WO2016207278A1 - Multispecific nk engager proteins - Google Patents
Multispecific nk engager proteins Download PDFInfo
- Publication number
- WO2016207278A1 WO2016207278A1 PCT/EP2016/064537 EP2016064537W WO2016207278A1 WO 2016207278 A1 WO2016207278 A1 WO 2016207278A1 EP 2016064537 W EP2016064537 W EP 2016064537W WO 2016207278 A1 WO2016207278 A1 WO 2016207278A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- domain
- nkp46
- polypeptide
- protein
- antigen binding
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/15—Natural-killer [NK] cells; Natural-killer T [NKT] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/283—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/522—CH1 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- Multispecific proteins that bind and specifically redirect effector cells to lyse a target cell of interest via multiple activating receptors are provided.
- the proteins have utility in the treatment of disease, notably cancer or infectious disease.
- Bispecific antibodies binding two different epitopes offer opportunities for increasing specificity, broadening potency, and utilizing novel mechanisms of action that cannot be achieved with a traditional monoclonal antibody.
- a variety of formats for bispecific antibodies that bind to two targets simultaneously have been reported.
- Cross-linking two different receptors using a bispecific antibody to inhibit a signaling pathway has shown utility in a number of applications (see, e.g., Jackman, et al., (2010) J. Biol. Chem. 285:20850-20859).
- Bispecific antibodies have also been used to neutralize two different receptors.
- bispecific antibodies have been used to recruit immune effector cells, where T- cell activation is achieved in proximity to tumor cells by the bispecific antibody which binds receptors simultaneously on the two different cell types (see Baeuerle, P. A., et al, (2009) Cancer Res 69(12):4941 -4). These antibodies have been referred to as "Bispecific T-cell engager antibodies" (or "BiTE" antibodies). However, in order to fully activate the T-cell, this T-cell and a cluster of BiTEs must interact on the surface of a target cell.
- Bispecific antibodies developed to date also include those which link the CD3 complex on T cells to a tumor-associated antigen. Also, bispecific antibodies having one arm which binds CD16 (FcyRllla) and another which bound to an antigen of interest such as CD19 have been developed (see Kellner et al. (201 1 ) Cancer Lett. 303(2): 128-139).
- NK cells Natural killer (NK) cells are a subpopulation of lymphocytes that are involved in non- conventional immunity. NK cells provide an efficient immunosurveillance mechanism by which undesired cells such as tumor or virally-infected cells can be eliminated. Characteristics and biological properties of NK cells include the expression of surface antigens including CD16, CD56 and/or CD57, the absence of the ⁇ / ⁇ or ⁇ / ⁇ TCR complex on the cell surface; the ability to bind to and kill cells that fail to express "self" MHC/HLA antigens by the activation of specific cytolytic enzymes, the ability to kill tumor cells or other diseased cells that express a ligand for NK activating receptors, and the ability to release protein molecules called cytokines that stimulate or inhibit the immune response.
- NK cell activity is regulated by a complex mechanism that involves both activating and inhibitory signals.
- Several distinct NK cell receptors have been identified that play an important role in the NK cell mediated recognition and killing of HLA Class I deficient target cells.
- One receptor although not specific to NK cells, is FcyR3a (CD16) which is responsible for NK cell mediated ADCC.
- NK cells also express a range of other activating and co- activating receptors, including CD137 (4-1 BB).
- Agonist antibodies against anti-4-1 BB are in clinical trials in patients with solid tumors, including melanoma, renal carcinoma, and ovarian cancer, and have shown strong activity in different cancer models, including breast cancer, sarcoma, glioma, colon carcinoma, myeloma, and mastocytoma.
- NKp46 Another NK cell receptor is NKp46, a member of the Ig superfamily.
- NKp46 is specific to NK cells and the cross-linking thereof, induced by specific mAbs, leads to a strong NK cell activation resulting in increased intracellular Ca ++ levels, the triggering of cytotoxicity, and lymphokine release.
- International patent publication number WO2005/105858 discloses the use of monospecific full-length IgG anti-NKp46 antibodies that bind Fey receptors for treating hematological malignancies that are Fcy-positive. Fc ⁇ receptors expressed on tumor cells (e.g.
- B cell malignancies were proposed to interact with the Fc domain of the anti-NKp46 antibodies which bound NK cells, such that the activated NK cells are brought into close proximity with target cells via the two reactive portions of the antibody (i.e., the antigen-recognizing domain and the Fc domain), thereby enhancing the efficiency of the treatment.
- the present invention arises from the discovery of functional multi-specific proteins (e.g. a polypeptide, a single chain protein, a multi-chain protein, including but not limited to antibody-based protein formats) that binds NKp46 on NK cells and to an antigen of interest on a target cell, and is capable of redirecting NK cells to lyse a target cell that expresses the antigen of interest, e.g. a cell that contributes to disease.
- functional multi-specific proteins e.g. a polypeptide, a single chain protein, a multi-chain protein, including but not limited to antibody-based protein formats
- a multispecific protein comprising a first antigen binding domain and a second antigen binding domain, wherein one of the first or second antigen binding domains binds to a human NKp46 polypeptide and the other binds an antigen of interest, wherein the multispecific protein binds the NKp46 polypeptide monovalently, and wherein the multispecific protein is capable of directing an NKp46-expressing NK cell to lyse a target cell expressing the antigen of interest.
- the multi- specific protein can bind (i) to antigen of interest on target cells and (ii) to NKp46 on NK cells, and, when bound to both antigen of interest on target cells and NKp46, can induce signaling in and/or activation of the NK cells through NKp46 (the protein acts as an NKp46 agonist), thereby promoting activation of NK cells and/or lysis of target cells, notably via the activating signal transmitted by NKp46.
- the multispecific protein comprises at least a portion of a human Fc domain, e.g. an Fc domain that is bound by FcRn.
- the multispecific antibody is designed to have decreased or substantially lack FcyR binding compared to a conventional full-length human lgG1 antibody.
- the multispecific protein has decreased or abolished binding to a human CD16, CD32A, CD32B and/or CD64 polypeptide, compared to a full length wild type human lgG1 antibody.
- the multispecific protein is designed to retain substantial FcyR binding, e.g., compared to a conventional full-length human lgG1 antibody.
- the multispecific protein binds (e.g. via its Fc domain) to a human CD16, CD32A, CD32B and/or CD64 polypeptide.
- the present invention arises in part from the observation that multispecific proteins which bind to an antigen of interest and which are further engineered to bind to NKp46 on NK cells monovalently, and to CD16 or CD16A, exhibit an enhanced capability to promote NK cell-mediated target cell lysis (relative to conventional antibodies).
- multispecific proteins which bind to an antigen of interest and which are further engineered to bind to NKp46 on NK cells monovalently, and to CD16 or CD16A, exhibit an enhanced capability to promote NK cell-mediated target cell lysis (relative to conventional antibodies).
- various functional multispecific proteins were constructed that bind (a) NKp46 and CD16 on NK cells and (b) to an antigen of interest on a target cell, which are capable of redirecting NK cells to lyse a target cell that expresses the antigen of interest, e.g. a cell that contributes to a disease such as cancer or infection. Moreover, despite binding to NKp46 on NK cells, advantageously these multispecific proteins do not induce lysis of NK cells themselves.
- novel formats for multispecific Fc proteins that are capable of activating CD16 and NKp46 and which can be used to promote NK-mediated killing of desired target cells.
- the potency in target cell killing demonstrated by the subject multispecific proteins which bind CD16 and which in addition bind to NKp46 and to an antigen of interest is believed to arise at least in part from an induction and upregulation of the co-activating receptor CD137 which is expressed on the surface NK cells.
- CD137 upregulation occurs on resting NK cells, in the absence of target cells (as well as in the presence of target cells), and without the induction of CD16-mediated lysis of NK cells.
- NK cells with increased CD137 expression are known to be highly active against target cells (e.g.
- the instant multispecific proteins which bind CD16 in addition to monovalently binding NKp46 can provide a means to upregulate CD137.
- the multispecific protein when binding additionally to an antigen of interest expressed by a target cell can elicit a multi-pronged recognition of target cells that involves multiple activating receptors expressed on effector cells.
- the multispecific proteins are far more potent in inducing NK cell-mediated lysis of tumor cells than human lgG1 antibodies.
- these multispecific proteins trigger the combined effects of NKp46-, CD16- and/or CD137-mediated activation thereby providing for a synergistic or additive enhancement in the induction of NK cell cytotoxicity by CD16 + NKp46 + NK cells. Additionally, independently of any contribution of CD137, these multispecific proteins advantageously are able to potently mobilize both CD16 + and CD16 " NK cells (all NK cells are NKp46 + ).
- the subject multispecific proteins are bound by CD16, unexpectedly they do not induce or increase down-modulation or internalization of the antigen of interest, even when targeting antigens of interest known to be susceptible to down-modulation or internalization when bound by conventional antibodies (such as full length human IgGVs).
- the subject multispecific proteins should be well suited for targeting antigens of interest expressed by target cells, e.g., tumor or infected cells, including antigens which are known to be capable of undergoing down-modulation or internalization when bound by conventional antibodies (e.g. antibodies with human lgG1 Fc domains that retain CD16 binding). This is a huge therapeutic benefit since it is known in the art that antigen internalization can substantially impede the ability of conventional human lgG1 antibodies to mediate ADCC against a target cell.
- multispecific proteins which bind to an antigen of interest expressed on the surface of a cell monovalently, wherein the protein does not increase or induce down-modulation or intracellular internalization of the antigen of interest.
- the invention provides a multispecific protein that comprises an antigen binding domain that binds to a human a NKp46 polypeptide monovalently (e.g., via a single antigen binding domain), and which is capable of binding to human CD16, and which when incubated in soluble form with effector cells expressing a NKp46 polypeptide and CD16 (e.g. human NKp46 + CD16 + NK cells), optionally in the absence and/or presence of target cells, further optionally in the absence of other cells, can cause an increase or induction of CD137 polypeptide expression on the surface of the effector cells (e.g. without inducing detectable lysis of the NK cells).
- the multispecific protein further binds to an antigen of interest.
- the invention provides a multispecific protein that comprises (i) a first antigen binding domain ("ABD") that binds to a human NKp46 polypeptide, (ii) an Fc domain that binds to human CD16A, and (iii) a second antigen binding domain that binds to an antigen of interest expressed by a target cell.
- ABD first antigen binding domain
- Fc Fc domain
- CD16A Fc domain that binds to human CD16A
- a second antigen binding domain that binds to an antigen of interest expressed by a target cell.
- the multispecific protein is capable of directing an NKp46-expressing NK cell to lyse a target cell expressing the antigen of interest, wherein said lysis of the target cell is mediated by NKp46-signaling, wherein optionally said lysis of the target cell is mediated by a combination of Nkp46- mediated signaling and CD16-mediated antibody-dependent cell-mediated cytotoxicity ("ADCC").
- ADCC antibody-dependent cell-mediated cytotoxicity
- the invention provides a multispecific antigen binding protein which comprises (i) a monovalent antigen binding polypeptide ("ABD") which binds to a human NKp46 polypeptide (i) an ABD which binds to an antigen of interest, wherein said antigen of interest optionally comprises an antigen expressed by a tumor cell or an infectious agent and (iii) a CD16A binding polypeptide, optionally an Fc polypeptide which Fc polypeptide is optionally modified to enhance CD16A binding relative to the corresponding wild-type Fc polypeptide, wherein the multispecific protein is capable of directing an NKp46- expressing NK cell to lyse a target cell expressing the antigen of interest by NKp46- signaling.
- ABD monovalent antigen binding polypeptide
- the invention provides an isolated multispecific Fc-protein comprising a first antigen binding domain, a second antigen binding domain, and an Fc domain or portion thereof, which optionally may be modified, that is capable of binding human CD16 or CD16A, wherein one of the first or second antigen binding domains binds to a human NKp46 polypeptide and the other binds an antigen of interest, and wherein the multispecific protein is capable of directing an NKp46-expressing NK cell to lyse a target cell expressing the antigen of interest.
- the protein causes lysis of the target cell by enhancing or inducing NKp46-signaling, wherein optionally lysis of the target cell is mediated by a combination of Nkp46 signaling and CD16-mediated antibody-dependent cell- mediated cytotoxicity ("ADCC").
- the multispecific protein further comprises a third or fourth or more antigen binding domains that each bind to an antigen of interest, e.g., one other than a NKp46 polypeptide, i.e., an antigen of interest expressed by a target cell such as a tumor cell or infectious agent, wherein the antigen of interest is the same or different from the antigen of interest bound by the second antigen binding domain.
- the third antigen binding domain binds to the same antigen of interest as the second antigen binding domain, optionally further wherein the third antigen binding domain binds to the same epitope or a different epitope on the antigen of interest as the second antigen binding domain.
- the antigen of interest is a cancer antigen.
- the antigen of interest is a protein expressed (optionally over-expressed) on the surface of malignant immune cells, e.g. cells involved in a hematological malignancy, leukemia cells, lymphoma cells, a CD19 protein, a CD20 protein, etc.
- the protein is used to treat a hematological malignancy, e.g., a leukemia or lymphoma cells.
- the antigen of interest is a protein expressed (optionally over- expressed) on the surface of infected cells or by an infectious agent such as virally, bacterially or parasite infected cells.
- the subject multispecific polypeptides when incubated in soluble form with effector cells expressing NKp46 and CD16 (e.g. human NKp46 + CD16 + NK cells), optionally in the presence or absence of other cells (e.g. target cells), can elicit an increase or induction of CD137 polypeptide expression on the surface of the NK cells (e.g. without inducing detectable lysis of the NK cells).
- the multispecific protein in the presence of target cells expressing the antigen of interest and NKp46 + CD16 + NK cells, the multispecific protein can induce the activation of NK cells and/or lysis of target cells, in particular via the activating signal(s) transmitted by any combination of NKp46, CD16 and/or CD137.
- the multispecific protein binds to NKp46 in monovalent fashion.
- the multispecific protein comprises an Nkp46- binding ABD which binds to an NKp46 polypeptide monovalently.
- the multispecific protein in the presence of target cells and NK cells, is capable of inducing an increase in cell surface CD137, e.g., on NK cells that express NK46 and CD16 (NKp46 + CD16 + NK cells).
- the multispecific protein in the presence of target cells and NK cells, is capable of inducing signaling by NK cells through NKp46.
- the multispecific protein lacks the ability to induce NKp46-mediated signaling or cellular activation of an NK cell (independently of CD16), when incubated with NK cells in the absence of target cells (cells expressing the antigen of interest); for example the multispecific protein lacks the ability to induce NKp46-mediated signaling or NK cell activation when incubated with NK cells in the absence of target cells, when the protein is modified to comprise an Fc domain that does not bind CD16 (e.g. an Fc region containing a N297S substitution); or the multispecific protein lacks the ability to induce NKp46-mediated signaling or NK cell activation when incubated with NKp46 + CD16 " NK cells, in the absence of target cells.
- such multispecific protein potentially possesses the following characteristics:
- NKp46 + CD16 + NK cells capable of inducing human NK cells that express CD16 and NKp46 (NKp46 + CD16 + NK cells) to lyse target cells expressing the antigen of interest, when incubated in the presence of the NK cells and target cells;
- the invention provides multispecific protein formats adapted for use in an NKp46-based NK cell engager, including antibody-based formats comprising antigen binding domain(s) and/or constant region domain(s) from immunoglobulins capable of forming a dimeric Fc domain that binds to human CD16 (and optionally further binding to FcRn and/or other human Fey receptors).
- antibody-based formats comprising antigen binding domain(s) and/or constant region domain(s) from immunoglobulins capable of forming a dimeric Fc domain that binds to human CD16 (and optionally further binding to FcRn and/or other human Fey receptors).
- the invention provides multispecific antibody formats with favorable pharmacology due to FcRn binding which can direct NK cell cytotoxicity to a target of interest, and which further possess increased ability to lyse target cells via the combined action of activating receptors CD16, NKp46, and in addition optionally CD137.
- the multispecific protein can be characterized by a lack of agonist activity for NKp46 when incubated with Fey receptor- negative NK cells (e.g. as purified NKp46 + CD16 " NK cells) and in the absence of target cells (e.g. cells expressing the antigen of interest).
- Fey receptor- negative NK cells e.g. as purified NKp46 + CD16 " NK cells
- target cells e.g. cells expressing the antigen of interest
- the invention provides a method for identifying, testing and/or producing a multispecific protein that binds NKp46 and CD16 on an NK cell and an antigen of interest expressed by a target cell, the method comprising:
- NKp46 + CD16 + NK cells e.g. NKp46 + CD16 + NK cells
- the NK cells are purified NK cells.
- the invention provides a method for identifying, testing and/or producing a multispecific protein, the method comprising providing a plurality of multispecific proteins that bind NKp46 and CD16 on an NK cell and an antigen of interest expressed by a target cell:
- each multispecific protein for the ability to induce an increase in cell surface CD137 when incubated with CD16-expressing NK cells (e.g. NKp46 + CD16 + NK cells); and
- a. has the ability to induce NK cells that express CD16 and NKp46 to lyse target cells, when incubated in the presence of the NK cells and target cells, and
- b. optionally, has the ability to induce an increase in cell surface CD137 when incubated with CD16-expressing NK cells.
- the invention provides a method for identifying, testing and/or producing a multispecific protein, the method comprising providing a plurality of multispecific proteins that bind NKp46 and CD16 on an NK cell and an antigen of interest expressed by a target cell:
- each multispecific protein optionally, further assessing each multispecific protein to determine whether it is capable of inducing an increase in cell surface CD137 when incubated with CD16-expressing NK cells (e.g. NKp46 + CD16 + NK cells); and
- a. lacks the ability to induce NKp46-mediated signaling or NK cell activation in an NK cell independently of CD16, when incubated with NK cells in absence of target cells;
- b. has the ability to induce NK cells to lyse target cells, when incubated with NK cells and target cells, and
- c. optionally, has the ability to induce an increase in cell surface CD137 when incubated with CD16-expressing NK cells.
- the invention provides a multispecific protein that binds human CD16 (e.g. polypeptide, non-antibody polypeptide, or antibody), comprising: (a) a first antigen binding domain; and (b) a second antigen binding domain, wherein one of the first antigen binding domains binds NKp46 and the other binds to an antigen of interest on a target cell (other than NKp46), wherein the multispecific protein is capable of directing NKp46-expressing NK cells to lyse said target cell.
- human CD16 e.g. polypeptide, non-antibody polypeptide, or antibody
- the protein comprises at least a portion of a human Fc domain, optionally wherein the Fc domain is dimeric, and is bound by human CD16 (and further optionally wherein the Fc domain is also bound by FcRn), and still further optionally wherein the multispecific antibody comprises an Fc domain comprising a modification (compared to a wild-type Fc domain) that results in increased binding to CD16; in one embodiment, the Fc domain is interposed between the two ABDs (one ABD is placed N- terminal and the other is C- terminal to the Fc domain).
- the multispecific protein comprises two or more polypeptide chains, i.e. it comprises a multi-chain protein.
- the multispecific protein or multi-chain protein can be a dimer, trimer or tetramer or may comprise more than 4 polypeptide chains.
- An antigen binding domain positioned on a polypeptide chain can itself bind to its target (i.e., NKp46 or an antigen of interest) (e.g. an scFv or single antigen binding domain) or can optionally bind its target when it is in association or together with one or more complementary protein domains (antigen binding domain or domains) positioned on a different polypeptide chain, wherein these polypeptide chains associate to form a multimer (e.g. dimer, trimer, etc.).
- the multispecific protein binds an NKp46 polypeptide (e.g. expressed on the surface of a NK cell) in monovalent fashion. In one aspect, the multispecific protein binds the antigen of interest in monovalent fashion.
- the invention provides multispecific proteins having a structure in which the freedom of motion (intrachain domain motion) or flexibility of one or more antigen binding domains (ABDs) is increased, e.g. compared to the ABDs of a conventional human IgG antibody.
- a multispecific protein comprising a structure that permits the antigen binding site of the first antigen binding domain and the antigen binding site of the second antigen binding domain to be separated by a distance that results in enhanced function, e.g., the ability of the multispecific protein to induce NKp46 signaling and lysis of target cells, e.g., optionally a distance of less than 80 angstrom (A).
- Multispecific proteins wherein the ABDs possess greater flexibility and/or are separated by an optimized distance may enhance the formation of a lytic NKp46-target synapse, thereby potentiating NKp46-mediated signaling.
- the invention provides multispecific proteins having increased freedom of motion of the antigen binding domains (e.g. compared to the ABDs of a conventional human IgG antibody, e.g., a human lgG1 antibody).
- a monomeric or multimeric Fc domain-containing protein e.g. a heterodimer or heterotrimer
- an antigen binding domain e.g., the ABD that binds NKp46 or the ABD that bind the antigen of interest
- an antigen binding domain e.g., the ABD that binds NKp46 or the ABD that bind the antigen of interest
- the linker can provide flexibility or freedom of motion of one or more ABDs by conferring the ability to bend thereby potentially decreasing the angle between the ABD and the Fc domain (or between the two ABDs) at the linker.
- both antigen binding domains (and optionally more if additional ABDs are present in the multispecific protein) are linked or fused to the Fc domain via a linker, typically a flexible peptide linker.
- other sequences or domains such as constant domains which optionally may be modified to alter (enhance or inhibit) one or more effector functions are placed between the Fc domain and an ABD, e.g. such that the ABD is fused to the Fc domain via a flexible linker and a constant region.
- the antigen binding domain can for example be comprised of variable region(s), a dAb, a VhH or a non-lg scaffold.
- the antigen binding domain may be present in its entirety on a single polypeptide chain or may be formed from the association with a domain present on a separate polypeptide chain.
- the protein with increased freedom of motion permits the protein to adopt a conformation in which the distance between the NKp46 binding site and the antigen of interest binding site is less that than observed in proteins in which both binding domains were Fabs, or less than in full length antibodies.
- An ABD can be connected to the Fc domain (or CH2 or CH3 domain thereof) via a flexible linker (optionally via intervening sequences such as constant region domains or portions thereof, e.g. CH1 or CK).
- the linker can be a polypeptide linker, for example peptide linkers comprising a length of at least 5 residues, at least 10 residues, at least 15 residues, at least 20 residues, at least 25 residues, at least 30 residues or more.
- the linkers comprises a length of between 2-4 residues, between 2-4 residues, between 2-6 residues, between 2-8 residues, between 2-10 residues, between 2- 12 residues, between 2-14 residues, between 2-16 residues, between 2-18 residues, between 2- 20 residues, between 2-30 residues, between 10-24 residues, between 10-26 residues, between 10-30 residues, or between 10-50 residues.
- a linker comprises an amino acid sequence derived from an antibody constant region, e.g., an N-terminal CH1 or hinge sequence.
- a linker comprises the amino acid sequence RTVA.
- a linker is a flexible linker predominantly or exclusively comprised of glycine and/or serine residues, e.g., comprising the amino acid sequence GEGTSTGS(G 2 S) 2 GGAD or the amino acid sequence (G 4 S) 3 .
- the Fc domain is interposed between the two ABDs (one ABD is placed N- terminal and the other is C- terminal to the Fc domain).
- the subject multispecific proteins e.g. dimers, trimers, tetramers
- the multispecific proteins may comprise a domain arrangement of any of the following in which domains can be placed on any of the 2, 3 or 4 polypeptide chains, wherein the Fc domain is not interposed between ABDs (e.g. the protein has a terminal or distal Fc domain), and wherein a flexible linker is present between at least one of the ABDs and the Fc domain:
- one of ABD-i and ABD 2 is an antigen binding domain that binds NKp46 and the other is an antigen binding domain that binds an antigen of interest, and wherein the linker is a flexible polypeptide linker.
- the Fc domain can be a dimeric Fc domain (e.g. that binds human FcRn and/or Fey receptors).
- each of ABD-i and ABD 2 are formed from two variable regions present within tandem variable regions, wherein the variable regions that associate to form a particular ABD can be on the same polypeptide chain or on different polypeptide chains.
- one of ABD-i and ABD 2 comprises a tandem variable region and the other comprises a Fab structure.
- the invention also identifies specific epitopes on NKp46 which are well suited for targeting with NKp46 binding moieties, including the multispecific polypeptides disclosed herein.
- NKp46 binding moieties including the multispecific polypeptides disclosed herein.
- bispecific or multispecific proteins which bind to one or more of these Nkp46 epitopes possess advantageous properties, notably high efficacy in causing or directing NK cells to lyse target cells (e.g. via NKp46-mediated signaling).
- CDRs of different anti-NKp46 antibodies suitable for use in the construction of efficient multispecific proteins, e.g., bispecific and trispecific proteins particularly those which potently lyse a target cell of interest, and amino acid and nucleic acid sequences of exemplary multispecific proteins and nucleic acids which encode these proteins.
- the protein (and/or the antigen binding domain thereof that binds
- NKp46 competes for binding to a NKp46 polypeptide with any one or any combination of monoclonal antibodies NKp46-1 , -2, -3, -4, -6 or -9 or an Anti-CD19-F5-Anti-NKp46 antibody that comprises such NKp46-1 , -2, -3, -4, -6 or -9 bispecific antibodies.
- the antigen binding domain that binds NKp46 binds an epitope within (partly or fully within) the D2 (proximal) domain of the NKp46 polypeptide.
