohol ⁇ e.g., mannitol) or a disaccharide ⁇ e.g., sucrose or trehalose) e.g., at around 1 5-30 mg/ml ⁇ e.g., 25 mg/ml), particularly if they are to be lyophilized or if they include material which has been reconstituted from lyophilized material.
- the pH of a composition for lyophilization may be adjusted to between 5 and 8, or between 5.5 and 7, or around 6.1 prior to lyophilization.
- compositions of the invention may also comprise one or more immunoregulatory agents.
- one or more of the immunoregulatory agents include(s) an adjuvant.
- the present invention provides the use of an antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention in (i) prophylaxis, treatment or attenuation of hepatitis B and/or hepatitis D; or in (ii) diagnosis of hepatitis B and/or hepatitis D.
- Methods of diagnosis may include contacting an antibody or an antibody fragment with a sample.
- samples may be isolated from a subject, for example an isolated tissue sample taken from, for example, nasal passages, sinus cavities, salivary glands, lung, liver, pancreas, kidney, ear, eye, placenta, alimentary tract, heart, ovaries, pituitary, adrenals, thyroid, brain, skin or blood, preferably serum.
- the methods of diagnosis may also include the detection of an antigen/antibody complex, in particular following the contacting of an antibody or an antibody fragment with a sample.
- a detection step is typically performed at the bench, i.e. without any contact to the human or animal body. Examples of detection methods are well-known to the person ski lled in the art and include, e.g., ELISA (enzyme-linked immunosorbent assay).
- the invention also provides the use of (i) an antibody, an antibody fragment, or variants and derivatives thereof according to the invention, (ii) an immortalized B cell clone according to the invention, (iii) a nucleic acid or a vector according to the present invention or (iv) a pharmaceutical composition of the invention in (a) the manufacture of a medicament for the prevention, treatment or attenuation of hepatitis B and/or hepatitis D or for (b) diagnosis of hepatitis B and/or hepatitis D.
- the invention also provides the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention for use as a medicament, in particular for the prevention or treatment of hepatitis B and/or hepatitis D. It also provides the use of an antibody of the invention in the manufacture of a medicament for treatment of a subject and/or diagnosis in a subject. It also provides a method for treating a subject, comprising the step of administering to the subject a composition of the invention. In some embodiments the subject may be a human. One way of checking efficacy of therapeutic treatment involves monitoring disease symptoms after administration of the composition of the invention. Treatment can be a single dose schedule or a multiple dose schedule.
- an antibody, antibody fragment, immortalized B cell clone, or pharmaceutical composition according to the invention is administered to a subject in need of such treatment.
- a subject includes, but is not limited to, one who is particularly at risk of or susceptible to hepatitis B and/or hepatitis D.
- Antibodies, or antigen binding fragments thereof, according to the present invention may also be used in a kit for the diagnosis of hepatitis B and/or hepatitis D. Further, the epitope in the antigenic loop region of HBsAg, which is capable of binding an antibody of the invention as described herein may be used in a kit for monitoring the efficacy of application procedures by detecting the presence or determining the titer of protective anti-HBV antibodies.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used in treatment or attenuation of chronic hepatitis B.
- the antibody according to the present invention (i) potently neutralizes HBV infection, (ii) binds to L-HBsAg (the large HBV envelope protein, which is present in infectious HBV particles), thereby preventing spreading of HBV, (iii) binds to S-HBsAg, thereby promoting clearance of subviral particles (SVP) and (iv) can induce seroconversion, i.e. an active immune response to the virus.
- L-HBsAg the large HBV envelope protein, which is present in infectious HBV particles
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used in prevention of hepatitis B (reinfection after liver transplantation in particular for hepatitis B induced liver fai lure.
- a high dose may be administered to the patient receiving a liver transplantation on the day of transplantation and daily doses are given peri-operatively for about a week. Thereafter, preferably further doses may be given every 1 -3 months to maintain anti-HBV antibody serum levels above 100 lU/ml.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used in prevention/prophylaxis of hepatitis B in non-immunized subjects. This is for example in case of (an assumed) accidental exposure to HBV (post-exposure prophylaxis).
- non- immunized subjects includes subjects, who never received a vaccination and are, thus, not immunized, and subjects, who did not show an immune response (no measurable anti- hepatitis B antibodies) after vaccination.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used in (continuous) prevention of hepatitis B, i.e. in contrast to "postexposure prophylaxis" (continuous) prevention is preferably for such subjects, who did not show an immune response (no measurable anti-hepatitis B antibodies) after vaccination and for whom continuous prevention is necessary.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used in prophylaxis of hepatitis B in haemodialysed patients.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used in prevention of hepatitis B in the newborn.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is administered at birth or as soon as possible after birth.
- the administration may be repeated until seroconversion following vaccination.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is used in treatment or attenuation of hepatitis D, preferably of hepatitis B and hepatitis D, which is in particular a hepatitis B and hepatitis D comorbidity.
- the antibody according to the present invention does not only potently neutralize hepatitis B virus, but also hepatitis delta virus. Therefore, the antibody according to the present invention may provide a first treatment of hepatitis D.
- the administration of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention in the methods and uses according to the invention can be carried out alone or in combination with a co-agent (also referred to as "additional active component" herein) useful for treating and/or stabilizing the disease or disorder to be treated or repressed.
- a co-agent also referred to as "additional active component” herein
- the invention encompasses the administration of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention, wherein it is administered to a subject prior to, simultaneously or sequentially with other therapeutic regimens or co-agents useful for treating, and/or preventing hepatitis B.
- Said antibody, nucleic acid, vector, cell or pharmaceutical composition, that is administered simultaneously with said co-agents can be administered in the same or different composition(s) and by the same or different route(s) of administration.
- Said other therapeutic regimens or co-agents may be selected from the group consisting of polymerase inhibitors, interferons and/or a checkpoint inhibitors.
- the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is administered in combination with a polymerase inhibitor, an interferon and/or a checkpoint inhibitor for the above described (medical) uses.
- Preferred polymerase inhibitors include Lamivudine, Adefovir, Entecavir, Telbivudine and Tenofovir. Polymerase inhibitors suppress revers transcription and synthesis of the DNA-plus strand. Polymerase inhibitors do not prevent viral spread, formation of cccDNA and does not affect HBsAg release.
- Interferons include IFNalpha and IFNbeta, whereby IFNbeta is preferred.
- Preferred checkpoint inhibitors are directed to a blockade of PD-1/PD-L1 and/or of CTLA4 and, thus, include anti-PD-1 antibodies, anti-PD-L1 antibodies and anti-CTLA4 antibodies.
- the pharmaceutical composition according to the present invention may comprise one or more of the additional active components.
- co-agent additional active components to be administered in combination with the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention include LTpR agonists.
- the antibody, or the antigen binding fragment, according to the present invention can be present either in the same pharmaceutical composition as the additional active component (co-agent) or, preferably, the antibody, or the antigen binding fragment, according to the present invention is comprised by a first pharmaceutical composition and the additional active component (co-agent) is comprised by a second pharmaceutical composition different from the first pharmaceutical composition. Accordingly, if more than one additional active component (co-agent) is envisaged, each additional active component (co-agent) and the antibody, or the antigen binding fragment, according to the present invention is preferably comprised by a different pharmaceutical composition. Such different pharmaceutical compositions may be administered either combined/simultaneously or at separate times or at separate locations (e.g. separate parts of the body).
- antibody, or the antigen binding fragment, according to the present invention and the additional active component (co-agent) provide an additive therapeutic effect or, preferably, a synergistic therapeutic effect.
- the term “synergy” is used to describe a combined effect of two or more active agents that is greater than the sum of the individual effects of each respective active agent.
- the combined effect of two or more agents results in “synergistic inhibition” of an activity or process, it is intended that the inhibition of the activity or process is greater than the sum of the inhibitory effects of each respective active agent.
- the term “synergistic therapeutic effect” refers to a therapeutic effect observed with a combination of two or more therapies wherein the therapeutic effect (as measured by any of a number of parameters) is greater than the sum of the individual therapeutic effects observed with the respective individual therapies.
- the present invention provides the use of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention for monitoring the quality of anti-hepatitis-B or anti-hepatitis-D vaccines by checking that the antigen of said vaccine contains the specific epitope in the correct conformation.
- the present invention also provides the use of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention in diagnosis of hepatitis B and/or hepatitis D.
- the use of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention in determining whether an isolated blood sample is infected with hepatitis B virus and/or hepatitis delta virus is provided.
- methods of diagnosis may include contacting an antibody or an antibody fragment with a sample.
- samples may be isolated from a subject, for example an isolated tissue sample taken from, for example, nasal passages, sinus cavities, salivary glands, lung, liver, pancreas, kidney, ear, eye, placenta, alimentary tract, heart, ovaries, pituitary, adrenals, thyroid, brain, skin or blood, preferably serum.
- the methods of diagnosis may also include the detection of an antigen/antibody complex, in particular following the contacting of an antibody or an antibody fragment with a sample.
- a detection step is typically performed at the bench, i.e. without any contact to the human or animal body. Examples of detection methods are well-known to the person ski lled in the art and include, e.g., ELISA (enzyme- linked immunosorbent assay).
- the present invention also provides a method of preventing and/or treating hepatitis B and/or hepatitis D in a subject, wherein the method comprises administering to a subject in need thereof the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention.
- the present invention also provides a method of treating a subject who has received a liver transplant comprising administering to the subject who has received the liver transplant, a therapeutically effective amount of the antibody, or an antigen binding fragment thereof, according to the present invention, the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention.
- the previously described details, in particular in the context of the pharmaceutical composition and the medical uses, also apply for the methods described herein.
- the antibody, or an antigen binding fragment thereof, according to the present invention the nucleic acid according to the present invention, the vector according to the present invention, the cell according to the present invention or the pharmaceutical composition according to the present invention is preferably administered in combination with a polymerase inhibitor, an interferon and/or a checkpoint inhibitor as described herein.
- Figure 1 shows for Example 1 the binding of HBC34 monoclonal antibody to three different HBsAg serotypes (adw, ady, and ayw) as measured by ELISA.
- Figure 2 shows for Example 2 the ability of various anti-HB antibodies, namely HBV immunoglobulins (HBIG), HBC34, and further monoclonal antibodies against PreS1 (1 8/7) or HBsAg to neutralize HBV infection of HepaRG cell in vitro.
- HBIG HBV immunoglobulins
- PreS1 PreS1
- HBsAg monoclonal antibodies against PreS1 (1 8/7) or HBsAg to neutralize HBV infection of HepaRG cell in vitro.
- Each antibody was tested at three different concentrations, namely 5 pg/ml, 0.5 g/ml and 0.05 pg/ml, except for HBIG, which was tested at 5000 pg/ml,
- Figure 3 shows for Example 2 the staining of HBcAg in HepaRG cells infected in the presence of three different concentrations (5 pg/ml, 0.5 pg/ml or 0.05 pg/ml) of HBC34 monoclonal antibody and, as a reference, the nuclear staining.
- FIG. 4 shows for Example 2 the neutralization activity of different concentrations of
- HBC34 on infectious HDV. At a concentration of 0.12 ⁇ g/ml HBC34 no HDV- positive cells were detectable, indicating potent neutralization of HDV. HBIG, in contrast, did not neutralize HDV (tested in 1 :1 000 dilution, i.e. 50 ⁇ g/ml).
- Figure 5 shows for Example 3 the amino acid sequences of the antigenic loop of HBsAg of the 10 HBV genotypes A, B. C. D, E, F, G, H, I and J. Those sequences comprise the epitope recognized by the HBC34 antibody (highlighted in grey). The sequence on the top (HBV-D J02203) was used to design the peptide library in Example 5, Fig. 7.
- Figure 6 shows for Example 3 the binding, as determined by cytofluori metric analysis, of the human monoclonal antibody HBC34 and a control antibody (both at 5 pg/ml) to permeabilized Hep2 cells transiently transfected with plasmids expressing the different HBsAg genotypes A, B, C, D, E, F, G, H, I and J as indicated in the Figure.
- Figure 7 shows for Example 4 the amino acid sequences of the antigenic loop of the 19
- Example 5 shows for Example 5 the binding of HBC34 to a library of 650 linear and looped peptides as determined using the Pepscan technology as well as the sequences of the four peptides bound by HBC34.
- Residues indicate as 1 are cysteines that were introduced to allow the chemical linking to scaffolds in order to reconstruct conformational epitopes. If other cysteines besides the newly introduced cyteines are presente, they are replaced by alanine (underlined alanine residues).
- Ab4 is a comparative antibody, which is also reactive against the antigenic loop.
- Example 6 shows for Example 6 the levels of HBV viremia in humanized uPA/SCID mice inoculated with 5 x 1 0 7 copies of HBV genome equivalents (genotype D), which received from three weeks post-infection treatment with either HBC34 treatment (at 1 mg/kg administered i .p. twice per week), a control antibody (control AB) or entecavir (ETV; administered orally at 1 for 6 weeks.
- HBC34 treatment at 1 mg/kg administered i .p. twice per week
- a control antibody control a control antibody
- entecavir ETV
- viremia i ncreased >2 log in the group which received the control antibody whi le H BV titers decreased in mice treated with H BC34 or entecavir.
- Example 6 shows for Example 6 staining of hepatocytes for the presence of HBcAg (intrahepatical analysis) in mice of Example 6 at the end of the experiment (week 9). Nearly al l hepatocytes stained H BcAg positive in mice which received the control antibody, while spreading was efficiently blocked by both, treatment with entecavir and treatment with HBC34 (ca. 1 -5% HBcAg- positive cells).
- Figure 1 3 shows for Example 6 cccDNA measurements, which did not differ significantly between mice that were sacrificed 3 weeks post HBV infection ("3week hbv"; i.e. no treatment) and mice that were treated from week 3 to week 9 postinfection with HBC34 or entecavir. In contrast, the estimated amount of cccDNA/cell increased up to 2 logs in the group receiving the control antibody when sacrificed 9 weeks post-infection.