- the antigen binding domain that binds NKp46 binds an epitope within (partly or fully within) the D1 (distal) domain of the NKp46 polypeptide. In one embodiment, the antigen binding domain that binds NKp46 binds an epitope on an NKp46 polypeptide of SEQ ID NO:1 comprising one, two, three or more residues selected from the residues bound by any one or combination of antibodies NKp46-1 , -2, -3, -4, -6 or -9 or an Anti-CD19-F5-Anti-NKp46 antibody that comprises such NKp46-1 , -2, -3, -4, -6 or -9 bispecific antibodies.
- the multispecific protein is capable of binding to human neonatal Fc receptor (FcRn). In one embodiment the multispecific protein has decreased or abolished binding to a human and/or non-human primate (e.g. cynomolgus monkey) Fey receptor, e.g., compared to a full length wild type human lgG1 antibody. In one embodiment the multispecific protein is capable of inducing NK-mediated lysis (e.g. as well as or better than a full length human wild-type lgG1 antibody).
- the antigen binding domain that binds to an antigen of interest binds to an antigen (e.g. polypeptide) expressed by a target cell which is sought to be lysed by an NK cell.
- an antigen e.g. polypeptide
- this antigen is expressed by a cancer cell, or a virally, bacterially or parasite infected cell, an immune cell that contributes to tumor growth or escape (e.g. a tumor-associated monocyte or macrophage), or a cell that contributes to an autoimmunity, an allergic response or inflammatory disease.
- the multispecific protein binds NKp46 in monovalent fashion. In one embodiment, the multispecific protein binds to the antigen of interest in monovalent fashion. In one embodiment, the multispecific protein binds both NKp46 and the antigen of interest in monovalent fashion. In one embodiment, the multispecific protein binds CD16 via a dimeric Fc domain.
- the first antigen binding domain comprises an antibody heavy chain variable domain and a light chain variable domain.
- both said heavy and light chain variable domains are involved in binding interactions with NKp46.
- the second ABD (and optionally third or more ABDs, when present) comprises an antibody heavy chain variable domain and a light chain variable domain.
- both said heavy and light chain variable domains are involved in binding interactions with the antigen bound by the second antigen binding domain.
- the second ABD (and optionally third or more ABD, when present) comprises a non-immunoglobulin scaffold.
- the Fc domain comprises at least a portion of a CH2 domain and at least a portion of a CH3 domain, and when present in a multispecific polypeptide, is part of a dimeric Fc domain.
- the CH2 domain comprises an amino acid modification, compared to a wild-type CH2 domain.
- the CH2 modification increases binding (e.g. increases binding affinity) of the bispecific polypeptide to a human CD16 polypeptide relative to a wild-type human Fc region.
- the CH2 domain and/or CH3 domains are naturally occurring
- the multispecific protein comprises an Fc domain that comprises N-linked glycosylation.
- the N-linked glycosylation comprises glycan structures typical of those found on IgG-class (e.g. lgG1 ) immunoglobulins produced in mammalian cells (e.g., CHO cells or other rodent cells, non-human primate or human cells).
- the Fc domain comprises modified N-linked glycosylation, e.g. hypofucosylated glycans at N297) which increase binding affinity for a human CD16 polypeptide.
- the Fc-derived polypeptide is a dimer, optionally a homodimer or a heterodimer. In one embodiment, the Fc-derived polypeptide is a heterotrimer. In one embodiment, the Fc-derived polypeptide is a hetero-tetramer.
- heterotrimer proteins comprising two antigen binding domains that are composed of three different polypeptide chains that each comprise at least one V-(CH 1 /CK) unit, wherein a first (central) chain comprises two V-(CH 1 /CK) units separated by an Fc domain (or portion thereof which optionally binds CD1 6), and each of the second and third chains comprise one V-(CH 1 /CK) unit, wherein one of the V-(CH 1 /CK) units of the central chain preferentially undergoes CH 1 -CK dimerization with the V-(CH 1 /CK) unit of the second chain thereby forming a first antigen binding domain, wherein the other of the V-(CH 1 /CK) units of the central chain preferentially undergoes CH 1 -CK dimerization with the V-(CH 1 /CK) unit of the third chain thereby forming a second antigen binding domain, and wherein the second or third chain further comprise an Fc domain (or portion thereof) placed on the polypeptide
- heterotrimer proteins having three antigen binding domains are provided that are composed of three different polypeptide chains that each comprise at least one V-(CH 1 /CK) unit, wherein a first (central) chain comprises two V-(CH 1 /CK) units and each of the second and third chains comprise one V-(CH 1 /CK) unit, wherein one of the V- (CH 1 /CK) units of the central chain preferentially undergoes CH 1 -CK dimerization with the V- (CH 1 /CK) unit of the second chain thereby forming a first antigen binding domain, wherein the other of the V-(CH 1 /CK) units of the central chain preferentially undergoes CH 1 -CK dimerization with the V-(CH 1 /CK) unit of the third chain thereby forming a second antigen binding domain, wherein one of the polypeptide chains further comprises an antigen binding domain (e.g.
- first or second chain further comprise an Fc domain (or portion thereof) placed on the polypeptide chain such that the Fc domain is capable of forming a dimeric Fc domain that bind CD16 together with the Fc domain of the central polypeptide.
- the invention provides a heteromultimeric, e.g. heterodimeric, bispecific protein comprising: (a) a first polypeptide chain comprising a first variable region (V), fused to a CH 1 or CK domain, wherein the V-(CH 1 /CK) unit is in turn fused to a first terminus (N- or C- terminus) of a human Fc domain (a full Fc domain or a portion thereof); (b) a second polypeptide chain comprising a first variable region (V) fused to a CH 1 or CK domain that is complementary with the CH 1 or CK of the first chain to form a CH 1 -CK dimer, wherein the V-(CH 1 /CK) unit is fused to at least a human Fc domain (a full Fc domain or a portion thereof), wherein the two first variable regions form an antigen binding domain that binds a first antigen of interest in monovalent fashion, and (c) an antigen binding domain that binds a second antigen (
- a dimeric Fc domain comprising N-linked glycosylation at residue N297 (Kabat EU numbering).
- the first and second polypeptide chains are bound by non- covalent bonds and optionally further interchain disulfide bonds, e.g. formed between respective CH1 and CK domains and/or between respective hinge domains.
- a V- (CH 1/CK) unit is fused to a human Fc domain directly, or via intervening sequences, e.g. linkers, other protein domain(s), etc.
- one of the antigens is NKp46 and another of the antigens is one expressed on the surface of a cell that is to be lysed by the immune cell, e.g.
- a cancer or viral or bacterial antigen is a protein that is known to undergo intracellular internalization, notably when bound by an antibody (e.g. a full length antibody of an isotype such as human lgG1 or lgG3 that is bound by CD16).
- an antibody e.g. a full length antibody of an isotype such as human lgG1 or lgG3 that is bound by CD16.
- the multispecific polypeptide or protein is monoclonal. In one embodiment, the multispecific polypeptide or protein is purified. In one embodiment, the multispecific polypeptide or protein is isolated. In another embodiment the multispecific polypeptide or protein is expressed by a cell, e.g., a human immune cell such as a human NK cell.
- the polypeptide or protein is a heterodimer, wherein the antigen binding domain for a second antigen is an scFv, optionally an scFv that binds NKp46.
- the heteromultimeric polypeptide or protein is a heterotrimer, comprising an antigen binding domain for a second antigen which comprises or consists of an heavy or light chain variable region, and the heteromultimeric polypeptide or protein further comprises a third polypeptide chain comprising or consisting of a variable region (V) fused to a CH1 or CK domain that is complementary with the CH1 or CK of the first chain to form a CH 1-CK dimer wherein the variable region that is the antigen binding domain for a second antigen of the first polypeptide and the variable region of the third chain form an antigen binding domain.
- V variable region
- a heterodimeric polypeptide according to the invention comprises: (a) a first polypeptide chain comprising, from N- to C- terminus, a first variable domain (V), a CH1 of CK constant region, a Fc domain or portion thereof which optionally binds CD16, a second variable domain and third variable domain; and
- a second polypeptide chain comprising, from N- to C- terminus, a first variable domain (V), a CH 1 or CK constant region, an Fc domain or portion thereof, wherein the CH 1 or CK constant region is selected to be complementary to the CH 1 or CK constant region of the first polypeptide chain such that the first and second polypeptides form a CH 1 -CK heterodimer in which the first variable domain of the first polypeptide chain and the first variable domain of the second polypeptide form an antigen binding domain that binds the first antigen of interest; and wherein a second variable domain and third variable domain forms an antigen binding domain that binds the second antigen of interest, and wherein the Fc domains (or portions thereof) of the first and second chains of the heteromultimeric protein form a dimeric Fc domain capable of being bound by human CD1 6 polypeptide, e.g. a dimeric Fc domain comprising N-linked glycosylation at residue N297 (Kabat EU numbering).
- heterodimeric polypeptide which comprises:
- a second polypeptide chain comprising, from N- to C- terminus, a first variable domain (V), a CH 1 or CK constant region, and a Fc domain or portion thereof, wherein the CH 1 or CK constant region is selected to be complementary to the CH 1 or CK constant region of the first polypeptide chain such that the first and second polypeptides form a CH I - CK heterodimer in which the first variable domain of the first polypeptide chain and the first variable domain of the second polypeptide form an antigen binding domain that binds to the first antigen of interest; and wherein a second variable domain and third variable domain forms an antigen binding domain that binds to a second antigen of interest, wherein the Fc domains (or portions thereof) of the first and second chains of the heteromultimeric protein form a dimeric Fc domain capable of being bound by human CD1 6 polypeptide, e.g. a dimeric Fc domain comprising IgG-type N-linked glycosylation at residue N297 (K
- the invention provides a heterodimeric polypeptide which comprises: (a) a first polypeptide chain comprising, from N- to C- terminus, a first variable domain (V) fused to a first CH1 or CKK constant region, an Fc domain or portion thereof, and a second variable domain (V) fused to a second CH1 or CK constant region;
- a second polypeptide chain comprising, from N- to C- terminus, a variable domain fused to a CH1 or CK constant region selected to be complementary to the first (but not the second) CH1 or CK constant region of the first polypeptide chain such that the first and second polypeptides form a CH1 -CK heterodimer, and an Fc domain or portion thereof;
- a third polypeptide chain comprising, from N- to C- terminus, a variable domain fused to a CH1 or CK constant region, wherein the CH1 or CK constant region is selected to be complementary to the second (but not the first) variable domain and second CH1 or CK constant region of the first polypeptide chain, wherein the Fc domains (or portions thereof) of the first and second chains of the heteromultimeric protein form a dimeric Fc domain capable of being bound by a human CD16 polypeptide, e.g. a dimeric Fc domain comprising IgG-type N-linked glycosylation at residue N297 (Kabat EU numbering).
- the first and third polypeptides will therefore form a CH1 -CK heterodimer formed between the CH1 or CK constant region of the third polypeptide and the second CH1 or CK constant region of the first polypeptide, but not between the CH1 or CK constant region of the third polypeptide and the first CH1 or CK constant region of the first polypeptide.
- the first, second and third polypeptides form a CH1-CK heterotrimer, and wherein the first variable domain of the first polypeptide chain and the variable domain of the second polypeptide chain form an antigen binding domain specific for a first antigen of interest, and the second variable domain of the first polypeptide chain and the variable domain on the third polypeptide chain form an antigen binding domain specific for a second antigen of interest.
- heteromultimeric polypeptides or proteins may comprise one or more additional polypeptide chains.
- heteromultimeric polypeptides or proteins described herein may comprise a dimeric Fc domain capable of being bound by human CD16 polypeptide, e.g. a dimeric Fc domain comprising N-linked glycosylation at residue N297 (Kabat EU numbering).
- the CH1 and/or CK domain are fused via a hinge region to the Fc domain.
- the hinge, CH2 and/or CH3 comprises one or more amino acid modifications which increase binding affinity for human CD16.
- the hinge, CH2 and/or CH3 comprises an amino acid modification which increases binding affinity for human FcRn.
- the amino acid modifications that increase binding affinity for CD16 may also increase affinity for one or more other human Fey receptors.
- the hinge, CH2 and/or CH3 comprise an amino acid modification which reduces or substantially abolishes binding to an inhibitory human Fey receptor (e.g. CD32B) and/or to an Fey receptor other than CD16 (e.g. CD32A and/or CD64).
- the CH1 and CK domains optionally can be of human origin.
- the bispecific protein binds more strongly or avidly (has a greater binding affinity) for the antigen of interest (e.g. a cancer or viral or other infectious agent antigen) than it binds NKp46.
- the polypeptide has a Kd (monovalent binding affinity) to NKp46 of less than 10 "7 M, preferably less than 10 "8 M, or preferably less than 10 "9 M; optionally the polypeptide has a Kd for binding (monovalent binding affinity) to a cancer, viral, bacterial or other antigen that is less than (i.e.
- the polypeptide has better binding affinity than) the Kd (monovalent binding affinity) to a NKp46 polypeptide.
- the polypeptide has a Kd (monovalent binding affinity) to NKp46 of between 10 "7 M (100 nanomolar) and 10 "10 M (0.1 nanomolar) for binding to a NKp46 polypeptide.
- the polypeptide has a Kd (monovalent binding affinity) to NKp46 of between 10 "8 M (10 nanomolar) and 10 "10 M (0.1 nanomolar).
- the multimeric polypeptide has a Kd (monovalent binding affinity) to NKp46 of between 10 "8 M (10 nanomolar) and 10 "9 M (1 nanomolar). Binding can be assessed as in the Examples herein, e.g. by surface plasmon resonance.
- the antigen binding domain that binds NKp46 binds to at least one residue on NKp46 corresponding to any of the amino acid residues bound by any one of monoclonal antibodies NKp46-1 , -2, -3, -4, -6 or -9 or the Anti-CD19-Anti-NKp46-1 , -2, -3, -4, -6 or -9 bispecific antibodies.
- the antigen binding domain that binds NKp46 binds at least 1 , 2, 3, 4 or more amino acids of NKp46 within the epitope bound by any one or combination of monoclonal antibodies NKp46-1 , -2, - 3, -4, -6 or -9 or the Anti-CD19-Anti-NKp46-1 , -2, -3, -4, -6 or -9 bispecific antibodies.
- the antigen binding domain that binds NKp46 binds to the same epitope on a NKp46 polypeptide as any of monoclonal antibodies NKp46-1 , -2, -3, -4, -6 or -9 or to any of the Anti-CD19-Anti-NKp46-1 , -2, -3, -4, -6 or -9 bispecific antibodies.
- the antigen binding domain that binds NKp46 binds to an epitope on the NKp46 polypeptide of SEQ ID NO:1 wherein the epitope comprises one, two, three or more residues selected from the group of residues bound by any of antibodies NKp46-1 , -2, -3, -4, -6 or -9.
- the protein that binds NKp46 exhibits significantly lower binding for a mutant NKp46 polypeptide in which a residue bound by any of antibodies NKp46-1 , -2, -3, - 4, -6 or -9 is substituted with a different amino acid, compared to a wild-type NKp46 polypeptide of SEQ ID NO: 1 .
- the protein that binds NKp46 competes for binding to a NKp46 polypeptide with any one or any combination of monoclonal antibodies NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9, or any of the Anti-CD19-anti-NKp46-1 , -2, -3, -4, -6 or -9 bispecific antibodies.
- the protein that binds NKp46 competes for binding to an NKp46 polypeptide with an antibody selected from the group consisting of:
- the invention provides a protein (or nucleic acid encoding such) that specifically binds NKp46 (e.g. a monospecific monoclonal antibody or fragment, a multispecific protein or fragment, a bispecific antibody, etc.) that competes for binding to an NKp46 polypeptide with an antibody selected from the group consisting of:
- NKp46-6 an antibody having respectively a V H and V L region of SEQ ID NOS: 13 and 14 (NKp46-9).
- the antigen binding domain that binds NKp46 comprises the hypervariable regions of any one of monoclonal antibodies NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9 or a combination of any of the foregoing.
- the antigen binding domain that binds NKp46 has a heavy and/or light chain variable region having one, two or three CDRs of the respective heavy and/or light chain of an antibody selected from the group consisting of antibody NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 and NKp46-9.
- an isolated multispecific protein that binds NKp46 according to the invention comprises or an antigen binding domain thereof comprises heavy chain CDR1 , 2 and 3 and light chain CDR 1 , 2 and 3 of any of the antibodies selected from the group consisting of:
- the invention provides an antibody (e.g. a full length monospecific antibody or a bispecific antibody) or antigen binding domain (which optionally may be humanized, chimerized or affinity matured) that binds NKp46 and comprises:
- the invention provides a protein (a monomeric or multimeric protein) that specifically binds NKp46 (e.g. a monospecific monoclonal antibody, a multispecific protein, a bispecific antibody) that binds the same or overlapping epitope on NKp46 as an antibody selected from the group consisting of antibody NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 and NKp46-9.
- the isolated polypeptide may be, for example, a monospecific monoclonal antibody, a multispecific polypeptide or a bispecific antibody.
- the invention provides an isolated multispecific heterotrimeric protein comprising a first polypeptide chain comprising an amino acid sequence which is at least 50%, 60%, 70%, 80%, 85%, 90%, 95%,98 or 99% identical to the sequence of a first polypeptide chain of a F5, F13 or T5 protein disclosed herein; a second polypeptide chain comprising an amino acid sequence which is at least 50%, 60%, 70%, 80%, 85%, 90%, 95%, 98 or 99% identical to the sequence of a second polypeptide chain of the respective F5, F13 or T5 protein disclosed herein; and a third polypeptide chain comprising an amino acid sequence which is at least 50%, 60%, 70%, 80%, 85%, 90%, 95%, 98 or 99% identical to the sequence of a third polypeptide chain of a F5, F13 or T5 protein disclosed herein.
- the protein comprises a dimeric Fc domain capable of being bound by a human CD16 polypeptide, e.g. a dimeric Fc domain comprising N-linked glycosylation at residue N297 (Kabat EU numbering).
- a dimeric Fc domain capable of being bound by a human CD16 polypeptide, e.g. a dimeric Fc domain comprising N-linked glycosylation at residue N297 (Kabat EU numbering).
- any or all of the variable regions or CDRs of the first, second and/or third chains are substituted with different variable regions; optionally any or all of the V-CH1/CK units of the first, second and/or third chains are substituted with different V-CH1/CK units.
- variable regions, CDRs or V-CH1/CK units are excluded from the sequences that are considered for computing identity; optionally wherein the anti- NKp46 variable regions, CDRs or V-CH1/CK units are included for computing identity and the variable regions, CDRs or V-CH1/CK units for the antigen binding domain that binds the other antigen are excluded from the sequences that are considered for computing identity.
- the multispecific polypeptide is capable of directing NKp46-expressing NK cells to lyse a target cell of interest (e.g. a target cell expressing an antigen other than NKp46).
- the invention provides a recombinant nucleic acid encoding a first polypeptide chain, and/or a second polypeptide chain, and/or a third polypeptide chain and/or a fourth polypeptide.
- the invention provides a recombinant host cell comprising a nucleic acid encoding a first polypeptide chain, and/or a second polypeptide chain and/or a third polypeptide chain, optionally wherein the host cell produces a multimeric or other protein according to the invention with a yield (final productivity or concentration before or after purification) of at least 1 , 2, 3 or 4 mg/L.
- kits or set of nucleic acids comprising a recombinant nucleic acid encoding a first polypeptide chain of the according to the invention, a recombinant nucleic acid encoding a second polypeptide chain according to the invention, and, optionally, a recombinant nucleic acid encoding a third polypeptide chain according to the invention. Also provided are methods of making dimeric, trimeric and tetrameric proteins according to the invention.
- any of the methods can further be characterized as comprising any step described in the application, including notably in the "Detailed Description of the Invention").
- the invention further relates to methods of identifying, testing and/or making proteins described herein.
- the invention further relates to a multispecific protein obtainable by any of present methods.
- the disclosure further relates to pharmaceutical or diagnostic formulations containing at least one of the multispecific proteins disclosed herein.
- the disclosure further relates to methods of using the subject multispecific proteins in methods of treatment or diagnosis.
- Figure 1 shows that Anti-CD19-F1 -Anti-CD3 does not cause T/B cell aggregation in the presence of B221 (CD19) or JURKAT (CD3) cell lines when separate, but it does cause aggregation of cells when both B221 and JURKAT cells are co-incubated.
- Figures 2A to 2F show different domain arrangements of bispecific anti-NKp46 proteins produced.
- Figures 3A and 3B respectively demonstrate that bispecific F1 and F2 format proteins having NKp46 binding region based on NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 are able to direct resting NK cells to their CD19-positive Daudi tumor target cells, while isotype control antibody did not lead to the elimination of the Daudi cells.
- Rituximab (RTX) served as the positive control of ADCC, where the maximal response obtained with RTX (at 10 ⁇ g ml in this assay) was 21 .6% specific lysis.
- Figure 4A shows that bispecific antibodies having NKp46 and CD19 binding regions in an F2 format protein do not activate resting NK cells in the absence of target cells; by contrast full length anti-NKp46 antibodies as well as positive control alemtuzumab did activate NK cells.
- Figure 4B shows that bispecific anti-NKp46 x anti-CD19 antibodies (including each of the NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 binding domains) activated resting NK cells in presence of Daudi target cells, while full-length anti-CD19 showed at best only very low activation of NK cells and neither full-length anti-NKp46 antibodies nor alemtuzumab elicited a substantial increase in activation beyond what was observed in the presence of NK cells alone.
- Figure 4C shows that in the presence of CD19-negative HUT78 cells, none of the bispecific anti-NKp46 x anti-CD19 antibodies (including each of the NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 variable regions) activated NK cells.
- the full-length anti-NKp46 antibodies and alemtuzumab resulted in detectable activation of NK cells, i.e., at a similar level observed in presence of NK cells alone. Isotype control antibody did not induce activation.
- Figures 5A and 5B shows that at low effector:target ratios of 1 :1 each of the tested bispecific anti-NKp46 x anti-CD19 antibodies activated NK cells in the presence of Daudi cells, and that bispecific anti-NKp46 x anti-CD19 antibodies were far more potent (better elicited lysis of target cells) than a control anti-CD19 antibody as well as a full-length human lgG1 ADCC inducing antibody.
- Figures 6A and 6B show that each NKp46 x CD19 bispecific protein (Format F3, F5 and F6) induced specific lysis of Daudi ( Figure 6A) or B221 ( Figure 6B) cells by human KHYG-1 CD16-negative hNKp46-positive NK cell line, while rituximab and human lgG1 isotype control (IC) antibodies did not.
- Figure 6C shows that a NKp46 x KIR3DL2 bispecific protein (Format F6) induced specific lysis of HUT78 tumor cells via NKp46 binding (without CD16 binding) comparably to a conventional lgG1 antibody with the same anti-KIR3DL2 variable regions.
- Figure 7 shows a NKp46 x CD19 bispecific protein in F5 format whose Fc domain binds CD16 is far more potent in mediating Daudi target cell lysis than a full-length lgG1 anti- CD19 antibody or a F6 format bispecific protein.
- the figure also shows that a bispecific anti- CD19 in F6 format whose Fc domain does not bind CD16 was as potent in mediating NK cell lysis of Daudi target cells as the full-length lgG1 anti-CD19 antibody, which is unexpected considering that the control lgG1 anti-CD19 antibody binds CD19 bivalently.
- CD19-F5-NKp46-3 was at least 1000 times more potent than the full-length anti-CD19 lgG1 .
- Figure 8 shows the results of cytotoxicity assays using fresh NK cells (Daudi cell in the right hand panel and HUT78 cells in the left hand panel); the CD19-F6-NKp46-3 whose Fc domain does not bind CD16 due to a N297 substitution has as mode of action NKp46 triggering when NK cells encounter the target cell, while the CD19-F5-NKp46-3 bispecific protein demonstrated a far higher potency in mediating cytotoxicity toward Daudi cells. Neither the F5 nor F6 proteins mediated any NK cell cytotoxicity towards HUT78 cells.
- Figure 9 shows the results of flow cytometry staining of NK cell surface markers showed a strong upregulation of CD137 on the surface of NK cells by F5 proteins (Left-most panel: NK cells vs. Daudi; middle panel: NK cells vs. HUT78; right-most panel: NK cells alone).
- the full-length anti-CD19 lgG1 antibody that binds CD16 also showed CD137 upregulation, but to a far lesser extent than the CD19-F5-NKp46-3 protein.
- the CD19-F6- NKp46-3 which functions via NKp46 but not CD16 did not show any CD137 upregulation.
- Figure 10 shows the results of cytotoxicity assays which compared the ability of the GA101 -F5+-NKp46-1 bispecific protein to a comparison antibody (GA101 ) containing the same variable regions to lyse Daudi cells.
- GA101 comparison antibody
- the term "antigen binding domain” or “ABD” refers to a domain comprising a three-dimensional structure capable of immunospecifically binding to an epitope.
- said domain can comprise a hypervariable region, optionally a V H and/or V L domain of an antibody chain, optionally at least a V H domain.
- the binding domain may comprise at least one complementarity determining region (CDR) of an antibody chain.
- the binding domain may comprise a polypeptide domain from a non-immunoglobulin scaffold.
- antibody herein is used in the broadest sense and specifically includes full-length monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments and derivatives, so long as they exhibit the desired biological activity.
- Various techniques relevant to the production of antibodies are provided in, e.g., Harlow, et al., ANTIBODIES: A LABORATORY MANUAL, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1988).
- An “antibody fragment” comprises a portion of a full-length antibody, e.g. antigen-binding or variable regions thereof.