- Figure 14 shows for Example 6 levels of circulating HBsAg at baseline (BL), week 3 of treatment (week 6 post-infection) and week 6 of treatment (week 9 postinfection).
- Levels of circulating HBsAg decreased >1 log (and below the limit of detection) in mice receiving HBC34, but not in mice treated with entecavir, while HBsAg levels increased >2 logs (reaching levels of 5000-10000 lU/ml) in the control group.
- Figure 1 5 shows for Example 7 HBV titer (left panel) and levels of circulating HBsAg
- HBV titer and levels of circulating HBsAg were decreased in mice receiving HBC34 at week 3 and week 6 of treatment. Individual curves represent individual animals. Control antibody: dotted lines, HBC34: continuous lines.
- FIG. 1 6 shows for Example 8 HBV titer (left panel) and HDV titer (right panel) in uPA/SCID mice repopulated with primary human hepatocytes and co-infected with a patient-derived serum containing HDV-RNA and HBV-DNA.
- HBV titer (left panel) and HDV titer (right panel) are shown at baseline (week3, week5BL), at week 3 of treatment (week 8 post-infection - "week 8") and at week 6 of treatment (week 1 1 post-infection - "week 1 1 ").
- Individual curves represent individual animals.
- Control antibody dotted lines
- HBC34 continuous lines.
- Example T Identification and characterization of human monoclonal antibody HBC34
- HBC34 is an IgGl - type fully human monoclonal antibody having the CDR, VH and VL sequences as shown above in Tables 2 and 3.
- HBC34 binds with high affinity to three HBsAg serotypes (adw, ady and ayw) with simi lar and low EC50 values, as measured by ELISA ( Figure 1 ).
- Protective titers of HBV antibodies are expressed in International Units (IU) which allows standardization over different assays.
- IU International Units
- the plasma used i n the preparation of this standard was derived from individuals who had been naturally infected with hepatitis B virus (Barker, L. F., D. Lorenz, S. C. Rastogi, J. S. Finlayson, and E. B. Seligmann. 1977. Study of a proposed international reference preparation for antihepatitis B immunoglobulin. WHO Expert Committee on Biological Standardization technical report series. WHO Expert Committee on Biological Standardisation 29th Report BS 77.1 1 64. Geneva, Switzerland, World Health Organization, 1 977; World Health Organization: Anti-hepatitis B immunoglobulin. WHO Tech Rep Ser 1 978; 626:1 8).
- the activity of HBC34 as measured diagnostically with an immunoassay (Abbott Architect diagnostic immunoassay), is 5000 lU/mg. As a comparison the activity of HBIG is ⁇ 1 lU/mg.
- the first object of Example 2 was to determine whether HBC34 neutralizes infectious HBV and to compare the neutralization activity of HBC34 to that of other anti-HB antibodies.
- differentiated HepaRG cells were incubated with a fixed amount of HBV in the presence or absence of antibodies (HBC34, 18/7, Ab2, Ab3 and HBIG) in medium supplemented with 4% PEG 8000 (Sigma-Aldrich) for 1 6 hours at 37°C. At the end of the incubation, the cells were washed and further cultivated. Medium was changed every 3 days.
- HBeAg staining was detected by measuring in enzyme-linked immunosorbent assay (ELISA) the levels of hepatitis B surface antigen (HBsAg) and hepatitis B e antigen (HBeAg) secreted into the culture supernatant from day 7 to 1 1 post-infection and by detecting HBeAg staining in an immunofluorescence assay.
- ELISA enzyme-linked immunosorbent assay
- HBIG neutralized HBV infection only when tested at 5000 and 500 pg/ml, i.e. with a 1000 fold lower potency as compared to HBC34. 1 8/7 is a murine monoclonal antibody against the pre-S1 region of HBsAg.
- the second object of Example 2 was to determine the neutralizing activity of HBC34 against HDV on differentiated HepaRg cells. Sera from HDV carriers were used as HDV infection inoculum. Delta antigen immunofluorescence staining was used as a readout. As shown in Figure 4, HBC34 completely blocked HDV infection when tested at 0.12 ⁇ 3 ⁇ 4' ⁇ ) ⁇ . As a comparison, HBIG were also tested and were ineffective (tested at 1/1000, i.e. 50 g/ml).
- Antibody HBC34 recognizes all 10 HBV genotypes A, B, C, D, E, F, G, H, I,
- HBC34 was tested for its ability to recognize the 10 HBV genotypes A, B, C, D, E, F, G, H, I, and J (as shown in Figure 5) by flow cytometry analysis.
- human epithelial cells Hep2 cells
- Human epithelial cells were transfected with plasmids expressing each of the HBsAg of the 10 HBV genotypes A, B, C, D, E, F, G, H, I, and J (as shown in Figure 5).
- Human monoclonal antibody HBC34 (5 pg/ml) and a control antibody (5 pg/ml) were used for staining of transiently transfected permeabi lized cells.
- HBC34 Two days after transfection, Hep2 cells were collected, fixed and permeabilized with saponin for immunostaining with HBC34 or a control Ab. Binding of antibodies to transfected cel ls was analysed using a Becton Dickinson FACSCanto2 (BD Biosciences) with Flowjo software (TreeStar). As shown in Figure 6 HBC34 recognized all 10 HBV HBsAg genotypes with similar patterns of staining.
- Example 4 Antibody HBC34 recognizes all functional HBsAg mutants HBC34 was tested for its abi lity to bind to the 1 9 different HBsAg genotype D mutants (based on HBsAg Genotype D, Genbank accession no.
- Hep2 cells human epithelial cells
- plasmids expressing the different HBsAg mutants were transfected with plasmids expressing the different HBsAg mutants and analyzed as in Example 3.
- 5 pg/ml of human monoclonal antibody HBC34 and two other HBsAg-specific antibodies (Ab5 and Ab6) were used for testing the binding of HBC34 to the transfected Hep2 cells.
- HBC34 was found to bind to 1 8 of the 1 9 HBsAg mutants.
- Example 5 Antibody HBC34 binds to a conserved conformational epitope in the antigenic loop
- the epitope recognized by HBC34 was identified by using a library of 650 linear and looped peptides ("CLIPS Discontinuous Epitope Mapping" technology from Pepscan, Lelystad, The Netherlands) designed to cover the entire antigenic loop region of the HBsAg.
- the linear and CLIPS peptides are synthesized based on standard Fmoc-chemistry.
- the looped peptides are synthesized on chemical scaffolds in order to reconstruct conformational epitopes, using the Chemically Linked Peptides on Scaffolds, CLIPS, technology as described in Timmerman et al., 2007, Journal of Molecular Recognition 20: 283-99.
- the single looped peptides are synthesized containing two cysteines and the size of the loop is varied by introducing the cysteine residues at variable spacing. If other cysteines besides the newly introduced cysteines are present, they are replaced by alanine.