- antibody fragments include Fab, Fab', F(ab) 2 , F(ab') 2 , F(ab) 3 , Fv (typically the V L and V H domains of a single arm of an antibody), single-chain Fv (scFv), dsFv, Fd fragments (typically the V H and CH1 domain), and dAb (typically a V H domain) fragments; V H , V L , VhH, and V-NAR domains; minibodies, diabodies, triabodies, tetrabodies, and kappa bodies (see, e.g., Ill et al., Protein Eng 1997;10: 949-57); camel IgG; IgNAR; and multispecific antibody fragments formed from antibody fragments, and one or more isolated CDRs or a functional paratope, where isolated CDRs or antigen-binding residues or polypeptides can be associated or linked together so as to form a functional antibody fragment.
- antibody derivative comprises a full-length antibody or a fragment of an antibody, e.g. comprising at least antigen-binding or variable regions thereof, wherein one or more of the amino acids are chemically modified, e.g., by alkylation, PEGylation, acylation, ester formation or amide formation or the like. This includes, but is not limited to, PEGylated antibodies, cysteine-PEGylated antibodies, and variants thereof.
- hypervariable region when used herein refers to the amino acid residues of an antibody that are responsible for antigen binding.
- the hypervariable region generally comprises amino acid residues from a "complementarity-determining region” or "CDR" (e.g. residues 24-34 (L1 ), 50-56 (L2) and 89-97 (L3) in the light-chain variable domain and 31 -35 (H1 ), 50-65 (H2) and 95-102 (H3) in the heavy-chain variable domain; Kabat et al. 1991 ) and/or those residues from a "hypervariable loop" (e.g.
- a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of CDR H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82.
- the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
- frame or "FR” residues as used herein is meant the region of an antibody variable domain exclusive of those regions defined as CDRs.
- Each antibody variable domain framework can be further subdivided into the contiguous regions separated by the CDRs (FR1 , FR2, FR3 and FR4).
- constant region as defined herein is meant an antibody-derived constant region that is encoded by one of the light or heavy chain immunoglobulin constant region genes.
- constant light chain or “light chain constant region” as used herein is meant the region of an antibody encoded by the kappa (CK) or lambda (CA) light chains.
- the constant light chain typically comprises a single domain, and as defined herein refers to positions 108-214 of CK, or CA, wherein numbering is according to the EU index (Kabat et al., 1991 , Sequences of Proteins of Immunological Interest, 5th Ed., United States Public Health Service, National Institutes of Health, Bethesda).
- constant heavy chain or “heavy chain constant region” as used herein is meant the region of an antibody encoded by the mu, delta, gamma, alpha, or epsilon genes to define the antibody's isotype as IgM, IgD, IgG, IgA, or IgE, respectively.
- the constant heavy chain as defined herein, refers to the N-terminus of the CH 1 domain to the C-terminus of the CH3 domain, thus comprising positions 1 18-447, wherein numbering is according to the EU index.
- Fab or "Fab region” as used herein is meant the polypeptide that comprises the V H , CH 1 , V L , and C L immunoglobulin domains. Fab may refer to this region in isolation, or this region in the context of a polypeptide, multispecific polypeptide or ABD, or any other embodiments as outlined herein.
- single-chain Fv or “scFv” as used herein are meant antibody fragments comprising the V H and V L domains of an antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains which enables the scFv to form the desired structure for antigen binding.
- Methods for producing scFvs are well known in the art. For a review of methods for producing scFvs see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 1 13, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315 (1994).
- Fv or “Fv fragment” or “Fv region” as used herein is meant a polypeptide that comprises the V L and V H domains of a single antibody.
- Fc or “Fc region”, as used herein is meant the polypeptide comprising the constant region of an antibody excluding the first constant region immunoglobulin domain.
- Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM, and the flexible hinge N-terminal to these domains.
- IgA and IgM Fc may include the J chain.
- Fc comprises immunoglobulin domains Cv2 (CH2) and Cy3 (CH3) and the hinge between Cy1 and Cv2.
- Fc region may vary, the human IgG heavy chain Fc region is usually defined to comprise residues C226, P230 or A231 to its carboxyl-terminus, wherein the numbering is according to the EU index.
- Fc may refer to this region in isolation, or this region in the context of an Fc polypeptide, as described below.
- Fc polypeptide or "Fc-derived polypeptide” as used herein is meant a polypeptide that comprises all or part of an Fc region.
- Fc polypeptides herein include but are not limited to antibodies, Fc fusions and Fc fragments.
- Fc regions according to the invention include variants containing at least one modification that alters (enhances or diminishes) an Fc associated effector function.
- Fc regions according to the invention include chimeric Fc regions comprising different portions or domains of different Fc regions, e.g., derived from antibodies of different isotype or species.
- variable region as used herein is meant the region of an antibody that comprises one or more Ig domains substantially encoded by any of the V L (including VK (VK) and VA) and/or V H genes that make up the light chain (including ⁇ and ⁇ ) and heavy chain immunoglobulin genetic loci respectively.
- a light or heavy chain variable region (V L or V H ) consists of a "framework" or "FR” region interrupted by three hypervariable regions referred to as “complementarity determining regions” or "CDRs".
- CDRs complementarity determining regions
- the extent of the framework region and CDRs have been precisely defined, for example as in Kabat (see “Sequences of Proteins of Immunological Interest,” E. Kabat et al., U.S. Department of Health and Human Services, (1983)), and as in Chothia.
- the framework regions of an antibody that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs, which are primarily responsible for binding to an
- the term "specifically binds to” means that an antibody or polypeptide can bind preferably in a competitive binding assay to the binding partner, e.g. NKp46, as assessed using either recombinant forms of the proteins, epitopes therein, or native proteins present on the surface of isolated target cells.
- Competitive binding assays and other methods for determining specific binding are further described below and are well known in the art.
- NKp46-1 , -2, -4, -6 or -9 in the context of an anti-NKp46 mono- or bi-specific antibody
- the antibody or polypeptide competes with the monoclonal antibody in a binding assay using either recombinant target (e.g. NKp46) molecules or surface expressed target (e.g. NKp46) molecules.
- a test antibody reduces the binding of NKp46- 1 , -2, -4, -6 or -9 to a NKp46 polypeptide or NKp46-expressing cell in a binding assay, the antibody is said to "compete” respectively with NKp46-1 , -2, -4, -6 or -9.
- affinity means the strength of the binding of an antibody or polypeptide to an epitope.
- the affinity of an antibody is given by the dissociation constant K D , defined as [Ab] x [Ag] / [Ab-Ag], where [Ab-Ag] is the molar concentration of the antibody-antigen complex, [Ab] is the molar concentration of the unbound antibody and [Ag] is the molar concentration of the unbound antigen.
- K D dissociation constant
- a “determinant” designates a site of interaction or binding on a polypeptide.
- epitope refers to an antigenic determinant, and is the area or region on an antigen to which an antibody or polypeptide binds.
- a protein epitope may comprise amino acid residues directly involved in the binding as well as amino acid residues which are effectively blocked by the specific antigen binding antibody or peptide, i.e. , amino acid residues within the "footprint” of the antibody. It is the simplest form or smallest structural area on a complex antigen molecule that can combine with e.g., an antibody or a receptor.
- Epitopes can be linear or conformational/structural.
- linear epitope is defined as an epitope composed of amino acid residues that are contiguous on the linear sequence of amino acids (primary structure).
- conformational or structural epitope is defined as an epitope composed of amino acid residues that are not all contiguous and thus represent separated parts of the linear sequence of amino acids that are brought into proximity to one another by folding of the molecule (secondary, tertiary and/or quaternary structures).
- a conformational epitope is dependent on the 3-dimensional structure.
- 'conformational' is therefore often used interchangeably with 'structural'.
- Epitopes may be identified by different methods known in the art including but not limited to alanine scanning, phage display, X-ray crystallography, array-based oligo-peptide scanning or pepscan analysis, site-directed mutagenesis, high throughput mutagenesis mapping, H/D-Ex Mass Spectroscopy, homology modeling, docking, hydrogen-deuterium exchange, among others.
- amino acid modification herein is meant an amino acid substitution, insertion, and/or deletion in a polypeptide sequence.
- An example of amino acid modification herein is a substitution.
- amino acid modification herein is meant an amino acid substitution, insertion, and/or deletion in a polypeptide sequence.
- amino acid substitution or “substitution” herein is meant the replacement of an amino acid at a given position in a protein sequence with another amino acid.
- substitution Y50W refers to a variant of a parent polypeptide, in which the tyrosine at position 50 is replaced with tryptophan.
- a “variant" of a polypeptide refers to a polypeptide having an amino acid sequence that is substantially identical to a reference polypeptide, typically a native or “parent” polypeptide.
- the polypeptide variant may possess one or more amino acid substitutions, deletions, and/or insertions at certain positions within the native amino acid sequence.
- Constant amino acid substitutions are those in which an amino acid residue is replaced with an amino acid residue having a side chain with similar physicochemical properties. Families of amino acid residues having similar side chains are known in the art, and include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta- branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine
- identity refers to the degree of sequence relatedness between polypeptides, as determined by the number of matches between strings of two or more amino acid residues. "Identity” measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e., "algorithms”). Identity of related polypeptides can be readily calculated by known methods. Such methods include, but are not limited to, those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D.
- Preferred methods for determining identity are designed to give the largest match between the sequences tested. Methods of determining identity are described in publicly available computer programs. Preferred computer program methods for determining identity between two sequences include the GCG program package, including GAP (Devereux et al., Nucl. Acid. Res. 12, 387 (1984); Genetics Computer Group, University of Wisconsin, Madison, Wis.), BLASTP, BLASTN, and FASTA (Altschul et al., J. Mol. Biol. 215, 403-410 (1990)). The BLASTX program is publicly available from the National Center for Biotechnology Information (NCBI) and other sources (BLAST Manual, Altschul et al. NCB/NLM/NIH Bethesda, Md. 20894; Altschul et al., supra). The well-known Smith Waterman algorithm may also be used to determine identity.
- NCBI National Center for Biotechnology Information
- an "isolated" molecule is a molecule that is the predominant species in the composition wherein it is found with respect to the class of molecules to which it belongs (i.e., it makes up at least about 50% of the type of molecule in the composition and typically will make up at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or more of the species of molecule, e.g., peptide, in the composition).
- a composition of a polypeptide will exhibit 98%, 98%, or 99% homogeneity for polypeptides in the context of all present peptide species in the composition or at least with respect to substantially active peptide species in the context of proposed use.
- treatment refers to preventing, alleviating, managing, curing or reducing one or more symptoms or clinically relevant manifestations of a disease or disorder, unless contradicted by context.
- treatment of a patient in whom no symptoms or clinically relevant manifestations of a disease or disorder have been identified is preventive or prophylactic therapy, whereas "treatment” of a patient in whom symptoms or clinically relevant manifestations of a disease or disorder have been identified generally does not constitute preventive or prophylactic therapy.
- NK cells refers to a sub-population of lymphocytes that is involved in non-conventional immunity.
- NK cells can be identified by virtue of certain characteristics and biological properties, such as the expression of specific surface antigens including CD56 and/or NKp46 for human NK cells, the absence of the alpha/beta or gamma/delta TCR complex on the cell surface, the ability to bind to and kill cells that fail to express "self" MHC/HLA antigens by the activation of specific cytolytic machinery, the ability to kill tumor cells or other diseased cells that express a ligand for NK activating receptors, and the ability to release protein molecules called cytokines that stimulate or inhibit the immune response.
- NK cells any of these characteristics and activities can be used to identify NK cells, using methods well known in the art. Any subpopulation of NK cells will also be encompassed by the term NK cells.
- active NK cells designate biologically active NK cells, including NK cells having the capacity of lysing target cells or enhancing the immune function of other cells.
- NK cells can be obtained by various techniques known in the art, such as isolation from blood samples, cytapheresis, tissue or cell collections, etc. Useful protocols for assays involving NK cells can be found in Natural Killer Cells Protocols (edited by Campbell KS and Colonna M). Humana Press, pp. 219-238 (2000).
- intracellular internalization refers to the molecular, biochemical and cellular events associated with the process of translocating a molecule from the extracellular surface of a cell to the intracellular surface of a cell.
- the processes responsible for intracellular internalization of molecules are well-known and can involve, inter alia, the internalization of extracellular molecules (such as hormones, antibodies, and small organic molecules); membrane-associated molecules (such as cell- surface receptors); and complexes of membrane-associated molecules bound to extracellular molecules (for example, a ligand bound to a transmembrane receptor or an antibody bound to a membrane-associated molecule).
- extracellular molecules such as hormones, antibodies, and small organic molecules
- membrane-associated molecules such as cell- surface receptors
- complexes of membrane-associated molecules bound to extracellular molecules for example, a ligand bound to a transmembrane receptor or an antibody bound to a membrane-associated molecule.
- inducing and/or increasing internalization refer to events wherein intracellular internalization is initiated and/or the rate and
- NKp46 signaling refers to an ability of an NKp46 polypeptide to activate or transduce an intracellular signaling pathway. Changes in NKp46 signaling activity can be measured, for example, by assays designed to measure changes in NKp46 signaling pathways, e.g.
- reporter genes can be naturally occurring genes (e.g. monitoring cytokine production) or they can be genes artificially introduced into a cell. Other genes can be placed under the control of such regulatory elements and thus serve to report the level of NKp46 signaling.
- NKp46 refers to a protein or polypeptide encoded by the Ncr1 gene or by a cDNA prepared from such a gene. Any naturally occurring isoform, allele, ortholog or variant is encompassed by the term NKp46 polypeptide (e.g., an NKp46 polypeptide 90%, 95%, 98% or 99% identical to SEQ ID NO 1 , or a contiguous sequence of at least 20, 30, 50, 100 or 200 amino acid residues thereof).
- the 304 amino acid residue sequence of human NKp46 (isoform a) is shown below:
- SEQ ID NO: 1 corresponds to NCBI accession number NP_004820, the disclosure of which is incorporated herein by reference.
- the human NKp46 mRNA sequence is described in NCBI accession number NM_004829, the disclosure of which is incorporated herein by reference.
- antigen binding domains used in the proteins described herein can be readily derived from any of a variety of immunoglobulin or non-immunoglobulin scaffolds, for example affibodies based on the Z-domain of staphylococcal protein A, engineered Kunitz domains, monobodies or adnectins based on the 10th extracellular domain of human fibronectin III, anticalins derived from lipocalins, DARPins (designed ankyrin repeat domains, multimerized LDLR-A module, avimers or cysteine-rich knottin peptides. See, e.g., Gebauer and Skerra (2009) Current Opinion in Chemical Biology 13:245-255, the disclosure of which is incorporated herein by reference.
- Variable domains are commonly derived from antibodies (immunoglobulin chains), for example in the form of associated V L and V H domains found on two polypeptide chains, or a single chain antigen binding domain such as a scFv, a V H domain, a V L domain, a dAb, a V-NAR domain or a V H H domain.
- an antigen binding domain e.g,. ABD-i and ABD 2
- the an antigen binding domain can also be readily derived from antibodies as a Fab or scFv.
- antibodies are initially obtained by immunization of a non-human animal, e.g., a mouse, rat, guinea pig or rabbit, with an immunogen comprising a polypeptide, or a fragment or derivative thereof, typically an immunogenic fragment, for which it is desired to obtain antibodies (e.g. a human polypeptide).
- an immunogen comprising a polypeptide, or a fragment or derivative thereof, typically an immunogenic fragment, for which it is desired to obtain antibodies (e.g. a human polypeptide).
- the step of immunizing a non-human mammal with an antigen may be carried out in any manner well known in the art for stimulating the production of antibodies in a mouse (see, for example, E. Harlow and D. Lane, Antibodies: A Laboratory Manual., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1988), the entire disclosure of which is herein incorporated by reference).
- Human antibodies may also be produced by using, for immunization, transgenic animals that have been engineered to express a human antibody repertoire (Jakobovitz et Nature 362 (1993) 255), or by selection of antibody repertoires using phage display methods.
- a XenoMouse (Abgenix, Fremont, CA) can be used for immunization.
- a XenoMouse is a murine host that has had its immunoglobulin genes replaced by functional human immunoglobulin genes.
- antibodies produced by this mouse or in hybridomas made from the B cells of this mouse are already humanized.
- the XenoMouse is described in United States Patent No. 6,162,963, which is herein incorporated in its entirety by reference.
- Antibodies may also be produced by selection of combinatorial libraries of immunoglobulins, as disclosed for instance in (Ward et al. Nature, 341 (1989) p. 544, the entire disclosure of which is herein incorporated by reference).
- Phage display technology McCafferty et al (1990) Nature 348:552-553
- V variable domain gene repertoires from unimmunized donors. See, e.g., Griffith et al (1993) EMBO J. 12:725- 734; US 5,565,332; US 5,573,905; US 5,567,610; and US 5,229,275).
- combinatorial libraries comprise variable (V) domain gene repertoires of human origin, selection from combinatorial libraries will yield human antibodies.
- Antibodies will typically be directed to a pre-determined antigen.
- examples of antibodies include antibodies that recognize an antigen expressed by a target cell that is to be eliminated, for example a proliferating cell or a cell contributing to a disease pathology.
- examples include antibodies that recognize tumor antigens, microbial (e.g. bacterial or parasite) antigens or viral antigens.
- Antigen binding domains that bind NKp46 can be derived from the anti-NKp46 antibodies provided herein (see section "CDR Sequences"). Variable regions can be used directly, or can be modified by selecting hypervariable or CDR regions from the NKp46 antibodies and placing them into an appropriate V L or V H framework, for example human frameworks. Antigen binding domains that bind NKp46 can also be derived de novo using methods for generating antibodies. Antibodies can be tested for binding to NKp46 polypeptides. In one aspect of any embodiment herein, a polypeptide (e.g. multispecific polypeptide, bispecific or monospecific antibody) that binds to NKp46 will be capable of binding NKp46 expressed on the surface of a cell, e.g. native NKp46 expressed by a NK cell.
- a polypeptide e.g. multispecific polypeptide, bispecific or monospecific antibody
- Antigen binding domains that bind antigens of interest can be selected based on the desired antigen of interest (e.g. an antigen other than NKp46), and may include for example cancer antigens such as antigens present on tumor cells and/or on immune cells capable of mediating a pro-tumoral effect, e.g. a monocyte or a macrophage, optionally a suppressor T cell, regulatory T cell, or myeloid-derived suppressor cell (for the treatment of cancer); bacterial or viral antigens (for the treatment of infectious disease); or antigens present on pro-inflammatory immune cells, e.g. T cells, neutrophils, macrophages, etc. (for the treatment of inflammatory and/or autoimmune disorder).
- cancer antigens such as antigens present on tumor cells and/or on immune cells capable of mediating a pro-tumoral effect, e.g. a monocyte or a macrophage, optionally a suppressor T cell, regulatory T cell, or myeloid-derived suppressor cell
- bacterial antigen includes, but is not limited to, intact, attenuated or killed bacteria, any structural or functional bacterial protein or carbohydrate, or any peptide portion of a bacterial protein of sufficient length (typically about 8 amino acids or longer) to be antigenic. Examples include gram-positive bacterial antigens and gram-negative bacterial antigens.
- the bacterial antigen is derived from a bacterium selected from the group consisting of Helicobacter species, in particular Helicobacter pyloris; Borrelia species, in particular Borrelia burgdorferi; Legionella species, in particular Legionella pneumophilia; Mycobacteria s species, in particular M. tuberculosis, M.
- avium M. intracellular, M. kansasii, M. gordonae; Staphylococcus species, in particular Staphylococcus aureus; Neisseria species, in particular N. gonorrhoeae, N. meningitidis; Listeria species, in particular Listeria monocytogenes; Streptococcus species, in particular S. pyogenes, S. agalactiae; S. faecalis; S. bovis, S.
- pneumoniae anaerobic Streptococcus species; pathogenic Campylobacter species; Enterococcus species; Haemophilus species, in particular Haemophilus influenzae; Bacillus species, in particular Bacillus anthracis; Corynebacterium species, in particular Corynebacterium diphtheriae; Erysipelothrix species, in particular Erysipelothrix rhusiopathiae; Clostridium species, in particular C. perfringens, C.
- Enterobacter species in particular Enterobacter aerogenes, Klebsiella species, in particular Klebsiella 1S pneumoniae, Pasteurella species, in particular Pasteurella multocida, Bacteroides species; Fusobacterium species, in particular Fusobacterium nucleatum; Streptobacillus species, in particular Streptobacillus moniliformis; Treponema species, in particular Treponema per pneumonia; Leptospira; pathogenic Escherichia species; and Actinomyces species, in particular Actinomyces israeli.
- viral antigen includes, but is not limited to, intact, attenuated or killed whole virus, any structural or functional viral protein, or any peptide portion of a viral protein of sufficient length (typically about 8 amino acids or longer) to be antigenic.
- Retroviridae e.g., human immunodeficiency viruses, such as HIV-1 (also referred to as HTLV-III, LAV or HTLV-III/LAV, or HIV-III; and other isolates, such as HIV-LP; Picornaviridae (e.g., polio viruses, hepatitis A virus; enteroviruses, human Coxsackie viruses, rhinoviruses, echoviruses); Calciviridae (e.g., strains that cause gastroenteritis); Togaviridae (e.g., equine encephalitis viruses, rubella viruses); Flaviviridae (e.g., dengue viruses, encephalitis viruses, yellow fever viruses); Coronaviridae (e.g., coronaviruses); Rhabdoviridae (e.g., vesicular stomatitis viruses, rabies viruses); Fil
- cancer antigen and “tumor antigen” are used interchangeably and refer to antigens (other than NKp46 or CD16) that are differentially expressed by cancer cells or are expressed by non-tumoral cells (e.g. immune cells) having a pro-tumoral effect (e.g. an immunosuppressive effect), and can thereby be exploited in order to target cancer cells.
- cancer antigens are antigens which can potentially stimulate apparently tumor-specific immune responses. Some of these antigens are encoded, although not necessarily expressed, or expressed at lower levels or less frequently, by normal cells.
- cancer antigens can be characterized as those which are normally silent (i.e., not expressed) in normal cells, those that are expressed only at certain stages of differentiation and those that are temporally expressed such as embryonic and fetal antigens.
- Other cancer antigens are encoded by mutant cellular genes, such as oncogenes (e.g., activated ras oncogene), suppressor genes (e.g., mutant p53), fusion proteins resulting from internal deletions or chromosomal translocations.
- Still other cancer antigens can be encoded by viral genes such as those carried on RNA and DNA tumor viruses.
- Still other cancer antigens can be expressed on immune cells capable of contributing to or mediating a pro-tumoral effect, e.g. cell that contributes to immune evasion, a monocyte or a macrophage, optionally a suppressor T cell, regulatory T cell, or myeloid-derived suppressor cell.
- the cancer antigens are usually normal cell surface antigens which are either over- expressed or expressed at abnormal times, or are expressed by a targeted population of cells.
- the target antigen is expressed only on proliferative cells (e.g., tumor cells) or pro-tumoral cells (e.g. immune cells having an immunosuppressive effect), however this is rarely observed in practice.
- proliferative cells e.g., tumor cells
- pro-tumoral cells e.g. immune cells having an immunosuppressive effect
- Example of cancer antigens include: Receptor Tyrosine Kinase-like Orphan Receptor 1 (ROR1 ), Crypto, CD4, CD20, CD30, CD19, CD38, CD47, Glycoprotein NMB, CanAg, Her2 (ErbB2/Neu), a Siglec family member, for example CD22 (Siglec2) or CD33 (Siglec3), CD79, CD138, CD171 , PSCA, L1 -CAM, PSMA (prostate specific membrane antigen), BCMA, CD52, CD56, CD80, CD70, E-selectin, EphB2, Melanotransferrin, Mud 6 and TMEFF2.
- cancer antigens also include Immunoglobulin superfamily (IgSF) such as cytokine receptors, Killer-lg Like Receptor, CD28 family proteins, for example, Killer-lg Like Receptor 3DL2 (KIR3DL2), B7-H3, B7-H4, B7-H6, PD-L1 , IL-6 receptor.
- IgSF Immunoglobulin superfamily
- Examples also include MAGE, MART-1/Melan-A, gp100, major histocompatibility complex class l-related chain A and B polypeptides (MICA and MICB), adenosine deaminase-binding protein (ADAbp), cyclophilin b, colorectal associated antigen (CRC)-C017-1A/GA733, protein tyrosine kinase 7(PTK7), receptor protein tyrosine kinase 3 (TYRO-3), nectins (e.g.
- nectin- 4 major histocompatibility complex class l-related chain A and B polypeptides (MICA and MICB), proteins of the UL16-binding protein (ULBP) family, proteins of the retinoic acid early transcript-1 (RAET1 ) family, carcinoembryonic antigen (CEA) and its immunogenic epitopes CAP-1 and CAP-2, etv6, aml1 , prostate specific antigen (PSA), T-cell receptor/CD3-zeta chain, MAGE-family of tumor antigens, GAGE-family of tumor antigens, anti-MQIIerian hormone Type II receptor, delta-like ligand 4 (DLL4), DR5, ROR1 (also known as Receptor Tyrosine Kinase-Like Orphan Receptor 1 or NTRKR1 (EC 2.7.10.1 ), BAGE, RAGE, LAGE-1 , NAG, GnT-V, MUM-1 , CDK4, MUC family, VEGF, VEGF
- the antigen of interest is an antigen (e.g. any one of the antigens listed above) capable of undergoing intracellular internalization, for example when bound by a conventional human lgG1 antibody, either in the presence of absence of Fey receptor cells.