- the side-chains of the multiple cysteines in the peptides are coupled to CLIPS templates by reacting onto credit-card format polypropylene PEPSCAN cards (455 peptide formats/card) with a 0.5 mM solution of CLIPS template such as 1 ,3-bis (bromomethyl)benzene in ammonium bicarbonate. The binding of antibody to each peptide is tested in a PEPSCAN-based ELISA.
- the 455-well credit card format polypropylene cards containing the covalently linked peptides are incubated with the test antibody (at 1 pg/ml) in blocking solution. After washing the peroxidase substrate 2,2'-azino- di-3-ehylbenzthiazoline sulfonate (ABTS) and 2 ⁇ of 3% H2O2 are added. After one hour, the color development is measured with a a charge coupled device (CCD)-camera and an image processing system. The raw data are optical values and range from 0 to 3000 (a log scale similar to 1 to 3 of a standard 96-well plate ELISA reader).
- HBC34 was found to recognize a double looped peptide having an amino acid sequence according to SEQ ID NO 52:
- SEQ ID NO 53 another linear peptide having an amino acid sequence according to SEQ ID NO 54:
- HBsAg The region of HBsAg, which comprises the conformational epitope, to which HBC34 binds to, is polymorphic in the different HBV genotypes.
- X the residues mutated in the different genotypes are indicated with an X:
- ⁇ ⁇ is preferably R or K
- X 2 is preferably M or T
- X 3 is preferably T or I
- X 4 is preferably T, P or L
- X 2 is C or S
- X 3 is R, K, D or I
- X 4 is M or T
- X 5 is T, A or I
- X 7 is Q, H or L.
- Example 6 Administration of HBC34 starting 3 weeks post HBV infection prevents viral spreading in humanized uPA mice
- Example 6 The object of Example 6 was to i nvestigate whether human monoclonal antibody HBC34 is able to prevent spreadi ng of HBV. In other words, it was the aim to investigate the capacity of the entry inhibitor HBC34 antibody to inhibit infection of the human hepatocytes in vivo by treating mice after the initial infection establ ishment. To this end, naive uPA/SCID mice repopulated with primary human hepatocytes (see Petersen et al. Nature Biotechnology, 2008, 26:335-341 ) were used. These mice were engrafted with cryopreserved human hepatocytes by intrasplenic injection.
- mice with appropriate human albumin levels were i noculated i.p. with 5 x 1 0 7 copies of HBV genome equivalents (genotype D, HBeAg positive) to permit viral entry.
- HBV genome equivalents gene D, HBeAg positive
- HBV DNA was extracted from serum samples using the QiAmp MinElute Virus spin kit (Qiagen, H i lden, Germany). H BV-specific primers and hybridization probes were used to determine HBV DNA viremia and cccDNA loads quantitatively as described previously (Volz T et al ., Gastroenterology 2007; 1 33: 843-852). DNA and RNA were extracted from liver specimens using the Master Pure DNA purification kit (Epicentre, Biozym, Germany) and RNeasy RNA purification kit (Qiagen, H i lden, Germany). Intrahepatic HBV DNA values were normal ized for cellular DNA contents using the beta-globin gene kit (Roche DNA control Kit; Roche Diagnostics).
- rcDNA levels were estimated by subtracting cccDNA amounts from total H BV DNA. Viral RNAs and genomic RNAs were reverse transcribed using oligo-dT primers and the Transcriptor Kit (Roche Applied Science) and quantified by using primers specific for total viral RNAs. HBV RNA levels were normalized to human specific GAPDH RNA. HBsAg quantification from blood samples was performed using the Abbott Architect platform (quant. HBsAg kit, Abbott, Ireland, Diagnostic Division), as recommended by the manufacturer. Cryostat sections of chimeric mouse livers were immunostained using humanspecific cytokeratin-1 8 monoclonal (Dako, Glostrup, Denmark) to stain human hepatocytes.
- HBV core antigen HBV core antigen
- the polyclonal rabbit anti- HBcAg was used. Specific signals were visualized by employing the Alexa-labeled secondary antibodies (Invitrogen, Darmstadt, Germany) or TSA-Fluorescein (HBcAg) System (Perkin Elmer, Ju ' gesheim, Germany), whi le nuclear staining was obtained with Hoechst 33342 (Invitrogen). Stained sections were analyzed by fluorescence microscope.
- HBV DNA The median baseline level of HBV DNA at the beginning of the treatment was 2 x 1 0 6 DNA copies /ml.
- viremia increased >2log in the group which received the control antibody, while HBV titers decreased in mice treated with HBC34 or entecavir ( Figure 1 1 ).
- mice were also analyzed intrahepatically at the end of the experiment (i.e. week 9) by staining hepatocytes for the presence of HBcAg. Nearly all hepatocytes stained HBcAg positive in mice which received the control antibody, while spreading was efficiently blocked by both, treatment with entecavir and treatment with HBC34 (ca. 1 -5% HBcAg-positive cells). These results indicate that HBC34 can efficiently block viral spreading during the ramp-up phase of HBV infection (Figure 12).
- HBsAg levels of blood circulating HBsAg were measured at baseline (BL), week 3 of treatment (week 6 post-infection) and week 6 of treatment (week 9 post-infection). It is of note that the levels of circulating HBsAg decreased >1 log (and below the limit of detection) in mice receiving HBC34, but not in mice treated with entecavir, while HBsAg levels increased >2 logs (reaching levels of 5000-10000 lU/ml) in the control group ( Figure 14). The measurement of HBsAg was not influenced by the presence of the HBC34 antibody as determined in a spike-in experiment where the addition of HBC34 antibody to HBsAg positive mouse sera did not alter the expected measurement using the Abbott Architect diagnostic immunoassay.
- Example 7 Administration of HBC34 in chronically HBV infected humanized uPA mice promoted HBV and HBsAg clearance
- naive humanized uPA/SCID mice were infected with HBV and after 12 weeks post infection, a median level of HBV DNA of 2 x 1 0 9 copies/ml and a level of HBsAg of 1 0000 lU/ml was reached. These levels are as high as the levels that are commonly observed in human patients with chronic HBV infection.
- mice were treated starting from week 12 post-infection either with HBC34 or with a control antibody for 6 weeks (1 mg/kg i.p. twice per week).
- HBV titer and levels of blood circulating HBsAg were decreased in mice receiving HBC34 for 3 weeks (week 1 5 post-infection) and 6 weeks (week 1 8 post-infection).
- HBC34 promoted a clear reduction of both HBV viremia and HBsAg levels after 6 weeks of treatment.
- HBeAg and human albumin levels were not altered in HBC34-treated mice, which indicates the absence of liver toxicity.
- Example 8 Administration of HBC34 blocks HDV infection in vivo Naive humanized uPA/SCID mice were co-infected with a patient-derived serum containing HDV-RNA and HBV-DNA. Five weeks after infection (when HBV titers reached levels between 10 7 to 10 9 , and HDV RNA reached levels between 1 0 3 to 10 6 copies/ml) mice were treated with HBC34 or a control antibody for 6 weeks (1 mg/kg i.p. twice per week). HBV DNA viremia was measured as described in Examples 6 and 7.