- an antigen e.g. any one of the antigens listed above
- the antigen of interest is a CD19 or CD20 polypeptide; in one aspect, the multispecific protein comprises a V H and/or V L , or a scFv or another ABD that binds CD19 or CD20 comprising an amino acid sequence which is at least 60%, 70%, 80%, 85%, 90% or 95% identical to the sequence of the anti-CD19 or anti- CD20 respective VH, V
- the multispecific protein competes for binding to a human CD19 or CD20 polypeptide with an antibody, or a F5 or T6 protein, comprising the respective anti-CD19 or anti-CD20 V H , V L or scFv disclosed in the Examples.
- the ABD that binds an antigen of interest is derived from (e.g. comprises the hypervariable region of, or comprises one, two, three, four, five or six of the CDRs of) a parental antibody that binds an antigen of interest (e.g. a murine antibody, a human antibody) which, when bound to its antigenic target (the antigen of interest on cells), increases or induces down-modulation or intracellular internalization of the antigen of interest.
- the antigen of interest is a cancer antigen, e.g. one of the cancer antigens listed above known to internalize (e.g.
- Immunoglobulin superfamily (IgSF) members for example cytokine receptor a or ⁇ chains, Killer-lg Like Receptors, CD28 family proteins, B7-H3, B7-H4, B7-H6, KIR3DL2, PTK7, ROR1 , L1 -CAM, Siglec family members, EGF receptor and EGF-like receptor family members, EGFR, HER-2, integrins, anti- MGIIerian hormone Type II receptor, CSF-1 R, and others)
- the antigen target is a polypeptide present on an immune cell capable of mediating a pro-tumoral effect, e.g. a monocyte or a macrophage, optionally a suppressor T cell, regulatory T cell, or myeloid-derived suppressor cell.
- the ABD binds to a cancer antigen, a viral antigen, a microbial antigen, or an antigen present on an infected cell (e.g. virally infected) or on a pro- inflammatory immune cell.
- said antigen is a polypeptide selectively expressed or overexpressed on a tumor cell, and infected cell or a pro-inflammatory cell.
- said antigen is a polypeptide that when inhibited, decreases the proliferation and/or survival of a tumor cell, an infected cell or a pro-inflammatory cell.
- the ABDs which are incorporated into the polypeptides can be tested for any desired activity prior to inclusion in a multispecific NKp46-binding protein, for example the ABD can be tested for binding to an antigen of interest.
- An ABD derived from an antibody will generally comprise at minimum a hypervariable region sufficient to confer binding activity. It will be appreciated that an ABD may comprise other amino acids or functional domains as may be desired, including but not limited to linker elements (e.g. linker peptides, CH1 , CK or CA domains, hinges, or fragments thereof). In one example an ABD comprises a scFv, a V H domain and a V L domain, or a single domain antibody (nanobody or dAb) such as a V-NAR domain or a V H H domain. Exemplary antibody formats are further described herein and an ABD can be selected based on the desired format.
- linker elements e.g. linker peptides, CH1 , CK or CA domains, hinges, or fragments thereof.
- an ABD comprises a scFv, a V H domain and a V L domain, or a single domain antibody (nanobody or dAb) such as a V-N
- an antigen binding domain can be obtained from a humanized antibody in which residues from a complementary-determining region (CDR) of a human antibody are replaced by residues from a CDR of the original antibody (the parent or donor antibody, e.g. a murine or rat antibody) while maintaining the desired specificity, affinity, and capacity of the original antibody.
- CDRs of the parent antibody some or all of which are encoded by nucleic acids originating in a non-human organism, are grafted in whole or in part into the beta-sheet framework of a human antibody variable region to create an antibody, the specificity of which is determined by the engrafted CDRs.
- An antigen binding domain can thus have non-human hypervariable regions or CDRs and human frameworks region sequences (optionally with back mutations).
- DNA encoding each of the or ABD can be separately placed, in suitable arrangements, in an appropriate expression vector, together with DNA encoding any elements such as CH1 , CK, CH2 and CH3 domains or portions thereof and any other optional elements (e.g. DNA encoding a hinge-derived or linker elements) for transfection into an appropriate host.
- ABDs will be arranged in an expression vector, or in separate vectors as a function of which type of polypeptide is to be produced, so as to produce the Fc-polypeptides having the desired domains operably linked to one another. The host is then used for the recombinant production of the multispecific polypeptide.
- a polypeptide fusion product can be produced from a vector in which the first of the two ABD is operably linked (e.g. directly, or via a CH1 , CK or CA constant region and/or hinge region) to the N-terminus of a CH2 domain, and the CH2 domain is operably linked at its C-terminus to the N-terminus a CH3 domain.
- the second of the two ABD can be on a second polypeptide chain that forms a dimer, e.g. heterodimer, with the polypeptide comprising the first ABD.
- the polypeptide may comprise a full length and/or dimeric Fc domain.
- the multispecific polypeptide can then be produced in an appropriate host cell or by any suitable synthetic process.
- a host cell chosen for expression of the multispecific polypeptide is an important contributor to the final composition, including, without limitation, the variation in composition of the oligosaccharide moieties decorating the protein in the immunoglobulin CH2 domain.
- one aspect of the invention involves the selection of appropriate host cells for use and/or development of a production cell expressing the desired therapeutic protein such that the multispecific polypeptide retains FcRn and CD16 binding.
- the host cell may be of mammalian origin or may be selected from COS-1 , COS-7, HEK293, BHK21 , CHO, BSC-1 , Hep G2, 653, SP2/0, 293, HeLa, myeloma, lymphoma, yeast, insect or plant cells, or any derivative, immortalized or transformed cell thereof.
- the host cell may be any suitable species or organism capable of producing N-linked glycosylated polypeptides, e.g. a mammalian host cell capable of producing human or rodent IgG type N-linked glycosylation.
- Multimeric bispecific proteins such as heterodimers, heterotrimers and tetramers (the latter including for example bispecific antibodies with two heavy chains and two light chains) can be produced according to a variety of formats.
- the multimeric polypeptide will generally comprise a dimeric Fc domain that is capable of binding to human CD16 or CD16A and optionally other Fey receptors, e.g., CD16B, CD32A, CD32B and/or CD64).
- Fc moieties with substantial FcRn and CD16 (CD16A) binding can be obtained through the use of suitable CH2 and/or CH3 domains, as further described herein.
- an Fc moiety is derived from a human lgG1 isotype constant region.
- an Fc moiety may be obtained by production of the polypeptide in a host cell or by a process that yields N297- linked glycosylation, e.g. a mammalian cell.
- an Fc moiety comprises one or more amino acid modifications, e.g. in the CH2 domain, that increases binding to CD16 or CD16A.
- the protein comprises a first and a second polypeptide chain each comprising a variable domain fused to a human Fc domain (comprising a CH3 domain capable of undergoing preferential CH3-CH3 hetero-dimerization), wherein the first and second chain associate via CH3-CH3 dimerization and the protein comprises a dimeric Fc domain.
- the variable domains of each chain can be part of the same or different antigen binding domains.
- One advantageous way of making multimeric polypeptides is through the assembly of different polypeptide chains that each comprise at least one heavy or light chain variable domain fused to a human CH 1 or CK constant domain (a V-(CH 1 /CK) unit), wherein the protein chains undergo CH 1 -CK dimerization and are bound to one another by non-covalent bonds and optionally further disulfide bonds formed between respective CH 1 and CK domains.
- a human CH 1 or CK constant domain a V-(CH 1 /CK) unit
- the invention provides an isolated or purified heterodimeric or heterotrimeric protein that binds to a first and second antigen, wherein the protein comprises at least two or three polypeptide chains, each comprising a V-(CH 1 /CK) unit, whereby the chains are bound to one another by non-covalent bonds and optionally further bound via disulfide bonds between CH 1 and CK domains, and still further optionally, whereby the chains are bound by non-covalent bonds between the respective variable regions, CH 1 and CK domains, and CH3 domains of the Fc portion.
- the protein comprises a first and a second polypeptide chain each comprising a variable domain fused to a CH 1 or CK domain (a V-(CH 1 /CK) unit), in turn fused at its C-terminus to a human Fc domain (comprising a CH3 domain capable of undergoing CH3-CH3 dimerization), wherein the first and second chain associate via CH 1 - CK and CH3-CH3 dimerization and the protein comprises a dimeric Fc domain.
- the variable domains of each chain can be part of the same or different antigen binding domains.
- variable and constant regions can be selected and configured such that each chain will preferentially associate with its desired complementary partner chain.
- the resulting multimeric protein will therefore be simple to produce using conventional production methods using recombinant host cells.
- the choice of which V H or V L to associate with a CH 1 and CK in a unit is based on affinity between the units to be paired so as to drive the formation of the desired multimer.
- the resulting multimer will be bound by non-covalent bonds between complementary V H and V L domains, by non-covalent bonds between complementary CH 1 and CK domains, and optionally by further disulfide bonding between complementary CH 1 and CK domains (and optionally further disulfide bonds between complementary hinge domains).
- V H -V L associations are stronger than V H -V H or V L -V L , consequently, as shown herein, one can place a V H or a V L next to either a CH 1 or a CK, and the resulting V-C unit will partner preferably with its V-C counterpart.
- V H -CK will pair with V L -CH 1 preferentially over V H -CH 1 .
- preferred chain pairing is further improved, as the two Fc-containing chains are bound by non-covalent bonds between CH3 domains of the Fc domains.
- the different V-C combinations, optionally further combined with Fc pairing thereby provides tools to make heteromultimeric proteins.
- the multispecific protein comprises a first and a second polypeptide chain each comprising a variable domain fused to a CH1 or CK domain (a V-(CH1/CK) unit), in turn fused at its C-terminus to a human Fc domain, wherein the V-(CH1/CK) unit of the first chain has undergone CH 1-CK dimerization with the V-(CH 1/CK) unit of the second chain thereby forming a first antigen binding domain (ABD-i) and a dimeric Fc domain, wherein one of the polypeptide chains further comprises an antigen binding domain that forms a second antigen binding domain (ABD 2 ), and wherein the Fc domain binds to a human CD16 polypeptide.
- the Fc domain comprises N-linked glycosylation at residue N297 (Kabat EU numbering).
- the protein has a domain arrangement:
- the protein comprises three polypeptide chains, each comprising a variable domain fused to a CH1 or CK domain (a V-(CH1/CK) unit), wherein a first (central) chain comprises two V-(CH 1/CK) units and a human Fc domain interposed between the units, the second chain comprises one V-(CH 1/CK) unit and a human Fc domain, and the third chain comprises one V-(CH1/CK) unit, wherein one of the V-(CH1/CK) units of the central chain has undergone CH1-CK dimerization with the V-(CH 1/CK) unit of the second chain thereby forming a first antigen binding domain (ABD-i) and a dimeric Fc domain, and wherein the other of the V-(CH1/CK) units of the central chain has undergone CH1 -CK dimerization with the V-(CH1/CK) unit of the third chain thereby forming
- VK - CK - Fc domain (second polypeptide)
- V H - CH1 - Fc domain - V H - CK (first polypeptide)
- VK - CH1 (third polypeptide).
- heterodimers are formed in which variable domains adjacent to the CH1 or CK domain do not require association with the second chain to form an antigen binding domain.
- each chain will contain a functional ABD.
- Examples based CH1 -CK dimerization with single variable exemplary heterodimer molecules can have a domain arrangement: (Vi-C K ) - (hinge or linker) - CH2 - CH3
- V-i and V 2 are single variable domains (e.g. V H domain, a V L domain, a dAb, a V- NAR domain or a V H H domain), and one of ⁇ and V 2 binds NKp46 and the other binds an antigen of interest.
- exemplary heterodimer molecules can have a domain arrangement:
- V a-1 , V b- i , V a-2 and V b- 2 are each a V H domain or a V L domain, and wherein one of V a-
- V b-1 is a V H and the other is a V L such that V a-1 and V b-1 form a first antigen binding domain (ABD), wherein one of V a-2 and V b-2 is a V H and the other is a V L such that V a-2 and V b- 2 form a second antigen binding domain, wherein one of the ABD binds NKp46 and the other binds an antigen of interest.
- ABD antigen binding domain
- V a-2 and V b-2 are a scFv (made up of two variable domains). Each pair of V domains can be separated by a linker peptide (e.g. to form a scFv).
- trimers can be constructed.
- Exemplary heterotrimer molecules can have the following domain arrangement:
- V a _2 - V b-2 (hinge or linker) - CH2 - CH3 (second chain)
- multimeric proteins are constructed based upon two Fc- containing chains (e.g. chains 1 and 2) to create a dimer via CH3-CH3 dimerization and/or hinge dimerization, and a further chain (e.g. chain 3) comprising a V-C H /CK unit that dimerizes with one of chains 1 or 2.
- exemplary molecules can have the following domain arrangement:
- V b- i is a VH and the other is a V L such that V a-1 and V b-1 form a first antigen binding domain (ABD), wherein one of V a-2 and V b-2 is a VH and the other is a V L such that V a-2 and
- V b-2 form a second antigen binding domain.
- Exemplary molecules may possess the following domain arrangement:
- V a-2 (CH 1 ) - (hinge or linker) - CH2 - CH3 Chain 2
- V b- i is a V H and the other is a V L such that V a-1 and V b-1 form a first antigen binding domain (ABD), wherein one of V a-2 and V b-2 is a V H and the other is a V L such that V a-2 and V b-
- the CH1 and CK are selected such that chain 1 is capable of associating with chain 2 and chain 2 with chain 3.
- the protein can be configured such that chains 1 and 2 associate via CH3-CH3 dimerization and chains 2 and 3 associate via CH I -CK dimerization.
- any of the multispecific proteins of the invention may include, CH3 domains which comprise amino acid substitutions, wherein the CH3 domain interface of the antibody Fc region is mutated to create altered charge polarity across the Fc dimer interface such that co-expression of electrostatically matched Fc chains supports favorable attractive interactions thereby promoting desired Fc heterodimer formation, whereas unfavorable repulsive charge interactions suppress unwanted Fc homodimer formation.
- Heterodimeric or heterotrimeric polypeptides with two ABDs and a dimeric Fc domain can optionally be produced as one or more chains that each associate with a central chain, e.g. by CH1 -CK heterodimerization.
- Such multimers may be composed of a central (first) polypeptide chain comprising two immunoglobulin variable domains that are part of separate antigen binding domains (of different antigen specificities), the one or more other chains that provide the additional and/or complementary variable domains, and an Fc domain placed on the central and/or one or more other chains.
- the Fc domain is interposed between the two ABDs in the multimeric protein.
- the first (central) polypeptide chain will provide one variable domain that will, together with a complementary variable domain on a second polypeptide chain, form an antigen binding domain specific for one (e.g. a first) antigen of interest.
- the first (central) polypeptide chain will also provide a second variable domain (e.g., placed on the opposite end of the interposed Fc domain) that will be paired with a complementary variable domain to form an antigen binding domain specific for another (e.g. a second) antigen of interest; the variable domain that is complementary to the second variable domain can be placed on the central polypeptide (e.g.
- a tandem variable domain construct such as an scFv
- a tandem variable domain construct such as an scFv
- the second (and third, if present) polypeptide chains will associate with the central polypeptide chain by CH 1 -CK heterodimerization, forming non-covalent bonds and optionally further interchain disulfide bonds between complementary CH 1 and CK domains (and optionally interchain disulfide bonds between hinge regions), with a primary multimeric polypeptide being formed so long as CH/CK and VH/VK domains are chosen to give rise to a preferred dimerization configuration that results preferentially in the desired V H -V L pairings.
- trimer or when polypeptides are constructed for preparation of a trimer, there will generally be one polypeptide chain that comprises a non-naturally occurring VH-CK or VK-CH 1 domain arrangement.
- domain arrangements (N- to C-termini) of central polypeptide chains for use in such heterodimeric proteins include any of the following:
- domain arrangements (N- to C-termini) of central polypeptide chains for use in such heterodimeric proteins can include:
- V A-1 (CH 1 or CK) 3 - FC domain - V A-2 - V B- 2;
- V b is a single variable domain (e.g. dAb, VhH).
- the Fc domain of the central chain may be a full Fc domain (CH2-CH3) or a portion thereof sufficient to confer the desired functionality (e.g. CD16 and optionally FcRn or another Fc receptor binding) when it forms a dimeric Fc with a second chain.
- a second polypeptide chain will then be configured which will comprise an immunoglobulin variable domain and a CH 1 or CK constant region, e.g., a (CH 1 or CK) B unit, selected so as to permit CH I -CK heterodimerization with the central polypeptide chain; the immunoglobulin variable domain will be selected so as to complement the variable domain of the central chain that is adjacent to the CH 1 or CK domain, whereby the complementary variable domains form an antigen binding domain for a first antigen of interest.
- a CH 1 or CK constant region e.g., a (CH 1 or CK) B unit
- a second polypeptide chain can comprise a domain arrangement:
- V b-1 forms an antigen binding domain together with V a-1 of the central chain. If the V a-1 of the central chain is a light chain variable domain, then V b-1 will be a heavy chain variable domain; and if V a-1 of the central chain is a heavy chain variable domain, then V b-1 will be a light chain variable domain.
- the antigen binding domain for the second antigen of interest can then be formed from V a-2 and V b-2 which are configured as tandem variable domains on the central chain forming the antigen binding domain for the second antigen of interest (e.g. a heavy chain variable domain (V H ) and a light chain ( ⁇ ) variable domain (VK), for example forming an scFv unit).
- the antigen binding domain for the second antigen of interest can also alternatively be formed from a single variable domain V b present on the central chain.
- the resulting heterodimer can, for example, have the following configuration (see further Examples of such proteins shown as formats 13 and 14 shown in Figure 2D and 2E): V a-1 - (CH 1 or CK) 3 - FC domain - V a-2 - V b-2 (first/central polypeptide chain)
- V b-1 - (CH 1 or CK) B - Fc domain (second polypeptide chain) wherein one of V a-1 of the first polypeptide chain and V b-1 of the second polypeptide chain is a light chain variable domain and the other is a heavy chain variable domain, and wherein one of V a-2 and V B- 2 is a light chain variable domain and the other is a heavy chain variable domain.
- the heterodimeric bispecific Fc-derived polypeptide comprises a domain arrangement selected from one of the following, optionally wherein one or both of the hinge domains are replaced by a peptide linker, optionally wherein the Fc domain is fused to anti-NKp46 scFv via a peptide linker):
- Heterotrimeric proteins can for example be formed by using a central (first) polypeptide chain comprising a first variable domain (V) fused to a first CH 1 or CK constant region, a second variable domain (V) fused to a second CH 1 or CK constant region, and an Fc domain or portion thereof interposed between the first and second variable domains (i.e. the Fc domain is interposed between the first and second (V-(CH 1 /CK) units.
- a central polypeptide chain for use in a heterotrimeric protein according to the invention can have the domain arrangements (N- to C- termini) as follows:
- a second polypeptide chain can then comprise a domain arrangement (N- to C- termini):
- a third polypeptide chain can then comprise the following domain arrangement (N- to
- V b-2 - (CH 1 or K D (third polypeptide)
- the first polypeptide can have two variable domains that each form an antigen binding domain with a variable domain on a separate polypeptide chain (i.e. the variable domain of the second and third chains), the second polypeptide chain has one variable domain, and the third polypeptide has one variable domain.
- a trimeric polypeptide according to the invention may further comprise the following: (a) a first polypeptide chain comprising a first variable domain (V) fused to a first CH 1 of CK constant region, a second variable domain (V) fused to a second CH 1 of CK constant region, and an Fc domain or portion thereof interposed between the first and second variable domains;
- a second polypeptide chain comprising a variable domain fused at its C- terminus to a CH 1 or CK constant region selected to be complementary to the first CH 1 or CK constant region of the first polypeptide chain such that the first and second polypeptides form a CH 1 -CK heterodimer, and an Fc domain;
- a third polypeptide chain comprising a variable domain fused (e.g. at its C- terminus) to a CH 1 or CK constant region, wherein the variable domain and the constant region are selected to be complementary to the second variable domain and second CH 1 or CK constant region of the first polypeptide chain such that the first and third polypeptides form a CH 1 -CK heterodimer bound by non-covalent and optionally further disulfide bond(s) formed between the CH 1 or CK constant region of the third polypeptide and the second CH 1 or CK constant region of the first polypeptide, but not between the CH 1 or CK constant region of the third polypeptide and the first CH 1 or CK constant region of the first polypeptide
- first, second and third polypeptides form a CH 1 -CK heterotrimer
- first variable domain of the first polypeptide chain and the variable domain of the second polypeptide chain form an antigen binding domain specific for a first antigen of interest
- second variable domain of the first polypeptide chain and the variable domain on the third polypeptide chain form an antigen binding domain specific for a second antigen of interest
- VK- CK - Fc domain (second polypeptide)
- VK - CM (third polypeptide)
- V H - - CM - Fc domain (second polypeptide)
- VK - CM (third polypeptide)
- heterotrimers can be constructed with three ABDs and a dimeric Fc.
- One of the ABDs will bind to NKp46, and the other two ABDs can bind to an antigen of interest, wherein the antigen of interest bound by the two ABDs can be the same antigen or a different antigen.
- the multimeric polypeptide can bind the antigen of interest in a bivalent manner (with two ABDs).
- Heterotrimeric proteins can for example be formed by using a central (first) polypeptide chain comprising a first variable domain (V) fused to a first CH1 or CK constant region, a second variable domain (V) fused to a second CH1 or CK constant region, and an Fc domain or portion thereof interposed between the first and second variable domains (i.e. the Fc domain is interposed between the first and second (V-(CH1/CK)) units.
- a central polypeptide chain for use in a heterotrimeric protein can have the domain arrangements (N- to C- termini) as follows:
- a second polypeptide chain can then comprise a domain arrangement (N- to C- termini):
- a third polypeptide chain can then comprise a domain arrangement (N- to C- termini): V 2 - (CH 1 or CK) d - scFv,
- a hinge region will typically be present on a polypeptide chain between a CH1 domain and a CH2 domain of an Fc domain, and/or can be present between a CK domain and a CH2 domain.
- a hinge region can optionally be replaced, e.g., by a suitable linker peptide.
- the Fc domain may comprise a CH2-CH3 unit (a full length CH2 and CH3 domain or a fragment thereof).
- the CH3 domain will be capable of CH3-CH3 dimerization (e.g. it will comprise a wild-type CH3 domain).
- the multispecific protein can be a heterodimer, a heterotrimer or a heterotetramers, wherein the polypeptide chains are engineered for heterodimerization among each other so as to produce the desired protein.
- the chains may comprise constant or Fc domains with amino acid modifications (e.g., substitutions) that favor the preferential hetero-dimerization of the two different chains over the homo- dimerization of two identical chains.
- a "knob-into-holes" approach is used in which the CH3 domain interface of the antibody Fc region is mutated so that the antibodies preferentially form heterodimers (further including the attached light chains).
- These mutations create altered charge polarity across the Fc dimer interface such that co- expression of electrostatically matched Fc chains support favorable attractive interactions thereby promoting desired Fc heterodimer formation, whereas unfavorable repulsive charge interactions suppress unwanted Fc homodimer formation.
- one heavy chain comprises a T366W substitution and the second heavy chain comprises a T366S, L368A and Y407V substitution, see, e.g. Ridgway et al (1996) Protein Eng., 9, pp.
- one heavy chain comprises a F405L substitution and the second heavy chain comprises a K409R substitution, see, e.g., Labrijn et al. (2013) Proc. Natl. Acad. Sci. U.S.A., 1 10, pp. 5145-5150.
- one heavy chain comprises T350V, L351Y, F405A, and Y407V substitutions and the second heavy chain comprises T350V, T366S, K392L, and T394W substitutions, see, e.g.
- one heavy chain comprises both K409D and K392D substitutions and the second heavy chain comprises both D399K and E356K substitutions, see, e.g. Gunasekaran et al., (2010) J. Biol. Chem. 285:19637-19646.
- one heavy chain comprises D221 E, P228E and L368E substitutions and the second heavy chain comprises D221 R, P228R, and K409R substitutions, see, e.g. Strop et al., (2012) J. Mol. Biol. 420: 204-219.
- one heavy chain comprises S364H and F405A substitutions and the second heavy chain comprises Y349Tand, T394F substitutions, see, e.g. Moore et al., (201 1 ) mAbs 3: 546-557.
- one heavy chain comprises a H435R substitution and the second heavy chain optionally may or may not comprise a substitution, see, e.g. US Patent no. 8,586,713.
- the Fc regions of these antibodies can be engineered to contain amino acid modifications that permit CD16 binding.
- the antibody may comprise mammalian antibody-type N-linked glycosylation at residue N297 (Kabat EU numbering).
- the invention also comprises a heterodimeric or heterotrimeric protein that comprises an NKp46-binding ABD and an antigen of interest-binding ABD, in which one or both of the ABDs (e.g., a variable region or other antigen binding domain such as a non-immunoglobulin scaffold) is linked to a constant region, e.g., an Fc domain or portion thereof via a linker, e.g., a flexible polypeptide linker.
- the ABD is placed on a single polypeptide chain (e.g. a tandem variable domain, a V H H or single V domain, a non-immunoglobulin scaffold).
- one or both of the ABDs is comprised in a V H and V L domain that associate with one another to form the ABD.
- the V H and V L that form an ABD are each within a tandem variable region (a V H and V L domain separated by a flexible polypeptide linker).
- one of the ABDs is comprised in a Fab or Fab-like structure, in which a variable domain is linked to a CH 1 domain and a complementary variable domain is linked to a complementary CK (or CA) constant domain, wherein the CH 1 and CK (or CA) constant domains associate (dimerize).
- one of the ABDs is comprised in such a Fab or Fab-like structure and the other ABD is placed on a single polypeptide chain (e.g. a tandem variable domain) and is linked to a constant region, e.g., an Fc domain or portion thereof via a linker, e.g., a flexible polypeptide linker.
- one of the ABDs comprises a Fab or Fab-like structure, in which a variable domain is linked to a CH 1 domain and a complementary variable domain is linked to a complementary CK (or CA) constant domain, wherein the CH 1 and CK (or CA) constant domains associate to form a heterodimeric protein.
- a first and second ABD can advantageously comprise or consist of single variable domains (e.g. VhH domains) having different antigen binding specificities (e.g., VhH-i and VhH 2 ).
- the VhH-i can be fused to a CH 1 domain and VhH 2 can be fused to a CK or CA domain.
- the ⁇ - CK (or CA) chain associates with a V 2 -CH 1 chain such that a Fab is formed. See, e.g., WO2006/064136 and WO2012/089814 which disclose examples of such antibodies lacking Fc domains, the disclosures of which PCT applications are incorporated herein by reference.
- the CH 1 and/or CK domains can then be linked to a CH2 domain, optionally via a hinge region (or a linker peptide, e.g., one that has similar functional properties, e.g., dimerization).
- the CH2 domain(s) is/are then linked to a CH3 domain.
- the CH2-CH3 domains can thus optionally be embodied as a full-length Fc domain.
- a hinge region can and generally will be present on a polypeptide chain between a CH 1 domain and a CH2 domain, and/or can be present between a CK domain and a CH2 domain.
- a hinge region can optionally be replaced for example by a suitable linker peptide, e.g. a flexible polypeptide.
- proteins domains described in the present disclosure can optionally be specified as being from N- to C- termini. Protein arrangements of the disclosure for purposes of illustration are shown from N-terminus (on the left) to C-terminus. Domains can be referred to as fused to one another (e.g. a domain can be said to be fused to the C-terminus of the domain on its left, and/or a domain can be said to be fused to the N-terminus of the domain on its right).
- the proteins domains described in the present disclosure can be fused to one another directly or via intervening amino acid sequences.
- a CH 1 or CK domain can be fused to an Fc domain (or CH2 or CH3 domain thereof) via a linker peptide, optionally a hinge region or a fragment thereof.
- a V H or VK domain can be fused to a CH3 domain via a linker peptide.
- V H and V L domains linked to another in tandem can and generally will be fused via a linker peptide (e.g. a scFv).
- V H and V L domains linked to an Fc domain will be fused via a linker peptide.
- Two polypeptide chains will be bound to one another (indicated by " "), by non-covalent bonds, and optionally can further be attached via interchain disulfide bonds, formed between cysteine residues within complementary CH 1 and CK domains.
- ABD(s) or a polypeptide chain(s) comprise(s) a tandem variable region (e.g. scFv)
- two V domains e.g. a V H domain and V L domains are generally linked together by a linker of sufficient length to enable the ABD to fold in such a way as to permit binding to the antigen for which the ABD is intended to bind.
- the linkage may be via a flexible linker (e.g. polypeptide linker) that permits the ABD to be positioned such that it binds to its target antigen and exhibits the desired functionality, e.g.
- linkers include, for example, linkers derived from antibody hinge regions, an amino sequence RTVA, or linkers comprising glycine and serine residues, e.g., the amino acid sequence GEGTSTGS(G 2 S) 2 GGAD.
- the V H domain and V L domains of a scFv are linked together by the amino acid sequence (G 4 S) 3 .
- any of the peptide linkers contained in the subject multispecific proteins may comprise a length of at least 4 residues, at least 5 residues, at least 1 0 residues, at least 15 residues, at least 20 residues, at least 25 residues, at least 30 residues or more.
- the linkers comprise a length of between 2-4 residues, between 2-4 residues, between 2-6 residues, between 2-8 residues, between 2-10 residues, between 2-12 residues, between 2-14 residues, between 2-16 residues, between 2-18 residues, between 2- 20 residues, between 2-22 residues, between 2-24 residues, between 2-26 residues, between 2-28 residues, between 2-30 residues, between 2 and 50 residues, or between 10 and 50 residues.
- An ABD (e.g. an immunoglobulin variable region) can optionally be linked to a constant domain or Fc domain via a flexible linker (e.g. polypeptide linker) that leads to less structural rigidity or stiffness (e.g. between or amongst the ABD and Fc domain) compared to a conventional (e.g. wild-type full length human IgG) antibody.
- the multispecific protein may have a structure or a flexible linker between the ABD and constant domain or Fc domain that permits an increased range of domain motion compared to the ABD in a conventional (e.g. wild-type full length human IgG) antibody.
- the structure or a flexible linker can be configured to confer on the antigen binding sites greater intrachain domain movement compared to antigen binding sites in a conventional human lgG1 antibody.
- Rigidity or domain motion/interchain domain movement can be determined, e.g., by computer modeling, electron microscopy, spectroscopy such as Nuclear Magnetic Resonance (NMR), X-ray crystallography, or Sedimentation Velocity Analytical ultracentrifugation (AUC) to measure or compare the radius of gyration of proteins comprising the linker or hinge.
- a test protein or linker may have lower rigidity relative to a comparator protein if the test protein has a value obtained from one of the tests described in the previous sentence differs from the value of the comparator, e.g., an lgG1 antibody or a hinge, by at least 5%, 10%, 25%, 50%, 75%, or 100%.
- the comparator e.g., an lgG1 antibody or a hinge
- the multispecific protein may have a structure or a flexible linker between the ABD and constant domain or Fc domain that permits the NKp46 ABD and the ABD which binds an antigen of interest to have a spacing between said ABDs comprising less than about 80 angstroms, less than about 60 angstroms or ranges from about 40-60 angstroms.
- the hinge region will be a fragment of a hinge region (e.g. a truncated hinge region without cysteine residues) or may comprise one or more amino acid modifications which remove (e.g. substitute by another amino acid, or delete) a cysteine residue, optionally both cysteine residues in a hinge region.
- Removing cysteines can be useful to prevent undesired disulfide bond formation, e.g., the formation of disulfide bridges in a monomeric polypeptide.
- a (poly)peptide linker used to link a CH1 or CK domain to a CH2 or CH3 domain of an Fc domain comprises a fragment of a CH1 domain and/or hinge region.
- an N-terminal amino acid sequence of CH1 can be fused to a variable domain in order to mimic as closely as possible the natural structure of a wild-type antibody.
- the linker comprises an amino acid sequence from a hinge domain or an N- terminal CH1 amino acid.
- the sequence can be, for example, between 2-4 residues, between 2-4 residues, between 2-6 residues, between 2-8 residues, between 2-10 residues, between 2-12 residues, between 2-14 residues, between 2-16 residues, between 2-18 residues, between 2- 20 residues, between 2-22 residues, between 2-24 residues, between 2-26 residues, between 2-28 residues, or between 2-30 residues.
- the linker comprises or consists of the amino acid sequence RTVA.
- the hinge region (or fragment thereof) is derived form a hinge domain of a human lgG1 antibody.
- a hinge domain may comprise the amino acid sequence: T-H-T-C-S-S-C-P-A-P-E-L-L (one letter code), or an amino acid sequence at least 60%, 70%, 80% or 90% identical thereto, optionally wherein one or both cysteines are deleted or substituted by a different amino acid residue.
- the hinge region (or fragment thereof) is derived from a C 2-C C 3 hinge domain of a human IgM antibody.
- a hinge domain may comprise the amino acid sequence: N-A-S-S-M-C-V-P-S-P-A-P-E-L-L (one letter code), or an amino acid sequence at least 60%, 70%, 80% or 90% identical thereto, optionally wherein one or both cysteines are deleted or substituted by a different amino acid residue.
- Polypeptide chains that dimerize and associate with one another via non-covalent bonds may or may not additionally be bound by an interchain disulfide bond formed between respective CH1 and CK domains, and/or between respective hinge domains on the chains.
- CH1 , CK and/or hinge domains can optionally be configured such that interchain disulfide bonds are formed between chains such that the desired pairing of chains is favored and undesired or incorrect disulfide bond formation is avoided.
- the polypeptide chains when two polypeptide chains to be paired each possess a CH 1 or CK adjacent to a hinge domain, the polypeptide chains can be configured such that the number of available cysteines for interchain disulfide bond formation between respective CH1/CK-hinge segments is reduced (or is entirely eliminated).
- the amino acid sequences of respective CH1 , CK and/or hinge domains can be modified to remove cysteine residues in both the CH 1/CK and the hinge domain of a polypeptide; thereby the CH1 and CK domains of the two chains that dimerize will associate via non-covalent interaction(s).
- the CH 1 or CK domain adjacent (e.g., N-terminal to) a hinge domain comprises a cysteine capable of interchain disulfide bond formation
- the hinge domain which is placed at the C-terminus of the CH 1 or CK comprises a deletion or substitution of one or both cysteines of the hinge (e.g. Cys 239 and Cys 242, as numbered for human lgG1 hinge according to Kabat).
- the hinge region (or fragment thereof) comprise the amino acid sequence: T-H-T-S-P-P-S-P-A-P-E-L-L (one letter code), or an amino acid sequence at least 60%, 70%, 80% or 90% identical thereto.
- the CH 1 or CK domain adjacent (e.g., N-terminal to) a hinge domain comprises a deletion or substitution at a cysteine residue capable of interchain disulfide bond formation
- the hinge domain placed at the C-terminus of the CH 1 or CK comprises one or both cysteines of the hinge (e.g. Cys 239 and Cys 242, as numbered for human lgG1 hinge according to Kabat).
- the hinge region (or fragment thereof) comprises the amino acid sequence: T-H-T-C-S-S-C-P-A-P-E-L-L (one letter code), or an amino acid sequence at least 60%, 70%, 80% or 90% identical thereto.
- a hinge region is derived from an IgM antibody.
- the CH 1/CK pairing mimics the C 2 domain homodimerization in IgM antibodies.
- the CH 1 or CK domain adjacent (e.g., N-terminal to) a hinge domain comprises a deletion or substitution at a cysteine capable of interchain disulfide bond formation, and an IgM hinge domain which is placed at the C-terminus of the CH 1 or CK comprises one or both cysteines of the hinge.
- the hinge region (or fragment thereof) comprises the amino acid sequence: T-H-T-C-S-S-C-P-A-P-E-L-L (one letter code), or an amino acid sequence at least 60%, 70%, 80% or 90% identical thereto.
- Constant region domains can be derived from any suitable human antibody, including, the constant heavy (CH 1 ) and light (CK) domains, hinge domains, CH2 and CH3 domains. With respect to heavy chain constant domains, “CH 1 " generally refers to positions
- CH2 generally refers to positions 237-340 according to the EU index as in Kabat
- CH3 generally refers to positions 341 -447 according to the EU index as in Kabat.
- a “hinge” or “hinge region” or “antibody hinge region” herein refers to the flexible polypeptide or linker between the first and second constant domains of an antibody.
- the IgG CH 1 domain ends at EU position 220, and the IgG CH2 domain begins at residue EU position 237.
- the hinge generally includes positions 221
- CH2 and CH3 domains which may be present in the subject antibodies or multispecific proteins can be derived from any suitable antibody.
- Such CH2 and CH3 domains can be used as wild-type domains or may serve as the basis for a modified CH2 or CH3 domain.
- the CH2 and/or CH3 domain is of human origin or may comprise that of another species (e.g., rodent, rabbit, non-human primate) or may comprise a modified or chimeric CH2 and/or CH3 domain, e.g., one comprising portions or residues from different CH2 or CH3 domains, e.g., from different antibody isotypes or species antibodies .
- a CH2 and/or CH3 domain may comprise a modification to decrease or abolish binding to FCYRI I IA (CD16).
- FCYRI I IA CD16
- CH2 mutations in a dimeric Fc domain proteins at reside N297 can eliminate CD16 binding.
- substitutions into human lgG1 or lgG2 residues at positions 233-236 and lgG4 residues at positions 327, 330 and 331 were shown to greatly reduce binding to Fey receptors and thus ADCC and CDC.
- Idusogie et al. (2000) J. Immunol. 164(8):4178-84 demonstrated that alanine substitution at different positions, including K322, significantly reduced complement activation.
- CH3 domain may be a wild-type domain or may comprise one or more amino acid modifications (e.g. amino acid substitutions) which increase binding to human CD16 and optionally another receptor such as FcRn.
- the modifications will not substantially decrease or abolish the ability of the Fc-derived polypeptide to bind to neonatal Fc receptor (FcRn), e.g. human FcRn.
- Typical modifications include modified human lgG1 -derived constant regions comprising at least one amino acid modification (e.g. substitution, deletions, insertions), and/or altered types of glycosylation, e.g., hypofucosylation.
- FcyRI CD64
- FcyRII CD32
- FcyRIII CD16
- FcyRI CD64
- FcyRI I A CD32A
- FcyRIII CD 16
- a modification may, for example, increase binding of the Fc domain to FcyRllla on effector (e.g. NK) cells and/or decrease binding to FcyRIIB. Examples of modifications are provided in PCT publication no. WO2014/044686, the disclosure of which is incorporated herein by reference. Specific mutations (in lgG1 Fc domains) which affect (enhance) FcyRllla or FcRn binding are also set forth below. Effector Effect of
- the multispecific protein comprises a variant Fc region comprise at least one amino acid modification (for example, possessing 1 , 2, 3, 4, 5, 6, 7, 8, 9, or more amino acid modifications) in the CH2 and/or CH3 domain of the Fc region, wherein the modification enhances binding to a human CD16 polypeptide.
- the multispecific protein comprises at least one amino acid modification (for example, 1 , 2, 3, 4, 5, 6, 7, 8, 9, or more amino acid modifications) in the CH2 domain of the Fc region from amino acids 237-341 , or within the lower hinge-CH2 region that comprises residues 231 - 341 .
- the multispecific protein comprises at least two amino acid modifications (for example, 2, 3, 4, 5, 6, 7, 8, 9, or more amino acid modifications), wherein at least one of such modifications is within the CH3 region and at least one such modifications is within the CH2 region.
- amino acid modifications in the hinge region encompassed are amino acid modifications in the CH1 domain, optionally in the upper hinge region that comprises residues 216-230 (Kabat EU numbering). Any suitable functional combination of Fc modifications can be made, for example any combination of the different Fc modifications which are disclosed in any of United States Patents Nos.
- the multispecific protein comprises an Fc domain comprising at least one amino acid modification (for example, 1 , 2, 3, 4, 5, 6, 7, 8, 9, or more amino acid modifications) relative to a wild-type Fc region, such that the molecule has an enhanced binding affinity for human CD16 relative to the same molecule comprising a wild-type Fc region, optionally wherein the variant Fc region comprises a substitution at any one or more of positions 221 , 239, 243, 247, 255, 256, 258, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 300, 301 , 303, 305, 307, 308, 309, 310, 31 1 , 312, 316, 320, 322, 326, 329, 330, 332, 331 , 332, 333, 334, 335, 337, 338, 339, 340, 359, 360, 370, 3
- the multispecific protein comprises an Fc domain comprising at least one amino acid modification (for example, 1 , 2, 3, 4, 5, 6, 7, 8, 9, or more amino acid modifications) relative to a wild-type Fc region, such that the molecule has enhanced binding affinity for human CD16 relative to a molecule comprising a wild-type Fc region, optionally wherein the variant Fc region comprises a substitution at any one or more of positions 239, 298, 330, 332, 333 and/or 334 (e.g. S239D, S298A, A330L, I332E, E333A and/or K334A substitutions), optionally wherein the variant Fc region comprises a substitution at residues S239 and I332, e.g. a S239D and I332E substitution (Kabat EU numbering).
- amino acid modification for example, 1 , 2, 3, 4, 5, 6, 7, 8, 9, or more amino acid modifications
- the multispecific protein comprises an Fc domain comprising altered glycosylation patterns that increase binding affinity for human CD16.
- carbohydrate modifications can be accomplished by, for example, by expressing a nucleic acid encoding the multispecific protein in a host cell with altered glycosylation machinery.
- Cells with altered glycosylation machinery are known in the art and can be used as host cells in which to express recombinant antibodies to thereby produce an antibody with altered glycosylation. See, for example, Shields, R.L. et al. (2002) J. Biol. Chem. 277:26733-26740; Umana et al. (1999) Nat. Biotech.
- the multispecific protein contains one or more hypofucosylated constant regions.
- Such multispecific protein may comprise an amino acid alteration or may not comprise an amino acid alteration and/or may be expressed or synthesized or treated under conditions that result in hypofucosylation.
- a multispecific protein composition comprises a multispecific protein described herein, wherein at least 20, 30, 40, 50, 60, 75, 85, 90, 95% or substantially all of the antibody species in the composition have a constant region comprising a core carbohydrate structure (e.g. complex, hybrid and high mannose structures) which lacks fucose.
- a multispecific protein composition which is free of N-linked glycans comprising a core carbohydrate structure having fucose.
- the core carbohydrate will preferably be a sugar chain at Asn297.
- a multispecific protein comprising a dimeric Fc domain can be characterized by having a binding affinity to a human CD16 polypeptide that is within 1-log of that of a conventional human lgG1 antibody, e.g., as assessed by surface plasmon resonance.
- the multispecific protein comprising a dimeric Fc domain engineered to enhance Fc receptor binding can be characterized by having a binding affinity to a human CD16 polypeptide that is at least 1 -log greater than that of a conventional or wild-type human lgG1 antibody, e.g., as assessed by surface plasmon resonance.
- a multispecific protein comprising a dimeric Fc domain can be characterized by a Kd for binding (monovalent) to a human CD16 polypeptide of less than 10 "5 M (10 ⁇ ), optionally less than 10 "6 M (1 ⁇ -iolar), as assessed by surface plasmon resonance (e.g. as in Example 16, SPR measurements performed on a Biacore T100 apparatus (Biacore GE Healthcare), with bispecific antibodies immobilized on a Sensor Chip CM5 and serial dilutions of soluble CD16 polypeptide injected over the immobilized bispecific antibodies.
- CDR sequences and epitopes can be characterized by a Kd for binding (monovalent) to a human CD16 polypeptide of less than 10 "5 M (10 ⁇ ), optionally less than 10 "6 M (1 ⁇ -iolar), as assessed by surface plasmon resonance (e.g. as in Example 16, SPR measurements performed on a Biacore T100 apparatus (Biacore GE Healthcare), with bispecific antibodies immobilized on
- the proteins and antibodies herein bind the D1 domain of NKp46, the D2 domain of NKp46, or bind a region spanning the D1 and D2 domains (at the border of the D1 and D2 domains, the D1/D2 junction), of the NKp46 polypeptide of SEQ ID NO: 1 .
- the multispecific proteins or antibodies according to the invention have an affinity for human NKp46 characterized by a K D of less than 10 "8 M, less than 10 "9 M, or less than 10 "10 M.
- the inventive antibodies or multispecific proteins bind NKp46 at substantially the same epitope on NKp46 as antibody NKp46-1 , NKp46-2, NKp46-3, NKp46- 4, NKp46-6 or NKp46-9.
- the antibodies at least partially overlaps, or includes at least one residue in the segment or epitope bound by NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9.
- all key residues of the epitope are in a segment corresponding to domain D1 or D2.
- the antibody or multispecific protein binds a residue present in the D1 domain as well as a residue present in in the D2 domain.
- the antibodies bind an epitope comprising 1 , 2, 3, 4, 5, 6, 7 or more residues in the segment corresponding to domain D1 or D2 of the NKp46 polypeptide of SEQ ID NO: 1.
- the antibodies bind domain D1 and further bind an epitope comprising 1 , 2, 3, or 4 of the residues R101 , V102, E104 and/or L105.
- the antibodies or multispecific proteins bind Nkp46 at the D1/D2 domain junction and bind an epitope comprising or consisting of 1 , 2, 3, 4 or 5 of the residues K41 , E42, E1 19, Y121 and/or Y194.
- the antibodies or multispecific proteins bind domain D2 and bind an epitope comprising 1 , 2, 3, or 4 of the residues P132, E133, 1135, and/or S136.
- the Examples section provided infra further describes the construction of a series of mutant human NKp46 polypeptides.
- the binding of anti-NKp46 antibody or multispecific protein to cells transfected with the NKp46 mutants was measured and compared to the ability of anti-NKp46 antibody to bind wild-type NKp46 polypeptide (SEQ ID NO:1 ).
- a reduction in binding between an anti-NKp46 antibody or NKp46 binding multispecific protein and a mutant NKp46 polypeptide as described herein means that there is a reduction in binding affinity (e.g., as measured by known methods such FACS testing of cells expressing a particular mutant, or by Biacore testing of binding to mutant polypeptides) and/or a reduction in the total binding capacity of the anti-NKp46 antibody (e.g., as evidenced by a decrease in Bmax in a plot of anti-NKp46 antibody concentration versus polypeptide concentration).
- a significant reduction in binding indicates that the mutated residue is directly involved in the binding to the anti-NKp46 antibody to NKp46 or is in close proximity to the binding protein when the anti-NKp46 antibody or NKp46 binding multispecific protein is bound to NKp46.
- An antibody epitope will thus preferably include such residue and may include additional residues adjacent to such residue.
- a significant reduction in binding means that the binding affinity and/or capacity between an anti-NKp46 antibody or NKp46 binding multispecific protein and a mutant NKp46 polypeptide is reduced by greater than 40 %, greater than 50 %, greater than 55 %, greater than 60 %, greater than 65 %, greater than 70 %, greater than 75 %, greater than 80 %, greater than 85 %, greater than 90% or greater than 95% relative to binding between the antibody and a wild type NKp46 polypeptide (e.g., the polypeptide shown in SEQ ID NO:1 ). In certain embodiments, binding is reduced below detectable limits.
- a significant reduction in binding is evidenced when binding of an anti-NKp46 antibody to a mutant NKp46 polypeptide is less than 50% (e.g., less than 45%, 40%, 35%, 30%, 25%, 20%, 15% or 10%) of the binding observed between the anti-NKp46 antibody and a wild-type NKp46 polypeptide (e.g., the polypeptide shown in SEQ ID NO: 1 (or the extracellular domain thereof)).
- binding measurements can be made using a variety of binding assays known in the art. A specific example of one such assay is described in the Example section.
- anti-NKp46 antibodies or NKp46 binding multispecific proteins are provided that exhibit significantly lower binding for a mutant NKp46 polypeptide in which a residue in a wild-type NKp46 polypeptide (e.g., SEQ ID NO:1 ) is substituted.
- a residue in a wild-type NKp46 polypeptide e.g., SEQ ID NO:1
- the format is: Wild type residue: Position in polypeptide: Mutant residue, with the numbering of the residues as indicated in SEQ ID NO: 1.
- an anti-NKp46 antibody binds a wild-type NKp46 polypeptide but has decreased binding to a mutant NKp46 polypeptide having a mutation (e.g., an alanine substitution) any one or more of the residues R101 , V102, E104 and/or L105 (with reference to SEQ ID NO:1 ) compared to binding to the wild-type NKp46).
- a mutation e.g., an alanine substitution
- an anti-NKp46 antibody or NKp46-binding multispecific protein binds a wild-type NKp46 polypeptide but has decreased binding to a mutant NKp46 polypeptide having a mutation (e.g., an alanine substitution) at one or more of residues K41 , E42, E1 19, Y121 and/or Y194 (with reference to SEQ ID NO:1 ) compared to binding to the wild-type NKp46).
- a mutation e.g., an alanine substitution
- an anti-NKp46 antibody or NKp46-binding multispecific protein binds a wild-type NKp46 polypeptide but has decreased binding to a mutant NKp46 polypeptide having a mutation (e.g., an alanine substitution) at one or more of residues P132, E133, 1135, and/or S136 (with reference to SEQ ID NO:1 ) compared to binding to the wild-type NKp46).
- a mutation e.g., an alanine substitution
- amino acid sequence of the heavy chain variable region of antibodies NKp46-1 , NKp46- 2, NKp46-3, NKp46-4, NKp46-6 and NKp46-9 are listed herein in Table B (SEQ ID NOS: 3, 5, 7, 9, 1 1 and 13 respectively), the amino acid sequence of the light chain variable region of antibodies NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 and NKp46-9 are also listed herein in Table B (SEQ ID NOS: 4, 6, 8, 10, 12 and 14 respectively).
- the invention provides is an antibody, e.g. a full length monospecific antibody, a multispecific or bispecific antibody, including a bispecific monomeric polypeptide, or a NKp46-binding multispecific protein that binds essentially the same epitope or determinant as monoclonal antibody NKp46-1 , NKp46-2, NKp46-3, NKp46- 4, NKp46-6 or NKp46-9; optionally the antibody comprises a hypervariable region of antibody NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9.
- an antibody e.g. a full length monospecific antibody, a multispecific or bispecific antibody, including a bispecific monomeric polypeptide, or a NKp46-binding multispecific protein that binds essentially the same epitope or determinant as monoclonal antibody NKp46-1 , NKp46-2, NKp46-3, NKp
- antibody NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9 can be characterized by its amino acid sequence and/or nucleic acid sequence encoding it.
- the antibody comprises the Fab or F(ab') 2 portion of NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9.
- an antibody comprises the three CDRs of the heavy chain variable region of NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9. Also provided is a polypeptide that further comprises one, two or three of the CDRs of the light chain variable region of NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9. Optionally any one or more of said light or heavy chain CDRs may contain one, two, three, four or five or more amino acid modifications (e.g. substitutions, insertions or deletions).