- HDV viremia was determined via reverse transcription of viral RNA (extracted from serum samples using the QiAmp MinElute Virus Spin Kit, Qiagen, Venlo, Netherlands) and quantitative RT-PCR using the ABI Fast 1 -Step Virus Master (Applied Biosystems, Carlsbad, USA), HDV specific primers and probes on a ABI Viia7 (Applied Biosystems, Carlsbad, USA).
- HBC34 efficiently blocked HDV viral spread both 3 weeks and 6 weeks after treatment (weeks 8 and 1 1 , respectively). Similarly to what was observed in HBV chronically infected mice, HBC34 promoted a HBV viral DNA titers reduction of 2 logs (Figure 13).
- GAGGTTAAA CDRL2 nuc gtcatctatGAGGTTAAAtaccgcccc CDRL2 long nuc
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Communicable Diseases (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Microbiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Priority Applications (35)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/EP2015/001970 WO2017059878A1 (en) | 2015-10-07 | 2015-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
| KR1020187012979A KR102725168B1 (ko) | 2015-10-07 | 2016-10-07 | B형 간염 바이러스를 강력하게 중화하는 항체 및 그의 용도 |
| PL16779075T PL3359564T3 (pl) | 2015-10-07 | 2016-10-07 | Przeciwciała, które silnie neutralizują wirusa zapalenia wątroby typu B i ich zastosowania |
| CN202210187026.6A CN114539392B (zh) | 2015-10-07 | 2016-10-07 | 中和乙型肝炎病毒的抗体和其用途 |
| CN201680055161.8A CN108137675B (zh) | 2015-10-07 | 2016-10-07 | 中和乙型肝炎病毒的抗体和其用途 |
| JP2018514962A JP6869968B2 (ja) | 2015-10-07 | 2016-10-07 | B型肝炎ウイルスを強力に中和する抗体及びその使用 |
| DK16779075.7T DK3359564T3 (da) | 2015-10-07 | 2016-10-07 | Antistoffer til potent neutralisering af hepatitis B-virus og anvendelser deraf |
| HRP20201345TT HRP20201345T1 (hr) | 2015-10-07 | 2016-10-07 | Protutijela koja snažno neutraliziraju virus hepatitisa b i njihova upotreba |
| AU2016334735A AU2016334735B2 (en) | 2015-10-07 | 2016-10-07 | Antibodies that potently neutralize hepatitis B virus and uses thereof |
| BR112018002406-6A BR112018002406A2 (pt) | 2015-10-07 | 2016-10-07 | anticorpos que neutralizam potentemente o vírus da hepatite b e usos dos mesmos |
| PT167790757T PT3359564T (pt) | 2015-10-07 | 2016-10-07 | Anticorpos que neutralizam de um modo potente o vírus da hepatite b e as suas utilizações |
| EP20177206.8A EP3753949A1 (en) | 2015-10-07 | 2016-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
| EP16779075.7A EP3359564B1 (en) | 2015-10-07 | 2016-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
| MYPI2018700678A MY187161A (en) | 2015-10-07 | 2016-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
| US15/766,703 US10683344B2 (en) | 2015-10-07 | 2016-10-07 | Antibodies that potently neutralize hepatitis B virus and uses thereof |
| EA201890874A EA038301B1 (ru) | 2015-10-07 | 2016-10-07 | Антитела, которые эффективно нейтрализуют вирус гепатита в, и их применение |
| PCT/EP2016/074114 WO2017060504A1 (en) | 2015-10-07 | 2016-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
| HUE16779075A HUE050231T2 (hu) | 2015-10-07 | 2016-10-07 | Antitestek, amelyek hatásosan semlegesítik a hepatitisz B vírust, és alkalmazásaik |
| CN202210185497.3A CN114539391A (zh) | 2015-10-07 | 2016-10-07 | 中和乙型肝炎病毒的抗体和其用途 |
| ES16779075T ES2813927T3 (es) | 2015-10-07 | 2016-10-07 | Anticuerpos que neutralizan potencialmente el virus de la Hepatitis B y usos de los mismos |
| SI201630896T SI3359564T1 (sl) | 2015-10-07 | 2016-10-07 | Protitelesa, ki močno nevtralizirajo virus hepatitisa B in njihove uporabe |
| HK18115967.7A HK1256869B (en) | 2015-10-07 | 2016-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
| LTEP16779075.7T LT3359564T (lt) | 2015-10-07 | 2016-10-07 | Antikūnai, kurie stipriai neutralizuoja hepatito b virusą, ir jų panaudojimas |
| CA2993745A CA2993745A1 (en) | 2015-10-07 | 2016-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
| NZ739360A NZ739360B2 (en) | 2016-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof | |
| MX2018004127A MX2018004127A (es) | 2015-10-07 | 2016-10-07 | Anticuerpos que neutralizan potencialmente el virus de hepatitis b y usos de los mismos. |
| PH12018500199A PH12018500199A1 (en) | 2015-10-07 | 2018-01-25 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
| ZA2018/00710A ZA201800710B (en) | 2015-10-07 | 2018-02-02 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
| IL258326A IL258326B (en) | 2015-10-07 | 2018-03-25 | Antibodies that neutralize the hepatitis b virus in potency and their uses |
| US16/864,087 US11390664B2 (en) | 2015-10-07 | 2020-04-30 | Antibodies that potently neutralize hepatitis B virus and uses thereof |
| CY20201100795T CY1123462T1 (el) | 2015-10-07 | 2020-08-26 | Αντισωματα που εξουδετερωνουν ισχυρα τον ιο ηπατιτιδας β και χρησεις αυτων |
| JP2021068062A JP7171809B2 (ja) | 2015-10-07 | 2021-04-14 | B型肝炎ウイルスを強力に中和する抗体及びその使用 |
| US17/867,466 US12037381B2 (en) | 2015-10-07 | 2022-07-18 | Antibodies that potently neutralize hepatitis B virus and uses thereof |
| JP2022175909A JP2023011809A (ja) | 2015-10-07 | 2022-11-02 | B型肝炎ウイルスを強力に中和する抗体及びその使用 |
| JP2024074160A JP2024097078A (ja) | 2015-10-07 | 2024-05-01 | B型肝炎ウイルスを強力に中和する抗体及びその使用 |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/EP2015/001970 WO2017059878A1 (en) | 2015-10-07 | 2015-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017059878A1 true WO2017059878A1 (en) | 2017-04-13 |
Family
ID=54330711
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2015/001970 Ceased WO2017059878A1 (en) | 2015-10-07 | 2015-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
| PCT/EP2016/074114 Ceased WO2017060504A1 (en) | 2015-10-07 | 2016-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/074114 Ceased WO2017060504A1 (en) | 2015-10-07 | 2016-10-07 | Antibodies that potently neutralize hepatitis b virus and uses thereof |
Country Status (24)
| Country | Link |
|---|---|
| US (3) | US10683344B2 (https=) |
| EP (2) | EP3359564B1 (https=) |
| JP (4) | JP6869968B2 (https=) |
| KR (1) | KR102725168B1 (https=) |
| CN (3) | CN114539392B (https=) |
| AU (1) | AU2016334735B2 (https=) |
| BR (1) | BR112018002406A2 (https=) |
| CA (1) | CA2993745A1 (https=) |
| CY (1) | CY1123462T1 (https=) |
| DK (1) | DK3359564T3 (https=) |
| EA (1) | EA038301B1 (https=) |
| ES (1) | ES2813927T3 (https=) |
| HR (1) | HRP20201345T1 (https=) |
| HU (1) | HUE050231T2 (https=) |
| IL (1) | IL258326B (https=) |
| LT (1) | LT3359564T (https=) |
| MX (1) | MX2018004127A (https=) |
| MY (1) | MY187161A (https=) |
| PH (1) | PH12018500199A1 (https=) |
| PL (1) | PL3359564T3 (https=) |
| PT (1) | PT3359564T (https=) |
| SI (1) | SI3359564T1 (https=) |
| WO (2) | WO2017059878A1 (https=) |
| ZA (1) | ZA201800710B (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020132346A1 (en) * | 2018-12-20 | 2020-06-25 | Vir Biotechnology, Inc. | Combination hbv therapy |
| WO2020132091A3 (en) * | 2018-12-19 | 2020-10-15 | Humabs Biomed Sa | Antibodies that neutralize hepatitis b virus and uses thereof |
| CN113234144A (zh) * | 2021-05-26 | 2021-08-10 | 武汉工程大学 | 一种人源性抗乙肝表面抗原的单链抗体、制剂、编码基因、载体质粒及宿主细胞 |
| WO2022087149A2 (en) | 2020-10-22 | 2022-04-28 | Gilead Sciences, Inc. | Interleukin-2-fc fusion proteins and methods of use |
| EP3999533A4 (en) * | 2019-07-20 | 2022-09-07 | Huahui Health Ltd. | METHODS OF TREATMENT OF HBV INFECTION USING ANTI-PRE-S1 HBV ANTIBODIES |
| WO2023039243A3 (en) * | 2021-09-13 | 2023-09-28 | Achelois Biopharma, Inc. | Hepatitis b virus antivirus (hbv-antivirus) compositions and methods of use |
Families Citing this family (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017059878A1 (en) | 2015-10-07 | 2017-04-13 | Humabs Biomed Sa | Antibodies that potently neutralize hepatitis b virus and uses thereof |
| EP3810625B1 (en) * | 2018-05-10 | 2024-05-22 | Clearb Therapeutics Ltd. | Methods and compositions for the treatment of hepatitis b infection |
| US20210214424A1 (en) * | 2018-05-16 | 2021-07-15 | Chang Gung Memorial Hospital, Linkou | Novel leucine-rich repeat neuronal protein 1 (lrrn1) antibodies and uses thereof |
| EP3801766A1 (en) * | 2018-05-31 | 2021-04-14 | Novartis AG | Hepatitis b antibodies |
| WO2020117715A1 (en) | 2018-12-03 | 2020-06-11 | Board Of Regents, The University Of Texas System | Oligo-benzamide analogs and their use in cancer treatment |
| KR102084912B1 (ko) * | 2019-01-17 | 2020-03-05 | 주식회사 녹십자 | B형 간염 바이러스 표면 항원의 입체 에피토프 및 이에 특이적으로 결합하는 항체 |
| CA3152511A1 (en) * | 2019-08-29 | 2021-03-04 | Vir Biotechnology, Inc. | Antibody compositions and methods for treating hepatitis b virus infection |
| CN113717283B (zh) * | 2020-05-25 | 2023-05-26 | 厦门万泰凯瑞生物技术有限公司 | 一种抗乙型肝炎病毒e抗原的单克隆抗体及其应用 |
| JP7579007B2 (ja) * | 2020-06-02 | 2024-11-07 | 株式会社Rcmg | Hbvの抗rnaウイルス粒子抗体 |
| PE20240080A1 (es) * | 2020-06-08 | 2024-01-16 | Hoffmann La Roche | Anticuerpos anti-hbv y metodos de uso |
| EP4168547A1 (en) * | 2020-06-22 | 2023-04-26 | Janssen Pharmaceuticals, Inc. | Compositions and methods for treatment of hepatitis d virus infection |
| PH12022553569A1 (en) * | 2020-06-24 | 2023-04-12 | Humabs Biomed Sa | Engineered hepatitis b virus neutralizing antibodies and uses thereof |
| TWI868379B (zh) * | 2020-07-09 | 2025-01-01 | 大陸商北京凱因科技股份有限公司 | 結合b型肝炎病毒表面抗原的抗體及其應用 |
| JP2024504167A (ja) | 2021-01-26 | 2024-01-30 | ヴィア・バイオテクノロジー・インコーポレイテッド | B型肝炎ウイルス感染を処置するための抗体組成物および方法 |
| WO2023287352A2 (en) * | 2021-07-15 | 2023-01-19 | National University Of Singapore | Anti-hbv antibodies and uses thereof |
| CN113777312B (zh) * | 2021-09-03 | 2024-02-02 | 普十生物科技(北京)有限公司 | 乙肝抗体片段的制备方法、乙肝抗体片段、试剂盒及应用 |
| CA3242060A1 (en) * | 2021-12-21 | 2023-06-29 | Hbvtech, Llc. | Methods for eliminating hepatitis b virus cccdna and rcdna and the hepatitis b drugs used in the methods thereof |
| TW202411246A (zh) | 2022-05-23 | 2024-03-16 | 美商維爾生物科技股份有限公司 | 經工程化之b型肝炎病毒中和抗體及其用途 |
| CN116162153B (zh) * | 2022-09-01 | 2024-09-10 | 复旦大学附属中山医院 | 一种乙肝病毒表面抗原的单克隆抗体及其应用 |
| CN118725092B (zh) * | 2023-03-28 | 2025-08-12 | 东莞市朋志生物科技有限公司 | 抗HBs-Ag抗体、检测HBs-Ag的试剂和试剂盒 |
| AU2024279207A1 (en) * | 2023-05-31 | 2025-10-16 | Bluejay Therapeutics, Inc. | Anti-hbsag antibody for treatment of chronic hepatitis d |
| CN119143869A (zh) * | 2023-06-16 | 2024-12-17 | 复旦大学 | 乙肝病毒表面抗体及其应用 |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1997040164A1 (en) * | 1996-04-25 | 1997-10-30 | Murex Diagnostics Corporation | Hepatitis b monoclonal antibodies |
| WO1998029442A1 (en) * | 1996-12-30 | 1998-07-09 | Innogenetics N.V. | ANNEXIN V-BINDING POLYPEPTIDES DERIVED FROM HBsAg AND THEIR USES |
| WO2006076640A1 (en) * | 2005-01-14 | 2006-07-20 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Monoclonal antibodies that bind or neutralize hepatitis b virus |
| WO2009069917A1 (en) * | 2007-11-30 | 2009-06-04 | Green Cross Corporation | Use of human antibody capable of neutralizing hepatitis b virus for the prevention or treatment of hepatitis b virus infection |