- a multispecific protein or antibody polypeptide where any of the light and/or heavy chain variable regions comprising part or all of an antigen binding region of antibody NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9 are fused to an immunoglobulin constant region of the human IgG type.
- the invention provides a protein, e.g., an antibody, a full length monospecific antibody, a multispecific or a bispecific protein, or a polypeptide chain or fragment thereof, or an NKp46-binding multispecific protein as well as a nucleic acid encoding any of the foregoing, wherein the protein comprises the heavy chain CDRs of NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9, comprising, for the respective antibody: a HCDR1 region comprising an amino acid sequence as set forth in Table A, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR2 region comprising an amino acid sequence as set forth in Table A, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a
- the invention provides a protein, e.g., an antibody, a full length monospecific antibody, a multispecific or a bispecific protein, or a polypeptide chain or fragment thereof, or an NKp46-binding multispecific protein as well as a nucleic acid encoding any of the foregoing, wherein the protein comprises light chain CDRs of NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9, comprising, for the respective antibody: a LCDR1 region comprising an amino acid sequence as set forth in Table A, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR2 region comprising an amino acid sequence as set forth in Table A, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid
- the invention provides a multispecific protein or antibody that binds to human NKp46, comprising:
- the heavy chain CDR 1 , 2 and 3 (HCDR1 , HCDR2) amino acid sequence of NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9 as shown in Table A, optionally wherein one, two, three or more amino acids in a CDR may be substituted by a different amino acid;
- the light chain CDR 1 , 2 and 3 (LCDR1 , LCDR2, LCDR3) amino acid sequence of NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 or NKp46-9 as shown in Table A, optionally wherein one, two, three or more amino acids in a CDR may be substituted by a different amino acid; or
- the aforementioned CDRs are according to Kabat, e.g. as shown in Table A. In one embodiment, the aforementioned CDRs are according to Chothia numbering, e.g. as shown in Table A. In one embodiment, the aforementioned CDRs are according to IMGT numbering, e.g. as shown in Table A.
- CDR3 of the heavy and light chains may be characterized by a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, and/or as having an amino acid sequence that shares at least 50%, 60%, 70%, 80%, 85%, 90% or 95% sequence identity with the particular CDR or set of CDRs listed in the corresponding SEQ ID NO or Table A.
- the invention provides an antibody that competes for NKp46 binding with a monoclonal antibody according to (a) to (f), above.
- the invention provides a bispecific antibody comprising an antibody that binds human NKp46 according to (a) to (f), above, or an antibody that competes for binding to NKp46 with any of such antibodies, fused (optionally via intervening amino acid sequences) to a monomeric Fc domain, optionally further fused (optionally via intervening amino acid sequences) to a second antigen binding domain (e.g. a scFv, a V H domain, a V L domain, a dAb, a V-NAR domain or a V H H domain).
- a second antigen binding domain e.g. a scFv, a V H domain, a V L domain, a dAb, a V-NAR domain or a V H H domain.
- the second antigen binding domain will bind a cancer antigen, a viral antigen, a parasitic antigen or a bacterial antigen.
- V L or V H sequence can be specified or numbered so as to contain or lack a signal peptide or any part thereof.
- NKp46-1 Kabat 15 DYVIN 18 EIYPGSGTNYYNEKFKA 21 RGRYGLYAMD
- NKp46-2 Kabat 31 SDYAWN 34 YITYSGSTSYNPSLES 36 GGYYGSSWGV
- NKp46-3 Kabat 46 EYTMH 49 GISPNIGGTSYNQKFKG 51 RGGSFDY
- NKp46-4 Kabat 60 SFTMH 63 YINPSSGYTEYNQKFKD 65 GSSRGFDY
- NKp46-9 Kabat 85 SDYAWN 88 YITYSGSTNYNPSLKS 89 CWDYALYAMD
- NKp46-1 Kabat 24 RASQDISNYLN 27 YTSRLHS 28 QQGNTRPWT
- NKp46-2 Kabat 39 RVSENIYSYLA 42 NAKTLAE 43 QHHYGTPWT
- NKp46-9 Kabat 92 RTSENIYSYLA 93 NAKTLAE 94 QHHYDTPLT
- NKp46-1 VL 4 DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKL LIYYTSRLHSGVPSRFSGSGSGTDYSLTINNLEQEDIATYFCQQGNT
- NKp46-2 VH 5 EVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKL
- NKp46-6 VH 1 1 QVQLQQPGSVLVRPGASVKLSCKASGYTFTSSWMHWAKQRPGQ
- NKp46-6 VL 12 DIQMTQSPSSLSASLGERVSLTCRASQDIGSSLNWLQQEPDGTIKR
- NKp46-9 VH 13 DVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKL
- a multispecific protein or antibody comprising the amino acid sequences of monomeric bispecific polypeptides which respectively comprise an scFv comprising the heavy and light chain CDR1 , 2 and 3 of the respective heavy and light chain variable region listed as SEQ ID NOS: 3-14 of antibodies NKp46-1 , NKp46-2, NKp46-3, NKp46-4, NKp46-6 and NKp46-9, a monomeric Fc domain, and an scFv comprising the heavy and light chain CDR1 , 2 and 3 of the heavy and light chain variable region of an anti-CD19 antibody, e.g. any of the anti-CD19 antibodies described in the Examples herein.
- the multispecific protein can be assessed for biological activity, e.g., antigen binding, ability to elicit target cell lysis and/or specific signaling activities elicited thereby.
- biological activity e.g., antigen binding, ability to elicit target cell lysis and/or specific signaling activities elicited thereby.
- the inventive multispecific protein is capable of inducing activation of an NKp46-expressing cell (e.g. an NK cell, a reporter cell) when the protein is incubated in the presence of the NKp46-expressing cell (e.g. purified NK cells) and a target cell that expresses the antigen of interest).
- an NKp46-expressing cell e.g. an NK cell, a reporter cell
- the protein is incubated in the presence of the NKp46-expressing cell (e.g. purified NK cells) and a target cell that expresses the antigen of interest).
- the inventive multispecific protein is capable of inducing an increase of CD137 present on the cell surface of an NKp46- and/or a CD16-expressing cell (e.g. an NK cell, a reporter cell) when the protein is incubated in the presence of the NKp46- and/or a CD16-expressing cell (e.g. purified NK cells), optionally in the absence of target cells.
- a CD16-expressing cell e.g. an NK cell, a reporter cell
- the inventive multispecific protein is capable of inducing NKp46 signaling in an NKp46-expressing cell (e.g. an NK cell, a reporter cell) when the protein is incubated in the presence of an NKp46-expressing cell (e.g. purified NK cells) and a target cell that expresses the antigen of interest).
- an NKp46-expressing cell e.g. an NK cell, a reporter cell
- an NKp46-expressing cell e.g. purified NK cells
- a target cell that expresses the antigen of interest e.g. purified NK cells
- NK cell activation or signaling in characterized by the increased expression of a cell surface marker of activation, e.g. CD107, CD69, Sca-1 or Ly-6A/E, KLRG1 , etc.
- a cell surface marker of activation e.g. CD107, CD69, Sca-1 or Ly-6A/E, KLRG1 , etc.
- Activity can be measured for example by bringing target cells and NKp46-expressing cells into contact with one another, in presence of the multispecific polypeptide.
- the aggregation of target cells and NK cells is measured.
- the multispecific protein may, for example, be assessed for the ability to cause a measurable increase in any property or activity known in the art as associated with NK cell activity, respectively, such as marker of cytotoxicity (CD107) or cytokine production (for example IFN- ⁇ or TNF-a), increases in intracellular free calcium levels, the ability to lyse target cells in a redirected killing assay, etc.
- the multispecific protein will be capable of causing an increase in a property or activity associated with NK cell activity (e.g. activation of NK cell cytotoxicity, CD107 expression, IFNy production) in vitro.
- a multispecific protein according to the invention can be selected based on its ability to increase an NK cell activity by more than about 20%, preferably by least about 30%, at least about 40%, at least about 50%, or more compared to that achieved with the same effector: target cell ratio with the same NK cells and target cells that are not brought into contact with the multispecific protein, as measured by an assay that detects NK cell activity, e.g., an assay which detects the expression of an NK activation marker or which detects NK cell cytotoxicity, e.g., an assay that detects CD107 or CD69 expression, IFNy production, or a classical in vitro chromium release test of cytotoxicity.
- an assay that detects NK cell activity e.g., an assay which detects the expression of an NK activation marker or which detects NK cell cytotoxicity, e.g., an assay that detects CD107 or CD69 expression, IFNy production, or a classical in vitro chromium release test of
- a multispecific protein according to the invention can be selected for or characterized by its ability to have greater ability to induce NK cell activity towards target cells, i.e., lysis of target cells compared to a conventional human lgG1 antibody that binds to the same antigen of interest, as measured by an assay of NK cell activity (e.g. an assay that detects NK cell- mediated lysis of target cells that express the antigen of interest).
- a multispecific protein according to the invention which possesses an Fc domain that does not bind CD16, does not, substantially induce NKp46 signaling (and/or NK activation that results therefrom) of NK cells when the protein is not bound to the antigen of interest on target cells (e.g. in the absence of the antigen of interest and/or target cells).
- the monovalent NKp46 binding component of the multispecific protein does not itself cause NKp46 signalling.
- such multispecific protein can be assessed for its ability to elicit NKp46 signaling or NKp46-mediated NK cell activation by testing the effect of this multispecific protein on NKp46 expression, by CD16-negative NK cells.
- the multispecific protein can optionally be characterized as not substantially causing (or increasing) NKp46 signaling by an NKp46-expressing, CD16-negative cell (e.g. a NKp46 + CD16 " NK cell, a reporter cell) when the multispecific protein is incubated with such NKp46-expressing, CD16- negative cells (e.g., purified NK cells or purified reporter cells) in the absence of target cells.
- a multispecific protein described herein that binds CD16 can for example be characterized by:
- NKp46 lack of agonist activity at NKp46 when incubated with CD16-negative NK cells, e.g. NKp46-expressing NK cells that do not express CD16, in the absence of target cells.
- the NK cells are purified NK cells.
- a multispecific protein described herein can for example be characterized by:
- NKp46 lack of agonist activity at NKp46 (e.g. when incubated with CD16-negative NK cells, for example CD16-NKp46+ NK cells, or when incubated with NK cells and where in the protein comprises (e.g. by modification) an Fc domain that lacks binding to CD16) in the absence of target cells.
- the NK cells are purified NK cells.
- any of the compounds defined herein particularly the inventive multispecific proteins or antibodies and/or cells which express same for the manufacture of a pharmaceutical preparation for the treatment, prevention or diagnosis of a disease in a mammal in need thereof.
- the invention provides methods for preparing a pharmaceutical composition containing a compound as defined herein, to provide a solid or a liquid formulation for administration orally, topically, or by injection. Such a method or process at least comprises the step of mixing the compound with a pharmaceutically acceptable carrier.
- a method to treat, prevent or more generally affect a predefined condition in an individual or to detect a certain condition by using or administering a multispecific protein or antibody described herein, or a (pharmaceutical) composition comprising same.
- the invention provides a method of restoring or potentiating the activity of NKp46 + NK cells (e.g. NKp46 + CD16 + NK cells) in a patient in need thereof (e.g. a patient having a cancer, or a viral or bacterial infection), comprising the step of administering a multispecific protein described herein to said patient.
- the method is directed at increasing the activity of NKp46 + lymphocytes (e.g. NKp46 + CD16 + NK cells) in patients having a disease in which increased lymphocyte (e.g. NK cell) activity is beneficial or which is caused or characterized by insufficient NK cell activity, such as a cancer, or a viral or microbial/bacterial infection.
- the invention provides a method of restoring or potentiating the activity of NKp46 + NK cells (e.g. NKp46 + CD16 + NK cells) in a patient in need thereof (e.g. a patient having a cancer, or a viral, parasite or bacterial infection), comprising the step of contacting cells derived from the patient, e.g., immune cells and optionally target cells expressing an antigen of interest with a multispecific protein according to the invention and reinfusing the multispecific protein treated cells into the patient.
- this method is directed at increasing the activity of NKp46+ lymphocytes (e.g. NKp46 + CD16 + NK cells) in patients having a disease in which increased lymphocyte (e.g. NK cell) activity is beneficial or which is caused or characterized by insufficient NK cell activity, such as a cancer, or a viral or microbial, e.g., bacterial or parasite infection.
- the subject multispecific proteins may be used or administered in combination with immune cells, particularly NK cells, derived from a patient who is to be treated or from a different donor, and these NK cells administered to a patient in need thereof such as a patient having a disease in which increased lymphocyte (e.g. NK cell) activity is beneficial or which is caused or characterized by insufficient NK cell activity, such as a cancer, or a viral or microbial, e.g., bacterial or parasite infection.
- immune cells particularly NK cells, derived from a patient who is to be treated or from a different donor
- these NK cells administered to a patient in need thereof such as a patient having a disease in which increased lymphocyte (e.g. NK cell) activity is beneficial or which is caused or characterized by insufficient NK cell activity, such as a cancer, or a viral or microbial, e.g., bacterial or parasite infection.
- NK cells unlike CAR-T cells
- TCRs TCRs
- these NK cells even those derived from different donors will not induce a GVHD reaction (see e.g., Glienke et al., "Advantages and applications of CAR-expressing natural killer cells", Front. Pharmacol. 6, Art. 21 :1 -6 (2015); Hermanson and Kaufman, Front. Immunol. 6, Art. 195:1 -6 (2015))
- the multispecific protein disclosed herein that mediates NK cell activation and/or target cell lysis via multiple activating receptors of effector cells can be used advantageously for treatment of individuals whose effector cells (e.g. NKp46 + CD16 + NK cells) cells are hypoactive, exhausted or suppressed, for example a patient who has a significant population of effector cells characterized by the expression and/or upregulation of one or multiple inhibitory receptors (e.g. TIM-3, PD1 , CD96, TIGIT, etc.).
- a patient who has a significant population of effector cells characterized by the expression and/or upregulation of one or multiple inhibitory receptors (e.g. TIM-3, PD1 , CD96, TIGIT, etc.).
- the multispecific polypeptides described herein can be used to prevent or treat disorders that can be treated with antibodies, such as cancers, solid and non-solid tumors, hematological malignancies, infections such as viral infections, and inflammatory or autoimmune disorders.
- the antigen of interest is an antigen expressed on the surface of a malignant cell of a type of cancer selected from the group consisting of: carcinoma, including that of the bladder, head and neck, breast, colon, kidney, liver, lung, ovary, prostate, pancreas, stomach, cervix, thyroid and skin, including squamous cell carcinoma; hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma, hairy cell lymphoma and Burkett's lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma
- the inventive multispecific polypeptides described herein can be used to prevent or treat a cancer selected from the group consisting of: carcinoma, including that of the bladder, head and neck, breast, colon, kidney, liver, lung, ovary, prostate, pancreas, stomach, cervix, thyroid and skin, including squamous cell carcinoma; hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma, hairy cell lymphoma and Burkett's lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyosarcoma; other tumor
- T-cell disorders such as T-prolymphocytic leukemia (T-PLL), including of the small cell and cerebriform cell type; large granular lymphocyte leukemia (LGL) preferably of the T-cell type; Sezary syndrome (SS); Adult T-cell leukemia lymphoma (ATLL); a/d T-NHL hepatosplenic lymphoma; peripheral/post-thymic T cell lymphoma (pleomorphic and immunoblastic subtypes); angio immunoblastic T-cell lymphoma; angiocentric (nasal) T-cell lymphoma; anaplastic (Ki 1 +) large cell lymphoma; intestinal T-cell lymphoma; T-lymphoblastic; and lymphoma/leukaemia (T-Lbly/T-ALL
- the tumor antigen is an antigen expressed on the surface of a lymphoma cell or a leukemia cell, and the multispecific protein is administered to, and/or used for the treatment of, an individual having a lymphoma or a leukemia.
- the tumor antigen is selected from CD19, CD20, CD22, CD30 or CD33.
- the methods of treatment comprise administering to an individual a multispecific protein described herein in a therapeutically effective amount, e.g., for the treatment of a disease as disclosed herein, for example any of the cancers identified above.
- a therapeutically effective amount may be any amount that has a therapeutic effect in a patient having a disease or disorder (or promotes, enhances, and/or induces such an effect in at least a substantial proportion of patients with the disease or disorder and substantially similar characteristics as the patient).
- a multispecific protein according to the invention is used to treat a cancer that is responsive to CD137 activation, e.g. a solid tumor or a hematological cancer, including but not limited to breast cancer, sarcoma, glioma, colon carcinoma, myeloma, mastocytoma, melanoma, renal carcinoma, and ovarian cancer.
- the multispecific protein according to the invention is used to treat a CD137L- expressing cancer. As shown herein, the strong efficacy in inducing tumor cell lysis of the multispecific protein is hypothesized to in part mediated by the upregulation of CD137 (4- 1 BB) on the surface of NK cells.
- the co-activating CD137 protein can bind and recognize CD137 ligand (CD137L, 4-1 BBL) on tumor cells, resulting in enhanced NK cell activation and cytotoxicity of CD137L-expressing cells.
- CD137L has been found to be expressed on a variety of tumors, and is more commonly expressed by malignant tumors, especially in moderate or low-differentiated tumors (see, e.g., Vinay et al., (2012) Mol. Cancer Ther. 1 1 (5):1062-1070).
- CD137L-expressing cancers include, for example, lung squamous cell carcinoma, nasal cavity squamous cell carcinoma, esophageal squamous cell carcinoma, cervical squamous cell carcinoma, colonic adenocarcinoma, rectal adenocarcinoma, gallbladder adenocarcinoma, pancreatic adenocarcinoma and breast adenocarcinoma.
- the multispecific protein according to the invention may be used with our without a prior step of detecting the expression of the antigen of interest on target cells in a biological sample obtained from an individual (e.g. a biological sample comprising cancer cells, cancer tissue or cancer-adjacent tissue).
- a biological sample obtained from an individual (e.g. a biological sample comprising cancer cells, cancer tissue or cancer-adjacent tissue).
- the disclosure provides a method for the treatment or prevention of a cancer in an individual in need thereof, the method comprising:
- detecting cells e.g. tumor cells
- a sample from the individual that express an antigen of interest e.g. tumor cells
- the antigen of interest is a cancer antigen (e.g. a cancer antigen disclosed herein), optionally a cancer antigen known to be capable of undergoing intracellular internalization when contacted with a full length human lgG1 antibody that binds specifically thereto.
- the invention provides a method for the treatment or prevention of a cancer in an individual in need thereof, the method comprising:
- detecting cells e.g. tumor cells
- CD137L CD137 ligand
- the cancer antigen is a cancer antigen disclosed herein), optionally a cancer antigen known to be capable of undergoing intracellular internalization when contacted with a full length human lgG1 antibody that binds specifically thereto.
- the disclosure provides a method for the treatment or prevention of a disease (e.g. a cancer) in an individual in need thereof, the method comprising:
- immune effector cells e.g. NK cells, T cells
- the cancer antigen is a cancer antigen disclosed herein), optionally a cancer antigen known to be capable of undergoing intracellular internalization when contacted with a full length human lgG1 antibody that binds specifically thereto.
- a multispecific protein according to the invention may be used as a monotherapy (without other therapeutic agents), or in combined treatments with one or more other therapeutic agents, including agents normally utilized for the particular therapeutic purpose for which the antibody is being administered.
- the additional therapeutic agent or agents will normally be administered in amounts and treatment regimens typically used for that agent in a monotherapy for the particular disease or condition being treated.
- Such therapeutic agents when used in the treatment of cancer include, but are not limited to anti-cancer agents and chemotherapeutic agents; in the treatment of infectious disease, include, but are not limited to anti-viral agents and antibiotics.
- Such other therapeutic agents may further include other immunomodulatory polypeptides such as Ig-fusion proteins, antibodies, cytokines and the like.
- the administration of the multispecific protein according to the invention and the other therapeutic agent may elicit an additive or synergistic effect on immunity and/or on therapeutic efficacy.
- kits may optionally further contain any number of polypeptides and/or other compounds, e.g., 1 , 2, 3, 4, or any other number of multispecific proteins according to the invention and/or other compounds. It will be appreciated that this description of the contents of the kits is not limiting in any way.
- the kit may contain other types of therapeutic compounds.
- the kits also include instructions for using the polypeptides, e.g., detailing the herein-described methods such as in the detection or treatment of specific disease conditions.
- the invention also provides pharmaceutical compositions comprising the subject multispecific proteins and optionally other compounds as defined above.
- a multispecific protein and optionally another compound may be administered in purified form together with a pharmaceutical carrier as a pharmaceutical composition.
- the form depends on the intended mode of administration and therapeutic or diagnostic application.
- the pharmaceutical carrier can be any compatible, nontoxic substance suitable to deliver the compounds to the patient.
- Pharmaceutically acceptable carriers include, for example, aqueous solutions such as (sterile) water or physiologically buffered saline or other solvents or vehicles such as glycols, glycerol, oils such as olive oil or injectable organic esters, alcohol, fats, waxes, and inert solids
- a pharmaceutically acceptable carrier may further contain physiologically acceptable compounds that act for example to stabilize or to increase the absorption of the compounds
- physiologically acceptable compounds include, for example, carbohydrates, such as glucose, sucrose or dextrans, antioxidants, such as ascorbic acid or glutathione, chelating agents, low molecular weight proteins or other stabilizers or excipients
- a pharmaceutically acceptable carrier including a physiologically acceptable compound, depends, for example, on the route of administration of the composition
- Pharmaceutically acceptable adjuvants, buffering agents, dispersing agents, and the like may also be incorporated into the pharmaceutical compositions.
- Non-limiting examples of such adjuvants include by way of example inorganic and organic adjuvants such as alum, aluminum phosphate and aluminum hydroxide, squalene, liposomes, lipopolysaccharides, double stranded (ds) RNAs, single stranded(s-s) DNAs, and TLR agonists such as unmethylated CpG's.
- inorganic and organic adjuvants such as alum, aluminum phosphate and aluminum hydroxide, squalene, liposomes, lipopolysaccharides, double stranded (ds) RNAs, single stranded(s-s) DNAs, and TLR agonists such as unmethylated CpG's.
- Multispecific proteins according to the invention can be administered parenterally.
- Preparations of the compounds for parenteral administration must be sterile. Sterilization is readily accomplished by filtration through sterile filtration membranes, optionally prior to or following lyophilization and reconstitution.
- the parenteral route for administration of compounds is in accord with known methods, e.g. injection or infusion by intravenous, intraperitoneal, intramuscular, intraarterial, or intralesional routes.
- the compounds may be administered continuously by infusion or by bolus injection.
- a typical composition for intravenous infusion could be made up to contain 100 to 500 ml of sterile 0.9% NaCI or 5% glucose optionally supplemented with a 20% albumin solution and 1 mg to 10 g of the compound, depending on the particular type of compound and its required dosing regimen.
- Methods for preparing parenterally administrable compositions are well known in the art.
- mice were immunized with a recombinant human NKp46 extracellular domain recombinant-Fc protein comprising the extracellular domain of the protein of SEQ ID NO: 1 .
- Mice received one primo-immunization with an emulsion of 50 ⁇ g NKp46 protein and Complete Freund Adjuvant, intraperitoneally, a 2nd immunization with an emulsion of 50 ⁇ g NKp46 protein and Incomplete Freund Adjuvant, intraperitoneally, and finally a boost with 10 ⁇ g NKp46 protein, intravenously.
- Immune spleen cells were fused 3 days after the boost with X63.Ag8.653 immortalized B cells, and cultured in the presence of irradiated spleen cells.
- SN Supernatant of growing clones were tested in a primary screen by flow cytometry using a cell line expressing the human NKp46 construct at the cell surface. Briefly, for FACS screening, the presence of reactive antibodies in supernatants was revealed by Goat anti-mouse polyclonal antibody (pAb) labeled with PE.
- pAb Goat anti-mouse polyclonal antibody
- a panel of antibodies that bound NKp46 was selected, produced and their variable regions sequenced and these antibodies and derivatives thereof further evaluated for their activity in the context of a bispecific molecule.
- bispecific proteins should bind to NKp46 monovalently via its anti-NKp46 binding domain.
- the monomeric Fc domain should retain at least partial binding to the human neonatal Fc receptor (FcRn), yet not substantially bind human CD16 and/or other human Fey receptors. Consequently, such bispecific proteins should not induce Fcy-mediated (e.g. CD16-mediated) target cell lysis.
- Example 2-1 Construction and binding analysis of Anti-CD19-lgG1 -Fcmono-Anti-CD3 Since no anti-NKp46 bispecific antibody has been produced that could indicate whether such a protein could be functional, CD3 was used as a model antigen in place of NKp46 in order to investigate the possible functionality of a new monovalent bispecific protein format prior to targeting NK cells via NKp46.
- a bispecific Fc-based on a scFv specific for tumor antigen CD19 (anti-CD19 scFv) and a scFv specific for activating receptor CD3 on a T cell (anti-CD3 scFv) was used to assess FcRn binding and CD19-binding functions of a new monomeric bispecific polypeptide format.
- the domain arrangement of the final polypeptide is referred to as the "F1 " format (the star in the CH2 domain indicates an optional N297S mutation, not included in the polypeptide tested here). (See Figure 2)
- a bispecific monomeric Fc-containing polypeptide was constructed based on a scFv specific for the tumor antigen CD19 (anti-CD19 scFv) and a scFv specific for an activating receptor CD3 on a T cell (anti-CD3 scFv).
- the CH3 domain incorporated the mutations (EU numbering) L351 K, T366S, P395V, F405R, T407A and K409Y.
- the polypeptide has domains arranged as follows: anti-CD19-CH2-CH3-anti-CD3.
- a DNA sequence coding for a CH3A H linker peptide having the amino acid sequence STGS was also designed in order to insert a specific Sail restriction site at the CH3-VH junction.
- This CH3 domain incorporated the mutations (EU numbering) L351 K, T366S, P395V, F405R, T407A and K409Y.
- the selected CH2 domain was a wild-type CH2.
- DNA and amino acid sequences for the monomeric CH2-CH3 Fc portion and the anti-CD19 are shown below.
- the light chain and heavy chain DNA and amino acid sequences corresponding to the anti-CD19 scFv were as follows:
- Anti-CD19-V H amino acid 1 16 The DNA sequences for the monomeric CH2-CH3 Fc portion and final bispecific lgG1 -Fcmono polypeptide (the last K was removed in that construct) is shown in SEQ ID NO: 1 17. The amino acid sequence encoded thereby is shown in SEQ ID NO: 2. The Anti- CD19-F1 -Anti-CD3 complete sequence (mature protein) is shown in SEQ ID NO: 1 18.
- Coding sequences were generated by direct synthesis and/or by PCR. PCR was performed using the PrimeSTAR MAX DNA polymerase (Takara, #R045A) and PCR products were purified from 1 % agarose gel using the NucleoSpin gel and PCR clean-up kit (Macherey-Nagel, #740609.250). Once purified the PCR products were quantified prior to the In-Fusion ligation reaction which was performed as described in the manufacturer's protocol (ClonTech, #ST0345). The plasmids were obtained after a miniprep preparation run on an EVO200 (Tecan) using the Nucleospin 96 plasmid kit (Macherey-Nagel, #740625.4). Plasmids were then sequenced for sequence confirmation before to transfecting the CHO cell line.
- CHO cells were grown in the CD-CHO medium (Invitrogen) complemented with phenol red and 6 mM GlutaMax. The day before the transfection, cells were counted and seeded at 175,000 cells/ml.
- cells (200.000 cells/transfection) were prepared as described in the AMAXA SF cell line kit (AMAXA, #V4XC-2032) and nucleofected using the DS137 protocol with the Nucleofector 4D device. All the transfections were performed using 300 ng of verified plasmids. After transfection, cells were seeded into 24 well plates in pre-warmed culture medium. After 24 hours, hygromycin B was added in the culture medium (200 g/ml).
- Protein expression was monitored after one week in culture. Cells expressing the proteins were then sub-cloned to obtain the best producers. Sub- cloning was performed using 96 flat-bottom well plates in which the cells are seeded at one cell per well into 200 ⁇ of culture medium complemented with 200 ⁇ g ml of hygromycin B. Cells were left for three weeks before testing the clone's productivity.
- Recombinant proteins which contain an lgG1-Fc fragment were purified using Protein-A beads (rProteinA Sepharose fast flow, GE Healthcare). Briefly, cell culture supernatants were concentrated, clarified by centrifugation and injected onto Protein-A columns to capture the recombinant Fc containing proteins. Proteins were eluted at acidic pH (citric acid 0.1 M pH 3), and the eluate immediately neutralized using TRIS-HCL pH 8.5 and dialyzed against 1 X PBS. Recombinant scFvs which contain a "six his" tag were purified by affinity chromatography using Cobalt resin. Other recombinant scFvs were purified by size exclusion chromatography (SEC).
- SEC size exclusion chromatography
- CD3 and CD19 expression were also controlled by flow cytometry: Cells were harvested and stained in PBS1 X / BSA 0.2% / EDTA 2mM buffer during 30 min at 4°C using 5 ⁇ of the anti-CD3-APC and 5 ⁇ of the anti-CD19-FITC antibodies. After two washes, stainings were conducted on a BD FACS Canto II and analyzed using the FlowJo software.
- T- and B- cell aggregation by purified Anti-CD19-F1-Anti-CD3 Purified Anti-CD19-F1 -Anti-CD3 was tested in a T/B cell aggregation assay to evaluate whether the antibody promotes the aggregation of CD19 and CD3 expressing cells.
- CD19-F1 -Anti-CD3 does not cause aggregation in the presence of B221 (CD19) or JURKAT (CD3) cell lines, but it does cause aggregation of cells when both B221 and JURKAT cells are co-incubated, indicating that the bispecific antibody is functional.
- the lower panel shows the results of the control experiment conducted without antibody.
- FcRn proteins were immobilized covalently to carboxyl groups in the dextran layer on a Sensor Chip CM5.
- the chip surface was activated with EDC/NHS (N- ethyl-N'-(3-dimethylaminopropyl) carbodiimidehydrochloride and N-hydroxysuccinimide (Biacore GE Healthcare)).
- FcRn proteins were diluted to 10 ⁇ g ml in coupling buffer (10 mM acetate, pH 5.6) and injected until the appropriate immobilization level was reached (i.e. 2500 RU). Deactivation of the remaining activated groups was performed using 100 mM ethanolamine pH 8 (Biacore GE Healthcare).
- Anti-CD19-F1 -Anti-CD3 having its CH2-CH3 domains placed between two antigen binding domains, particularly two scFvs, was evaluated to assess whether such bispecific monomeric Fc protein could retain binding to FcRn and possess an improved in vivo half-life compared to conventional bispecific antibodies.
- the results of these experiments showed that FcRn binding was retained, the model suggesting a 1 :1 ratio (1 FcRn for each monomeric Fc) instead of a 2:1 ratio (2 FcRn for each antibody) for a regular or wild-type IgG.
- a new bispecific protein format was developed as a single chain protein which binds to FcRn but not FcyR. Additionally, multimeric proteins that comprise two or three polypeptide chains, wherein the Fc domain remains monomeric, were developed that are compatible for use with antibody variable regions that do not maintain binding to their target when converted to scFv format.
- the latter formats can be used conveniently for antibody screening; by incorporating at least one binding region as a F(ab) structure, any anti-target (e.g. anti-tumor) antibody variable region can be directly expressed in a bispecific construct as the F(ab) format within the bispecific protein and tested, irrespective of whether the antibody would retain binding as an scFv, thereby simplifying screening and enhancing the number of antibodies available.
- These formats in which the Fc domain remains monomeric have the advantage of maintaining maximum conformational flexibility and as shown infra may permit optimal binding to NKp46 or target antigens.
- variable domains from the scFv specific for tumor antigen CD19 described in Example 2-1 were also made using different variable regions from antibodies specific for the NKp46 receptor identified in Example 1 .
- a construct was also made using as the anti-NKp46 the variable regions from a commercially available antibody Bab281 (mlgG1 , available commercially from Beckman Coulter, Inc. (Brea, CA, USA) (see also Pessino et al, J. Exp. Med, 1998, 188 (5): 953-960 and Sivori et al, Eur J Immunol, 1999. 29:1656-1666) specific for the NKp46 receptor.
- Bab281 mlgG1 , available commercially from Beckman Coulter, Inc. (Brea, CA, USA)
- CH3-CH3 dimerization was prevented through two different strategies: (1 ) through the use of CH3 domain incorporating specific mutations (EU numbering), i.e., L351 K, T366S, P395V, F405R, T407A and K409Y; or (2) through the use of a tandem CH3 domain in which the tandem CH3 domains are separated by a flexible linker associated with one another, which prevents interchain CH3-CH3 dimerization.
- EU numbering i.e., L351 K, T366S, P395V, F405R, T407A and K409Y
- tandem CH3 domain in which the tandem CH3 domains are separated by a flexible linker associated with one another, which prevents interchain CH3-CH3 dimerization.
- the DNA and amino acid sequences for the monomeric CH2-CH3 Fc portion containing the above-identified point mutations were the same as in Example 2-1 .
- Example 2-1 The light chain and heavy chain DNA and amino acid sequences for the anti-CD19 scFv were also the same as in Example 2-1 . Proteins were cloned, produced and purified as in Example 2-1. Shown below are the light chain and heavy chain DNA and amino acid sequences for different anti-NKp46 scFvs. Table 1 : Amino acid sequences of different anti-NKp46 scFvs
- Table 2A DNA sequences corresponding to different anti-NKp46 scFvs NKp46
- NKp46-2 SEQ ID NO: 127
- the domain structure of Format 1 is shown in Figure 2A.
- a bispecific Fc- containing polypeptide was constructed based on a scFv specific for the tumor antigen CD19 (anti-CD19 scFv) and an scFV specific for the NKp46 receptor.
- the polypeptide is a single chain polypeptide having domains arranged (N- to C- termini) as follows:
- a DNA sequence coding for a CH3A H linker peptide having the amino acid sequence STGS was designed in order to insert a specific Sail restriction site at the CH3-V H junction.
- the domain arrangement of the final polypeptide in shown in Figure 2 (the star in the CH2 domain indicates an optional N297S mutation), where the anti-CD3 scFv is replaced by an anti-NKp46 scFv.
- the (VK-V h ) units include a linker between the V H and VK domains. Proteins were cloned, produced and purified as in Example 2-1 .
- the amino acid sequences of the bispecific polypeptides are shown in the corresponding SEQ ID NOS listed in the Table 2B below.
- CD19-F1 -Bab281 139 Format 2 (F2) : CD19-F2-NKp46-3
- the domain structure of F2 polypeptides is shown in Figure 2A.
- the DNA and amino acid sequences for the monomeric CH2-CH3 Fc portion were as in Example 2-1 and it similarly contains CH3 domain mutations (the mutations (EU numbering) L351 K, T366S, P395V, F405R, T407A and K409Y.
- the heterodimer is made up of:
- the (VK-VH) unit was made up of a V H domain, a linker and a Vioinit (i.e. an scFv).
- a Vioinit i.e. an scFv.
- CH3A H linker peptide having the amino acid sequence STGS designed in order to insert a specific Sail restriction site at the CH3-VH junction. Proteins were cloned, produced and purified as in Example 2-1 . The amino acid sequences for the first and second chains of the
- F2 protein are shown in SEQ ID NO: 140 and 141.
- the domain structure of F3 polypeptides is shown in Figure 2A.
- the DNA and amino acid sequences for the CH2-CH3 Fc portion comprised a tandem CH3 domain in which the two CH3 domains on the same polypeptide chain associated with one another, thereby preventing dimerization between different bispecific proteins.
- the single chain polypeptide has domains arranged (N- to C- termini) as follows: (VK-V H ) ANTI"CD19 - CH2 - CH3 - CH3 - (V H -V K ) ANTI - NK 46
- the (VK-VH) units were made up of a V H domain, a linker and a VK unit (scFv).
- Proteins were cloned, produced and purified as in Example 2-1. Bispecific protein was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 3.4 mg/L and the purified proteins exhibited a simple SEC profile.
- the amino acid sequence for the F3 protein is shown in SEQ ID NO: 142.
- the domain structure of F4 polypeptides is shown in Figure 2A.
- the DNA and amino acid sequences for the CH2-CH3 Fc portion comprised a tandem CH3 domain as in Format F3, and additionally comprise a N297S mutation which prevents N-linked glycosylation and abolishes FcyR binding.
- Proteins were cloned, produced and purified as in Example 2-1 .
- Bispecific proteins was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a good production yield of 1 mg/L and the purified proteins exhibited a simple SEC profile.
- the amino acid sequence for the F4 protein with NKp46-3 variable domains is shown in SEQ ID NO: 143.
- the domain structure of F8 polypeptides is shown in Figure 2B.
- the DNA and amino acid sequences for the monomeric CH2-CH3 Fc portion were as in Format F2 and it similarly contains CH3 domain mutations (the mutations (EU numbering) L351 K, T366S, P395V, F405R, T407A and K409Y, as well as a N297S mutation which prevents N-linked glycosylation and moreover abolishes FcyR binding.
- F8 proteins Three variants of F8 proteins were produced: (a) one wherein the cysteine residues in the hinge region were left intact (wild- type, referred to as F8A), (b) a second wherein the cysteine residues in the hinge region were replaced by serine residues (F8B), and (c) a third including a linker sequence GGGSS replacing residues DKTHTCPPCP in the hinge (F8C).
- F8A cysteine residues in the hinge region were left intact (wild- type, referred to as F8A)
- F8B cysteine residues in the hinge region were replaced by serine residues
- F8C a third including a linker sequence GGGSS replacing residues DKTHTCPPCP in the hinge
- Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 3.7 mg/L (F8C) and the purified proteins again exhibited a simple SEC profile.
- the amino acid sequences of the three chains of the F8 protein (C variant) with NKp46-3 variable regions are shown in SEQ ID NOS: 144, 145 and 146.
- the F9 polypeptide is a trimeric polypeptide having a central polypeptide chain and two polypeptide chains each of which associate with the central chain via CH1 -CK dimerization.
- the domain structure of the trimeric F9 protein is shown in Figure 2B, wherein the bonds between the CH1 and CK domains are interchain disulfide bonds.
- the two antigen binding domains have a F(ab) structure permitting the use of these antibodies irrespective of whether they remain functional in a scFv format.
- the DNA and amino acid sequences for the CH2-CH3 Fc portion comprise a tandem CH3 domain as in Format F4 and comprise a CH2 domain comprising a N297S substitution.
- F9A cysteine residues in the hinge region left intact (wild-type, referred to as F9A)
- F9B cysteine residues in the hinge region were replaced by serine residues
- F9C a linker sequence GGGSS which replaces residues DKTHTCPPCP in the hinge
- Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 8.7 mg/L (F9A) and 3.0 mg/L (F9B), and the purified proteins again exhibited a simple SEC profile.
- the amino acid sequences of the three chains of the F9 protein variant F9A are shown in the SEQ ID NOS: 147, 148 and 149.
- the amino acid sequences of the three chains of the F9 protein variant F9B are shown in the SEQ ID NOS: 150, 151 and 152.
- the amino acid sequences of the three chains of the F9 protein variant F9C are shown in the SEQ ID NOS: 153, 154 and 155.
- the F10 polypeptide is a dimeric protein having a central polypeptide chain and a second polypeptide chain which associates with the central chain via CH1 -CK dimerization.
- the domain structure of the dimeric F10 protein is shown in Figure 2B wherein the bonds between the CH1 and CK domains are interchain disulfide bonds.
- One of the two antigen binding domains has a Fab structure, and the other is a scFv.
- the DNA and amino acid sequences for the CH2-CH3 Fc portion comprise a tandem CH3 domain as shown in Format F4 and comprise a CH2 domain containing a N297S substitution.
- F10A cysteine residues in the hinge region were left intact (wild-type, referred to as F10A)
- F10B cysteine residues in the hinge region were replaced by serine residues
- F10C serine residues
- Variants F10B and F10C provided advantages in production as they avoid the formation of homodimers of the central chain.
- the (VK-V h ) unit was made up of a V H domain, a linker and a VK unit (scFv).
- the heterodimer is made up of:
- Example 2-1 Bispecific proteins was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC.
- the protein showed a good production yield of 2 mg/L (F10A) and the purified proteins again exhibited a simple SEC profile.
- the amino acid sequences of the two chains of the F10A protein variant are shown in SEQ ID NOS: 156 (second chain) and 157 (first chain).
- the amino acid sequences of the two chains of the F10B protein variant are shown in SEQ ID NOS: 158 (second chain) and 159 (first chain).
- the amino acid sequences of the two chains of the F10C protein variant are shown in the SEQ ID NOS: 160 (second chain) and 161 (first chain).
- the domain structure of F1 1 polypeptides is shown in Figure 2C.
- the heterodimeric protein is similar to F10 except that the structures of the antigen binding domains are reversed.
- One of the two antigen binding domains has a Fab-like structure, and the other is a scFv.
- the heterodimer is made up of :
- Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a good production yield of 2 mg/L and the purified proteins similarly exhibited a simple SEC profile.
- the amino acid sequences of the two chains of the F1 1 protein are shown in SEQ ID NO: 162 (chain 1 ) and SEQ ID NO: 163 (chain 2).
- the domain structure of the dimeric F12 polypeptides is shown in Figure 2C, wherein the bonds between the CH1 and CK domains are disulfide bonds.
- the heterodimeric protein is similar to F1 1 but the CH1 and CK domains within the F(ab) structure are inversed.
- the heterodimer is made up of:
- Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins were purified from the cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a good production yield of 2.8 mg/L and the purified proteins similarly exhibited a simple SEC profile.
- the amino acid sequences of the two chains of the F12 protein are shown in SEQ ID NO: 164 (chain 1 ) and SEQ ID NO: 165 (chain 2).
- the domain structure of the trimeric F17 polypeptides is shown in Figure 2C, wherein the bonds between the CH1 and CK domains are disulfide bonds.
- the heterodimeric protein is similar to F9 but the V H and VK domains, and the CH1 and CK, domains within the C-terminal F(ab) structure are each respectively inversed with their partner.
- the heterotrimer is made up of:
- F17A cysteine residues in the hinge region were left intact (wild-type, referred to as F17A), (b) a second wherein the cysteine residues in the hinge region were replaced by serine residues (F10B, and (c) a third containing a linker sequence GGGSS which replaces residues DKTHTCPPCP in the hinge (F17C).
- F17A cysteine residues in the hinge region were left intact (wild-type, referred to as F17A)
- F10B serine residues
- GGGSS linker sequence GGGSS which replaces residues DKTHTCPPCP in the hinge
- variable domain(s) a single variable domain that associates with a variable domain on a separated polypeptide chain, a tandem variable domain (e.g., an scFv), or a single variable domain that is capable of binding antigen as a single variable domain.
- the two chains associate by CH1-CK dimerization to form disulfide linked dimers, or if associated with a third chain, to form trimers.
- the domain structure of the trimeric F5 polypeptide is shown in Figure 2D, wherein the interchain bonds between hinge domains (indicated in the figures between CH1/CK and CH2 domains on a chain) and interchain bonds between the CH1 and CK domains are interchain disulfide bonds.
- the heterotrimer is made up of:
- Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 37 mg/L and the purified proteins again exhibited a simple SEC profile.
- the amino acid sequences of the three polypeptide chains are shown in SEQ ID NOS 169 (second chain), 170 (first chain) and 171 (third chain).
- F6 protein is the same as F5, but contains a N297S substitution to avoid N-linked glycosylation. Proteins were cloned, produced and purified as in Example 2-1 . Bispecific proteins were purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 12 mg/L and the purified proteins exhibited a simple SEC profile. The amino acid sequences of the three polypeptide chains are shown in SEQ ID NOS: 172 (second chain), 173 (first chain) and 174 (third chain).
- the domain structure of heterotrimeric F7 polypeptides is shown in Figure 2D.
- the F7 protein is the same as F6, except for cysteine to serine substitutions in the CH1 and CK domains that are linked at their C-termini to Fc domains, in order to prevent formation of a minor population of dimeric species of the central chain with the ⁇ antl"NKp46 - CH1 chain.
- Proteins were cloned, produced and purified as in Example 2-1.
- Bispecific proteins were purified from the cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 1 1 mg/L and the purified proteins exhibited a simple SEC profile.
- the amino acid sequences of the three polypeptide chains are shown in SEQ ID NOS: 175 (second chain), 176 (first chain) and 177 (third chain).
- the domain structure of the dimeric F13 polypeptide is shown in Figure 2D, wherein the interchain bonds between hinge domains (indicated between CH1/CK and CH2 domains on a chain) and interchain bonds between the CH1 and CK domains are interchain disulfide bonds.
- the heterodimer is made up of:
- the (V H -VK) unit was made up of a V H domain, a linker and a VK unit (scFv).
- Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins were purified from the cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 6.4 mg/L and the purified proteins exhibited a simple SEC profile.
- the amino acid sequences of the two polypeptide chains are shown in SEQ ID NOS: 178 (second chain) and 179 (first chain).
- the domain structure of the dimeric F14 polypeptide is shown in Figure 2E.
- the F14 polypeptide is a dimeric polypeptide which shares the structure of the F13 format, but instead of a wild-type Fc domain (CH2-CH3), the F14 bispecific format has CH2 domain mutations N297S to abolish N-linked glycosylation.
- Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins were purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 2.4 mg/L and the purified proteins exhibited a simple SEC profile.
- the amino acid sequences of the two polypeptide chains are shown in SEQ ID NOS: 180 (second chain) and 181 (first chain).
- F15 polypeptide is a dimeric polypeptide which shares the structure of the F6 format, but differs by inversion of the N-terminal V H -CH1 and VK-CK units between the central and second chains.
- Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins were purified from the cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a good production yield of 0.9 mg/L and the purified proteins possessed a simple SEC profile.
- the amino acid sequences of the three polypeptide chains are shown in SEQ ID NOS: 182 (second chain), 183 (first chain) and 184 (third chain).
- the domain structure of the trimeric F16 polypeptide is shown in Figure 2E.
- the F16 polypeptide is a dimeric polypeptide which shares the structure of the F6 format, but differs by inversion of the C-terminal V H -CK and VK-CH1 units between the central and second chains. Proteins were cloned, produced and purified as in Example 2-1 .
- the amino acid sequences of the three polypeptide chains are shown in SEQ ID NOS: 185 (second chain), 186 (first chain) and 187 (third chain).
- the domain structure of a trimeric T5 polypeptide is shown in Figure 2F.
- the T5 polypeptide is a trimeric polypeptide which shares the structure of the F5 format, but differs by fusion of an scFv unit at the C-terminus of the third chain (the chain lacking the Fc domain).
- This protein will therefore have two antigen binding domains for antigens of interest, and one for NKp46, and will bind CD16 via its Fc domain. Proteins were cloned, produced and purified as in Example 2-1.
- the T5 protein had two antigen binding domains that bind human CD20, originating from different antibodies (and binding to different epitopes on CD20).
- the first anti-CD20 ABD contained the V H and V L of the parent antibody GA101 (GAZYVA®, Gazyvaro®, obinutuzumab, Roche Pharmaceuticals).
- the second anti-CD20 ABD contained the V H and V L of the parent antibody rituximab (Rituxan®, Mabthera®, Roche Pharmaceuticals).
- the third antigen binding domain binds human NKp46.
- the amino acid sequences of the three chains of the T5 protein are shown below (Rituximab sequences are in bold and underlined, anti-GA101 sequences are underlined, anti-NKp46 sequences are in italics).
- Polypeptide 1 (SEQ ID NO : 188)
- Polypeptide 2 (SEQ ID NO : 189)
- Polypeptide 3 (SEQ ID NO : 190)
- the domain structure of the trimeric T6 polypeptide is shown in Figure 2F.
- the T6 polypeptide is a trimeric polypeptide which shares the structure of the F6 format, but differs by the fusion of an scFv unit at the C-terminus of the third chain (the chain lacking the Fc domain).
- This trimeric protein contains two antigen binding domains for antigens of interest, and one for NKp46, and does not bind CD16 via its Fc domain due to the N297 substitution. Proteins were cloned, produced and purified as in Example 2-1 .
- the T6 protein contains two antigen binding domains that bind human CD20.
- the first anti-CD20 ABD comprises the V H and V L of the parent antibody GA101 and the second anti-CD20 ABD comprises the V H and V L of rituximab.
- the amino acid sequences of the three chains of the T6 proteins are shown in SEQ ID NOS : 191 , 192 and 193.
- T9B The domain structure of the trimeric T9B polypeptide is shown in Figure 2F.
- the T9B polypeptide is a trimeric polypeptide which shares the structure of the F9 format (F9B variant), but differs by the fusion of an scFv unit at the C-terminus of the free CH1 domain (on the third chain).
- This protein contains two antigen binding domains for antigen of interest, and one for NKp46, but will not bind CD16 via its Fc domain due to the monomeric Fc domain and/or the N297 substitution.
- Trimeric proteins as above described were cloned, produced and purified as in Example 2-1 .
- the T9B protein had two antigen binding domains that bind human CD20.
- the first anti-CD20 ABD contained the V H and V L of the parent antibody GA101 and the second anti-CD20 ABD contained the V H and V L of the parent antibody rituximab.
- the amino acid sequences of the three chains of the T9B proteins are shown below.
- Polypeptide 3 (SEQ ID NO : 196):
- the domain structure of the dimeric T1 1 polypeptide is shown in Figure 2F.
- the T1 1 polypeptide is a trimeric polypeptide which shares the structure of the F1 1 format, but differs by the fusion of an scFv unit at the C-terminus of the free CH1 domain.
- This dimeric protein contains two antigen binding domains for antigen of interest, and one for NKp46, and does not bind CD16 via its Fc domain due to the monomeric Fc domain and/or the N297 substitution. Proteins were cloned, produced and purified as in Example 2-1.
- the T1 1 protein contains two antigen binding domains that bind human CD20.
- the first anti-CD20 ABD contained the V H and V L of the parent antibody GA101 and the second anti-CD20 ABD contained the V H and V L of rituximab.
- the amino acid sequences of the two chains of the T1 1 protein are shown below.
- Polypeptide 1 (SEQ ID NO : 197):
- Protein-A proteins were immobilized covalently to carboxyl groups in the dextran layer on a Sensor Chip CM5.
- the chip surface was activated with EDC/NHS (N-ethyl-N'-(3- dimethylaminopropyl) carbodiimidehydrochloride and N-hydroxysuccinimide (Biacore GE Healthcare)).
- Protein-A was diluted to 10 ⁇ g ml in coupling buffer (10 mM acetate, pH 5.6) and injected until the appropriate immobilization level was reached (i.e. 2000 RU). Deactivation of the remaining activated groups was performed using 100 mM ethanolamine pH 8 (Biacore GE Healthcare).