| WO2014032176A1 (en) * | 2012-08-30 | 2014-03-06 | Replicor Inc. | Methods for the treatment of hepatitis b and hepatitis d infections |
| WO2015107126A1 (en) * | 2014-01-16 | 2015-07-23 | Mondelli Mario Umberto Francesco | Neutralizing human monoclonal antibodies against hepatitis b virus surface antigen |
Family Cites Families (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NL154600B (nl) | 1971-02-10 | 1977-09-15 | Organon Nv | Werkwijze voor het aantonen en bepalen van specifiek bindende eiwitten en hun corresponderende bindbare stoffen. |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3766162A (en) | 1971-08-24 | 1973-10-16 | Hoffmann La Roche | Barbituric acid antigens and antibodies specific therefor |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4233402A (en) | 1978-04-05 | 1980-11-11 | Syva Company | Reagents and method employing channeling |
| JPS5896026A (ja) | 1981-10-30 | 1983-06-07 | Nippon Chemiphar Co Ltd | 新規ウロキナ−ゼ誘導体およびその製造法ならびにそれを含有する血栓溶解剤 |
| DE3380726D1 (en) | 1982-06-24 | 1989-11-23 | Japan Chem Res | Long-acting composition |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4831175A (en) | 1986-09-05 | 1989-05-16 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| US5595721A (en) | 1993-09-16 | 1997-01-21 | Coulter Pharmaceutical, Inc. | Radioimmunotherapy of lymphoma using anti-CD20 |
| WO1997039029A2 (en) | 1996-04-18 | 1997-10-23 | Abbott Laboratories | An antigenic epitope of the a determinant of hepatitis b surface antigen and uses thereof |
| US20020102208A1 (en) | 1999-03-01 | 2002-08-01 | Paul Chinn | Radiolabeling kit and binding assay |
| MY133346A (en) | 1999-03-01 | 2007-11-30 | Biogen Inc | Kit for radiolabeling ligands with yttrium-90 |
| AU2004215125B2 (en) | 2003-02-26 | 2011-01-06 | Institute For Research In Biomedicine | Monoclonal antibody production by EBV transformation of B cells |
| NZ544924A (en) | 2003-06-27 | 2009-03-31 | Biogen Idec Inc | Modified binding molecules comprising connecting peptides |
| EP2158318A2 (en) | 2007-05-14 | 2010-03-03 | Biogen Idec MA, Inc. | Single-chain fc (scfc) regions, binding polypeptides comprising same, and methods related thereto |
| PL2350128T3 (pl) | 2008-10-22 | 2015-03-31 | Inst Res Biomedicine | Sposoby wytwarzania przeciwciał z komórek plazmatycznych |
| CN104955837A (zh) * | 2012-11-12 | 2015-09-30 | 海德堡吕布莱希特-卡尔斯大学 | Hbv和/或hdv易感细胞、细胞系和非人动物的开发 |
| WO2017059878A1 (en) | 2015-10-07 | 2017-04-13 | Humabs Biomed Sa | Antibodies that potently neutralize hepatitis b virus and uses thereof |
-
2015
- 2015-10-07 WO PCT/EP2015/001970 patent/WO2017059878A1/en not_active Ceased
-
2016
- 2016-10-07 SI SI201630896T patent/SI3359564T1/sl unknown
- 2016-10-07 MX MX2018004127A patent/MX2018004127A/es unknown
- 2016-10-07 CN CN202210187026.6A patent/CN114539392B/zh active Active
- 2016-10-07 HR HRP20201345TT patent/HRP20201345T1/hr unknown
- 2016-10-07 EA EA201890874A patent/EA038301B1/ru unknown
- 2016-10-07 EP EP16779075.7A patent/EP3359564B1/en active Active
- 2016-10-07 MY MYPI2018700678A patent/MY187161A/en unknown
- 2016-10-07 PL PL16779075T patent/PL3359564T3/pl unknown
- 2016-10-07 CN CN201680055161.8A patent/CN108137675B/zh active Active
- 2016-10-07 EP EP20177206.8A patent/EP3753949A1/en active Pending
- 2016-10-07 AU AU2016334735A patent/AU2016334735B2/en active Active
- 2016-10-07 US US15/766,703 patent/US10683344B2/en active Active
- 2016-10-07 DK DK16779075.7T patent/DK3359564T3/da active
- 2016-10-07 ES ES16779075T patent/ES2813927T3/es active Active
- 2016-10-07 JP JP2018514962A patent/JP6869968B2/ja active Active
- 2016-10-07 KR KR1020187012979A patent/KR102725168B1/ko active Active
- 2016-10-07 CN CN202210185497.3A patent/CN114539391A/zh active Pending
- 2016-10-07 BR BR112018002406-6A patent/BR112018002406A2/pt not_active Application Discontinuation
- 2016-10-07 WO PCT/EP2016/074114 patent/WO2017060504A1/en not_active Ceased
- 2016-10-07 HU HUE16779075A patent/HUE050231T2/hu unknown
- 2016-10-07 LT LTEP16779075.7T patent/LT3359564T/lt unknown
- 2016-10-07 CA CA2993745A patent/CA2993745A1/en active Pending
- 2016-10-07 PT PT167790757T patent/PT3359564T/pt unknown
-
2018
- 2018-01-25 PH PH12018500199A patent/PH12018500199A1/en unknown
- 2018-02-02 ZA ZA2018/00710A patent/ZA201800710B/en unknown
- 2018-03-25 IL IL258326A patent/IL258326B/en unknown
-
2020
- 2020-04-30 US US16/864,087 patent/US11390664B2/en active Active
- 2020-08-26 CY CY20201100795T patent/CY1123462T1/el unknown
-
2021
- 2021-04-14 JP JP2021068062A patent/JP7171809B2/ja active Active
-
2022
- 2022-07-18 US US17/867,466 patent/US12037381B2/en active Active
- 2022-11-02 JP JP2022175909A patent/JP2023011809A/ja not_active Withdrawn
-
2024
- 2024-05-01 JP JP2024074160A patent/JP2024097078A/ja active Pending
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1997040164A1 (en) * | 1996-04-25 | 1997-10-30 | Murex Diagnostics Corporation | Hepatitis b monoclonal antibodies |
| WO1998029442A1 (en) * | 1996-12-30 | 1998-07-09 | Innogenetics N.V. | ANNEXIN V-BINDING POLYPEPTIDES DERIVED FROM HBsAg AND THEIR USES |
| WO2006076640A1 (en) * | 2005-01-14 | 2006-07-20 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Monoclonal antibodies that bind or neutralize hepatitis b virus |
| WO2009069917A1 (en) * | 2007-11-30 | 2009-06-04 | Green Cross Corporation | Use of human antibody capable of neutralizing hepatitis b virus for the prevention or treatment of hepatitis b virus infection |
| WO2014032176A1 (en) * | 2012-08-30 | 2014-03-06 | Replicor Inc. | Methods for the treatment of hepatitis b and hepatitis d infections |
| WO2015107126A1 (en) * | 2014-01-16 | 2015-07-23 | Mondelli Mario Umberto Francesco | Neutralizing human monoclonal antibodies against hepatitis b virus surface antigen |
Non-Patent Citations (6)
| Title |
|---|
| C SUREAU ET AL: "Production of infectious hepatitis delta virus in vitro and neutralization with antibodies directed against hepatitis B virus pre-S antigens", JOURNAL OF VIROLOGY, 1 February 1992 (1992-02-01), UNITED STATES, pages 1241 - 1245, XP055229681, Retrieved from the Internet <URL:http://jvi.asm.org/content/66/2/1241.full.pdf#page=1&view=FitH> [retrieved on 20151119] * |
| FOROUGH GOLSAZ SHIRAZI ET AL: "Monoclonal antibodies to various epitopes of hepatitis B surface antigen inhibit hepatitis B virus infection", JOURNAL OF GASTROENTEROLOGY AND HEPATOLOGY, vol. 29, no. 5, 21 April 2014 (2014-04-21), AU, pages 1083 - 1091, XP055231723, ISSN: 0815-9319, DOI: 10.1111/jgh.12483 * |
| HEINER WEDEMEYER ET AL: "Update on the Management of HBV-HDV Coinfection", CURRENT HEPATITIS REPORTS, CURRENT SCIENCE INC, NEW YORK, vol. 11, no. 2, 25 March 2012 (2012-03-25), pages 95 - 101, XP035063834, ISSN: 1541-0706, DOI: 10.1007/S11901-012-0129-3 * |
| QIU X ET AL: "IDENTIFICATION AND CHARACTERIZATION OF A C(K/R)TC MOTIF AS A COMMON EPITOPE PRESENT IN ALL SUBTYPES OF HEPATITIS B SURFACE ANTIGEN", THE JOURNAL OF IMMUNOLOGY, THE AMERICAN ASSOCIATION OF IMMUNOLOGISTS, US, vol. 156, no. 9, 1 May 1996 (1996-05-01), pages 3350 - 3356, XP002041204, ISSN: 0022-1767 * |
| TRAGGIAI E ET AL: "An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus", NATURE MEDICINE, NATURE PUBLISHING GROUP, NEW YORK, NY, US, vol. 10, no. 8, 11 July 2004 (2004-07-11), pages 871 - 875, XP002385893, ISSN: 1078-8956 * |
| ZUBKIN M ET AL: "76 Strategy of vaccination against HBV-infection in hemodialysis patients with 'isolated' HBcAb", INTERNATIONAL JOURNAL OF INFECTIOUS DISEASES, INTERNATIONAL SOCIETY FOR INFECTIOUS DISEASES, HAMILTON, CA, vol. 10, 1 January 2006 (2006-01-01), pages S42 - S43, XP028032646, ISSN: 1201-9712, [retrieved on 20060101], DOI: 10.1016/S1201-9712(06)80073-1 * |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4292659A3 (en) * | 2018-12-19 | 2024-03-20 | Humabs Biomed SA | Antibodies that neutralize hepatitis b virus and uses thereof |
| WO2020132091A3 (en) * | 2018-12-19 | 2020-10-15 | Humabs Biomed Sa | Antibodies that neutralize hepatitis b virus and uses thereof |
| TWI892974B (zh) * | 2018-12-19 | 2025-08-11 | 瑞士商休曼斯生物醫藥公司 | 中和b型肝炎病毒之抗體和彼之用途 |
| CN113544148A (zh) * | 2018-12-19 | 2021-10-22 | 胡默波斯生物医学公司 | 中和乙型肝炎病毒的抗体和其用途 |
| US12304946B2 (en) | 2018-12-19 | 2025-05-20 | Humabs Biomed Sa | Antibodies that neutralize hepatitis B virus and uses thereof |
| AU2019403245B2 (en) * | 2018-12-19 | 2024-10-31 | Humabs Biomed Sa | Antibodies that neutralize hepatitis B virus and uses thereof |
| CN113544148B (zh) * | 2018-12-19 | 2024-04-05 | 胡默波斯生物医学公司 | 中和乙型肝炎病毒的抗体和其用途 |
| EP4285929A3 (en) * | 2018-12-20 | 2024-03-06 | Humabs Biomed SA | Combination hbv therapy |
| WO2020132346A1 (en) * | 2018-12-20 | 2020-06-25 | Vir Biotechnology, Inc. | Combination hbv therapy |
| US12404318B2 (en) | 2018-12-20 | 2025-09-02 | Vir Biotechnology, Inc. | Combination HBV therapy |
| TWI912239B (zh) * | 2018-12-20 | 2026-01-21 | 瑞士商休曼斯生物醫藥公司 | 組合hbv療法 |
| EP4656656A3 (en) * | 2018-12-20 | 2026-03-04 | Humabs BioMed SA | Combination hbv therapy |
| EP3999533A4 (en) * | 2019-07-20 | 2022-09-07 | Huahui Health Ltd. | METHODS OF TREATMENT OF HBV INFECTION USING ANTI-PRE-S1 HBV ANTIBODIES |
| US12509504B2 (en) | 2019-07-20 | 2025-12-30 | Huahui Health Ltd. | Method of treating HBV infection by using anti-pre-S1 HBV antibodies |
| WO2022087149A2 (en) | 2020-10-22 | 2022-04-28 | Gilead Sciences, Inc. | Interleukin-2-fc fusion proteins and methods of use |
| EP4667499A2 (en) | 2020-10-22 | 2025-12-24 | Gilead Sciences, Inc. | Interleukin-2-fc fusion proteins and methods of use |
| CN113234144B (zh) * | 2021-05-26 | 2022-02-25 | 武汉工程大学 | 一种人源性抗乙肝表面抗原的单链抗体、制剂、编码基因、载体质粒及宿主细胞 |
| CN113234144A (zh) * | 2021-05-26 | 2021-08-10 | 武汉工程大学 | 一种人源性抗乙肝表面抗原的单链抗体、制剂、编码基因、载体质粒及宿主细胞 |
| WO2023039243A3 (en) * | 2021-09-13 | 2023-09-28 | Achelois Biopharma, Inc. | Hepatitis b virus antivirus (hbv-antivirus) compositions and methods of use |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12037381B2 (en) | Antibodies that potently neutralize hepatitis B virus and uses thereof | |
| US20250353900A1 (en) | Antibodies that neutralize hepatitis b virus and uses thereof | |
| HK40074417A (en) | Antibodies that neutralize hepatitis b virus and uses thereof | |
| HK40074418A (en) | Antibodies that neutralize hepatitis b virus and uses thereof | |
| HK40037903A (en) | Antibodies that potently neutralize hepatitis b virus and uses thereof | |
| HK40074418B (zh) | 中和乙型肝炎病毒的抗体和其用途 | |
| HK1256869B (en) | Antibodies that potently neutralize hepatitis b virus and uses thereof | |
| HK40056051A (en) | Antibodies that neutralize hepatitis b virus and uses thereof | |
| CN117042797A (zh) | 用于治疗乙型肝炎病毒感染的组合物和方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15781576 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 15781576 Country of ref document: EP Kind code of ref document: A1 |