- the bispecific proteins were first tested in Format F1 as described in Example 2 having different anti-NKp46 variable regions from NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 antibodies. Antibodies were next tested as different formats (F3, F4, F5, F6, F9, F10, F1 1 , F13, F14) having the anti-NKp46 variable regions from the NKp46-3 antibody, and were compared to the NKp46-3 antibody as a full-length human lgG1.
- Bispecific proteins at 1 ⁇ g mL were captured onto Protein-A chip and recombinant human NKp46 proteins were injected at 5 ⁇ g mL over captured bispecific antibodies. For blank subtraction, cycles were performed again replacing NKp46 proteins with running buffer.
- the Bab281 antibody was separately tested for binding to NKp46 by SPR, and additionally by flow cytometry using a cell line expressing the human NKp46 construct on the cell surface.
- SPC and FACS results showed that the Bab281 based antibody did not bind the NKp46 cell line or to NKp46-Fc proteins.
- Bab281 lost the ability to bind to its target when presented in the bispecific format.
- Bispecific antibodies having a monomeric Fc domain and a domain arrangement according to the single chain F1 or dimeric F2 formats described in Example 3, and a NKp46 binding region based on NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 were tested for functional ability to direct NK cells to lyse CD19-positive tumor target cells (Daudi, a well characterized B lymphoblast cell line).
- the F2 proteins additionally included NKp46-9 variable regions which lost the ability to bindNKp46 in the scFv format but which retained the ability to bindNKp46 in the F(ab)-like format of F2.
- each bi-specific antibody NKp46-1 , NKp46-2, NKp46-3, NKp46-4 or NKp46-9 induced specific lysis of Daudi cells by human KHYG-1 hNKp46 NK cell line compared to negative controls (Human lgG1 isotype control (IC) and CD19/CD3 bi-specific antibodies), thereby showing that these antibodies induce Daudi target cell lysis by KHYG-1 hNKp46 through CD19/NKp46 cross-linking.
- each bi-specific antibody NKp46-1 , NKp46-2, NKp46-3, NKp46-4 or NKp46-9 again induced specific lysis of Daudi cells by human NK cells compared to the negative control (Human lgG1 isotype control (IC) antibody), thereby showing that these antibodies induce Daudi target cell lysis by human NK cells through CD19/NKp46 cross-linking.
- Rituximab RTX, chimeric lgG1
- ADCC Antibody-Dependent Cell Cytotoxicity
- bispecific antibodies possessing a specific bispecific format were produced in order to assess whether such bispecific antibodies can mediate NKp46- mediated NK activation toward cancer target cells without triggering non-specific NK cell activation.
- NKp46 x CD19 bispecific proteins having an arrangement according to the F2 format described in Example 3 with anti-NKp46 variable domains from NKp46-1 , NKp46-2, NKp46-3, NKp46-4 or NKp46-9 were compared to:
- the experiments further included as controls: rituximab, an anti-CD20 ADCC inducing antibody control for a target antigen with high expression levels; an anti-CD52 antibody alemtuzumab, a human IgGlwhich binds CD52 target present on both targets and NK cells; and a negative control isotype control therapeutic antibody (a human lgG1 that does not bind a target present on the target cells (HUG1 -IC).
- NK cell activation in the presence of CD19-positive tumor target cells (Daudi cells), in the presence of CD19-negative, CD16-positive target cells (HUT78 T-lymphoma cells), and in the absence of target cells.
- NK activation was tested by assessing CD69 and CD107 expression on NK cells by flow cytometry.
- the assay was carried out in 96 U well plates in completed RPMI, 150 ⁇ _ final/well. Effector cells were fresh NK cells purified from donors. Target cells were Daudi (CD19-positive), HUT78 (CD19-negative) or K562 (NK activation control cell line). In addition to K562 positive control, three conditions were tested, as follows:
- Antibodies, target cells and effector cells were mixed; spun 1 min at 300g; incubated 4h at 37°C; spun 3 min at 500g; washed twice with Staining Buffer (SB); added 50 ⁇ _ of staining Ab mix; incubated 30 min at 300g; washed twice with SB resuspended pellet with CellFix ; stored overnight at 4°C; and fluorescence was detected with Canto II (HTS).
- SB Staining Buffer
- Alemtuzumab also induced the activation of NK cells at a similar level of activation to what was observed in the presence of NK cells alone, and at higher antibody concentrations in this setting (ET 2.5 : 1 ) the activation was greater than with the bispecific anti-NKp46 x anti-CD19 antibody.
- the isotype control antibody did not induce activation.
- the inventive bispecific anti-NKp46 proteins are able to activate NK cells in a target-cell specific manner, unlike full-length monospecific anti- NKp46 antibodies and further unlike full-length antibodies of depleting IgG isotypes which also activate NK cells in the absence of target cells.
- the NK cell activation achieved with anti-NKp46 bispecific proteins remarkably was higher than that observed with full length anti- CD19 lgG1 antibodies. Therefore these bispecific antibodies should elicit less non-specific cytotoxicity and may be more potent when used in therapy.
- NKp46 x CD19 bispecific proteins having an arrangement according to the F2 format described in Example 3 with anti-NKp46 variable domains from NKp46-1 , NKp46-2, NKp46- 3, NKp46-4 or NKp46-9 were compared to:
- rituximab an anti-CD20 ADCC inducing antibody control for a target antigen with high expression levels
- anti-CD52 antibody alemtuzumab a human lgG1 , binds CD52 target present on both targets and NK cells
- negative control isotype control therapeutic antibody a human lgG1 that does not bind a target present on the target cells (HUG1 -IC).
- the different proteins were tested for their functional effect on NK cell activation as assessed by CD69 or CD107 expression in the presence of CD19-positive tumor target cells (Daudi cells), in the presence of CD19- negative, CD16-positive target cells (HUT78 T-lymphoma cells), and in the absence of target cells.
- the experiments were carried out as in Example 7 except that the ET ratio was 1 :1 .
- each of the bispecific anti-NKp46 x anti-CD19 antibodies activated NK cells in the presence of Daudi cells.
- bispecific anti-NKp46 x anti-CD19 antibody The activation induced by bispecific anti-NKp46 x anti-CD19 antibody in the presence of Daudi cells was far more potent than that elicited by the full-length human lgG1 anti-CD19 antibody. This ADCC inducing antibody had low activity in this setting. Furthermore, in this low E:T ratio setting the activation induced by the bispecific anti-NKp46 x anti-CD19 antibody was as potent as the anti-CD20 antibody rituximab, with a difference being observed only at the highest concentrations that were 10 fold higher than concentrations in which differences were observed at the 2.5:1 ET ratio.
- NKp46 x CD19 bispecific proteins having an arrangement according to the F2, F3, F5 or F6 formats described in Examples 3 or 4 with anti-NKp46 variable domains from NKp46-3 were compared to rituximab (anti-CD20 ADCC inducing antibody), and to a human lgG1 isotype control antibody for their functional ability to direct CD16-/NKp46+ NK cell lines to lyse CD19-positive tumor target cells.
- KIR3DL2 Anti-KIR3DL2 bispecific proteins
- KIR3DL2 CD158k; killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
- KIR3DL2 CD158k; killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
- KIR3DL2 CD158k; killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
- KIR3DL2 CD158k; killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
- KIR3DL2 CD158k; killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
- KIR3DL2 CD158k; killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
- NKp46 bispecific proteins to promote NKp46-mediated lysis of target cells may be affected by the distance between the two antigen binding domains in the bispecific protein which may impact the ability of one or both of the NKp46 antigen binding domain and the antigen binding domain which interacts with an antigen of interest to interact with their respective targets.
- NKp46 mediated lysis of target cells may be impacted by the structure of the two antigen binding domains and/or their respective conformation, freedom of motion or flexibility which may be impacted by the structure of the two antigen binding domains as well as the manner by which they are associated with each other, e.g., by a linker peptide and its particular length and chemical composition.
- a linker peptide and its particular length and chemical composition e.g., it was theorized that a lytic NKp46- target cell synapse may vary as a function of the size and structure of the bispecific protein. Therefore, the inventors posited that bispecific proteins wherein the antigen binding domains are in a format whereby the antigen binding domains more closely mimics or approximates the conformation, spacing and flexibility of the antigen binding domains of
- conformational flexibility notably intrachain domain motion or movement
- the inventors evaluated the lytic function of multimeric proteins of different bispecific protein formats and which comprise more or less freedom of motion of the antigen binding domains based on the structure of the antigen binding sites and the specific linkers separating these antigen binding sites.
- NKp46 x tumor antigen bispecific proteins of different formats such as the F3, F4, F9, F10 and F1 1 format that bound different tumor antigens were evaluated for their relative ability to induce NKp46- mediated lysis of tumor target cells by KHYG-1 NK cells (NKp46 + CD16 " ).
- F5 and F6 bispecific protein formats have distances between the NKp46 binding site and the antigen of interest binding site that are less than that of full-length antibodies.
- bispecific proteins targeting human CD19 (CD19 x NKp46 bispecific) in F9 format have binding sites that are spaced farther apart, similar to distances in the two binding sites in conventional full-length antibodies.
- Bispecific proteins were therefore constructed as F9 formats and compared to F10 and F1 1 formats. Structurally speaking, format F9, F10 and F1 1 are very close to one another, however formats F10 and F1 1 are characterized by one antigen binding domain with a Fab structure and the other antigen binding domain with a tandem variable domain structure (two variable domains separated by a flexible linker). F10 and F1 1 therefore have greater intrachain domain motion and/or less local steric hindrance, as well as possibly less distance between binding sites than in the F9 proteins.
- F9 format proteins have distances between the NKp46 binding site and the antigen of interest binding site which is similar to full-length antibodies or about 80 A, and the F10 and F1 1 proteins comprise a single chain domain connected to the Fc by a flexible linker and have substantially less than 80A between the antigen binding sites (in the case of F10, about 55 A).
- F3, F4 protein formats were selected for comparison with protein formats F10 and F1 1 .
- Each of these proteins have distances between antigen binding sites of less than 80A, however, F3 and F4 are shorter than F10 and F1 1 , and F3 and F4 have distances between antigen binding sites that are equivalent to F1 1 but 25A less than that of F10.
- NKp46 x CD19 bispecific proteins that bind human CD16 having an arrangement according to the F5 format with anti-NKp46 variable domains from NKp46-3 were compared to the same bispecific antibody in a F6 format (which lacks CD16 binding), and to a human lgG1 isotype anti-CD19 antibody, as well as to a human lgG1 isotype control antibody for functional ability to direct purified NK cells to lyse CD19-positive Daudi tumor target cells.
- the F5 format was far more potent in mediating Daudi target cell lysis that the full-length lgG1 anti-CD19 antibody or the F6 format bispecific protein.
- NKp46 can enhance target cell lysis even when CD16 is triggered.
- the CD19-F5-NKp46 was at least 1000 times more potent than the full-length anti- CD19 lgG1.
- Lysis of Daudi cells by NKp46 x CD19 bispecific F5 and F6 were compared to a conventional human lgG1 antibody. As a control, lysis was also tested on HUT78 cells that lack CD19; positive control for HUT78 cell lysis was an anti-KIR3DL2 of human lgG1 isotype (HUT78 are KIR3DL2-positive). Cytotoxicity assays were carried out as in Example 10. Flow cytometry staining of NK cell surface markers was carried out as in Example 7.
- the CD19-F6-NKp46-3 which functions via NKp46 but not via CD16 did not elicit any detectable CD137 upregulation. It is hypothesized that the remarkable potency of the F5 format may arise from a particularly strong CD137 upregulation on NK cells which may be mediated by the dual targeting of NKp46 and CD16.
- Fc-engineered CD16-binding NKp46 x CD20 bispecific New bispecific proteins were further constructed in an attempt to generate an agent that could improve on the most potent new generation of Fc enhanced antibodies.
- the comparison antibody we selected the commercial antibody GA101 (GAZYVA®, Gazyvaro®, obinutuzumab, Roche Pharmaceuticals), which is an Fc-modified human lgG1 antibody having enhanced CD16A binding as a result of hypofucosylated relinked glycosylation.
- NKp46 x CD20 bispecific proteins were produced as proteins without CD16 binding (F6 format), with CD16 binding (F5 format), or as Fc-engineered format based on F5 but comprising two amino acid substitutions in the CH2 domain of the heavy chain that increase binding affinity for human CD16A (referred to as "F5+").
- the anti-CD20 ABDs comprise the V H and V L of GA101.
- GA101 -F5+-NKp46-1 bispecific protein demonstrated a far higher potency (approximately 10-fold increase in EC 50 ) in mediating cytotoxicity toward Daudi cells that GA101 .
- agents capable of inducing ADCC via CD16 can be improved by further conferring on them the ability to induce NKp46-mediated lysis, and also that the potency of bispecific anti-NKp46 agents can be improved by enhancing affinity for CD16 via Fc engineering.
- F5 and F6 bispecific antibodies CD19-F5-NKp46-3 or CD19-F6-NKp46-3 were immobilized covalently to carboxyl groups in the dextran layer on a Sensor Chip CM5.
- the chip surface was activated with EDC/NHS (N-ethyl-N'-(3-dimethylaminopropyl) carbodiimidehydrochloride and N-hydroxysuccinimide (Biacore GE Healthcare)).
- Bispecific antibodies were diluted to 10 g/ml in coupling buffer (10 mM acetate, pH 5.6) and injected until the appropriate immobilization level was reached (i.e. 800 to 900 RU). Deactivation of the remaining activated groups was performed using 100 mM ethanolamine pH 8 (Biacore GE Healthcare).
- Conventional human anti-lgG1 antibodies have comparable binding to these Fc receptors (KD shown in the table below).
- Biacore T100 SPR measurements were performed on a Biacore T100 apparatus (Biacore GE Healthcare) at 25°C. In all Biacore experiments HBS-EP+ (Biacore GE Healthcare) and NaOH 10mM NaCI 500 mM served as running buffer and regeneration buffer respectively. Sensorgrams were analyzed with Biacore T100 Evaluation software.
- Anti-6xHis tag antibody was purchased from QIAGEN. Human 6xHis tagged NKp46 recombinant proteins (NKp46- His) were cloned, produced and purified at Innate Pharma. Anti-His antibodies were immobilized covalently to carboxyl groups in the dextran layer on a Sensor Chip CM5.
- the chip surface was activated with EDC/NHS (N-ethyl-N'-(3- dimethylaminopropyl) carbodiimidehydrochloride and N-hydroxysuccinimide (Biacore GE Healthcare)).
- EDC/NHS N-ethyl-N'-(3- dimethylaminopropyl) carbodiimidehydrochloride and N-hydroxysuccinimide
- Protein-A and anti-His antibodies were diluted to 10 ⁇ g ml in coupling buffer (10 mM acetate, pH 5.6) and injected until the appropriate immobilization level was reached (i.e. 2000 to 2500 RU). Deactivation of the remaining activated groups was performed using 100 mM ethanolamine pH 8 (Biacore GE Healthcare).
- NKp46 binding region corresponding to NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 were used for the competition study which has been performed using an Anti-6xHis tag antibody chip.
- Bispecific antibodies having NKp46 binding region based on NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 at 1 ⁇ g/mL were captured onto Protein-A chip and recombinant human NKp46 proteins were injected at 5 ⁇ g mL together with a second test bispecific antibody of the NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 group.
- NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 competed with one another for binding to NKp46. Accordingly these antibodies each bind or interact with a different NKp46epitope.
- NKp46 mutants defined by one, two or three substitutions of amino acids exposed at the molecular surface over the 2 domains of NKp46. This approach led to the generation of 42 mutants which were transfected in Hek-293T cells, as shown in the table below.
- the targeted amino acid mutations in Table 5 below are shown both according to the numbering of SEQ I D NO: 1 (also corresponding to the numbering used in Jaron-Mendelson et al. (2012) J. Immunol. 88(12):6165-74.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Transplantation (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2016284871A AU2016284871B2 (en) | 2015-06-23 | 2016-06-23 | Multispecific NK engager proteins |
| JP2017566332A JP6971153B2 (ja) | 2015-06-23 | 2016-06-23 | 多重特異的nkエンゲイジャータンパク質 |
| EP16734592.5A EP3313881A1 (en) | 2015-06-23 | 2016-06-23 | Multispecific nk engager proteins |
| CA2990518A CA2990518C (en) | 2015-06-23 | 2016-06-23 | Multispecific nk engager proteins |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EPPCT/EP2015/064063 | 2015-06-23 | ||
| PCT/EP2015/064063 WO2015197593A1 (en) | 2014-06-27 | 2015-06-23 | MULTISPECIFIC NKp46 BINDING PROTEINS |
| US201562271459P | 2015-12-28 | 2015-12-28 | |
| US62/271,459 | 2015-12-28 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016207278A1 true WO2016207278A1 (en) | 2016-12-29 |
Family
ID=57584697
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/064537 Ceased WO2016207278A1 (en) | 2015-06-23 | 2016-06-23 | Multispecific nk engager proteins |
Country Status (5)
| Country | Link |
|---|---|
| US (4) | US10113003B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3313881A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP6971153B2 (cg-RX-API-DMAC7.html) |
| AU (1) | AU2016284871B2 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2016207278A1 (cg-RX-API-DMAC7.html) |
Cited By (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017114694A1 (en) * | 2015-12-28 | 2017-07-06 | Innate Pharma | VARIABLE REGIONS FOR NKp46 BINDING PROTEINS |
| US10113003B2 (en) | 2015-06-23 | 2018-10-30 | Innate Pharma | Multispecific NK engager proteins |
| WO2019101695A1 (en) | 2017-11-21 | 2019-05-31 | Innate Pharma | Multispecific antigen binding proteins |
| WO2019198051A3 (en) * | 2018-04-13 | 2019-11-14 | Affimed Gmbh | Nk cell engaging antibody fusion constructs |
| WO2019226617A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Compositions and methods for enhancing the killing of target cells by nk cells |
| US10519234B2 (en) | 2014-06-27 | 2019-12-31 | Innate Pharma | NKp46 binding proteins |
| EP3634994A4 (en) * | 2017-06-05 | 2021-06-30 | Janssen Biotech, Inc. | SURFACE LOAD ENGINEERING PROCESSES FOR THE PRODUCTION OF A BISPECIFIC ANTIBODY |
| US11208480B2 (en) | 2014-06-27 | 2021-12-28 | Innate Pharma | Multispecific antigen binding proteins |
| RU2774711C2 (ru) * | 2018-04-13 | 2022-06-22 | Аффимед Гмбх | Слитые конструкции антител для вовлечения nk-клеток |
| WO2022200525A1 (en) | 2021-03-26 | 2022-09-29 | Innate Pharma | Multispecific proteins comprising an nkp46-binding site, a cancer antgienge binding site fused to a cytokine for nk cell engaging |
| WO2022216723A1 (en) * | 2021-04-05 | 2022-10-13 | Cytovia Therapeutics, Llc. | Bispecific antibodies targeting nkp46 and cd38 and methods of use thereof |
| WO2022216744A3 (en) * | 2021-04-05 | 2022-11-17 | Cytovia Therapeutics, Llc. | Bispecific antibodies targeting nkp46 and gpc3 and methods of use thereof |
| WO2022258662A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkp46, a cytokine receptor, a tumour antigen and cd16a |
| WO2022258673A1 (en) * | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific antibodies binding to cd20, nkp46, cd16 and conjugated to il-2 |
| WO2023034740A1 (en) * | 2021-08-30 | 2023-03-09 | Inhibrx, Inc. | Nkp46-binding polypeptides and uses thereof |
| WO2023034741A1 (en) * | 2021-08-30 | 2023-03-09 | Inhibrx, Inc. | Nkp46-targeted modified il-2 polypeptides and uses thereof |
| US11692039B2 (en) | 2020-12-31 | 2023-07-04 | Innate Pharma | Multifunctional natural killer (NK) cell engagers binding to NKp46 and CD123 |
| US11834506B2 (en) | 2017-02-08 | 2023-12-05 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| US11884732B2 (en) | 2017-02-20 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Proteins binding HER2, NKG2D and CD16 |
| US11884733B2 (en) | 2018-02-08 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| WO2024056861A1 (en) | 2022-09-15 | 2024-03-21 | Avidicure Ip B.V. | Multispecific antigen binding proteins for stimulating nk cells and use thereof |
| WO2024208818A1 (en) | 2023-04-04 | 2024-10-10 | Innate Pharma | Modular chimeric antigen receptor |
| US12157771B2 (en) | 2020-05-06 | 2024-12-03 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and CLEC12A |
| US12195555B2 (en) | 2022-05-27 | 2025-01-14 | Sanofi | Natural killer (NK) cell engagers binding to NKp46 and BCMA variants with Fc-engineering |
| US12215157B2 (en) | 2018-02-20 | 2025-02-04 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
| US12384851B2 (en) | 2018-08-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
| WO2025191133A1 (en) | 2024-03-15 | 2025-09-18 | Avidicure Ip B.V. | Il-21 muteins, fusion proteins comprising the same and uses thereof |
| WO2025193146A1 (en) | 2024-03-13 | 2025-09-18 | Berg Thoren Fredrik | Trail receptor binding molecules |
| WO2025191136A1 (en) | 2024-03-15 | 2025-09-18 | Avidicure Ip B.V. | Muteins of 4-1bb ligand extracellular domain, fusion proteins comprising the same and uses thereof |
| WO2025191139A1 (en) | 2024-03-15 | 2025-09-18 | Avidicure Ip B.V. | Conjugates of her2-specific antigen binding proteins and cytokines |
Families Citing this family (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9767555B2 (en) * | 2015-01-05 | 2017-09-19 | Case Western Reserve University | Disease characterization from fused pathology and radiology data |
| EP3313876B1 (en) * | 2015-06-23 | 2025-01-22 | Innate Pharma | Multispecific antigen binding proteins |
| JP6944925B2 (ja) | 2015-07-24 | 2021-10-06 | イナート・ファルマ・ソシエテ・アノニムInnate Pharma Pharma S.A. | 組織浸潤nk細胞を検出する方法 |
| US10436795B2 (en) * | 2016-09-16 | 2019-10-08 | Institute For Cancer Research | Carbon-detected NMR for mapping binding sites in intrinsically disordered regions of a protein |
| CN109863175A (zh) | 2016-10-21 | 2019-06-07 | 依奈特制药公司 | 用抗-kir3dl2药剂进行的治疗 |
| US20190322767A1 (en) * | 2016-12-23 | 2019-10-24 | Innate Pharma | Heterodimeric antigen binding proteins |
| JPWO2019167874A1 (ja) * | 2018-02-27 | 2021-03-18 | エーザイ・アール・アンド・ディー・マネジメント株式会社 | Apoa4に対するモノクローナル抗体、免疫学的測定方法及び測定用キット |
| KR102578060B1 (ko) * | 2018-03-23 | 2023-09-13 | 한림대학교 산학협력단 | 항균용 항체 및 그 용도 |
| AU2019319906A1 (en) * | 2018-08-08 | 2021-03-04 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12331320B2 (en) | 2018-10-10 | 2025-06-17 | The Research Foundation For The State University Of New York | Genome edited cancer cell vaccines |
| MX2021007672A (es) * | 2018-12-24 | 2021-09-30 | Sanofi Sa | Proteinas de union multiespecificas con dominios fab mutantes. |
| US20220412993A1 (en) * | 2019-12-05 | 2022-12-29 | The General Hospital Corporation | Multi-Biomarker Prediction Models for Multiple Infection Episodes Following Blunt Trauma |
| PH12022552283A1 (en) * | 2020-02-27 | 2024-01-22 | Novartis Ag | Methods of making chimeric antigen receptor-expressing cells |
| BR112022020232A2 (pt) * | 2020-04-06 | 2022-12-13 | Yissum Res Dev Co Of Hebrew Univ Jerusalem Ltd | Anticorpos contra nkp46 e construtos dos mesmos para o tratamento de cânceres e infecções |
| KR20230010228A (ko) * | 2020-05-08 | 2023-01-18 | 시애틀 칠드런즈 호스피탈 디/비/에이 시애틀 칠드런즈 리서치 인스티튜트 | 자연 살해 세포를 표적으로 하는 키메라 항원 수용체 (cars) |
| WO2022115776A1 (en) | 2020-11-30 | 2022-06-02 | Cho Pharma, Inc. | Antibody for enrichment of cells |
| US20240279331A1 (en) * | 2021-06-11 | 2024-08-22 | The Regents Of The University Of California | Antibodies that stimulate nk cell-mediated cytotoxicity |
| EP4588524A3 (en) | 2021-07-01 | 2025-09-03 | Compugen Ltd. | Anti-tigit and anti-pvrig in monotherapy and combination treatments |
Citations (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1992011018A1 (en) | 1990-12-19 | 1992-07-09 | Protein Design Labs, Inc. | Improved humanized immunoglobulins |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| US5573905A (en) | 1992-03-30 | 1996-11-12 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US20020161201A1 (en) | 1997-04-30 | 2002-10-31 | Enzon, Inc. | Single-chain antigen-binding proteins capable of glycosylation, production and uses thereof |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| US6821505B2 (en) | 1997-03-03 | 2004-11-23 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| WO2004103269A2 (en) | 2002-10-18 | 2004-12-02 | Macrogenics, Inc. | Methods and compositions for vaccination comprising nucleic acid and/or polypeptide sequences of the genus borrelia |
| WO2005000086A2 (en) * | 2003-06-30 | 2005-01-06 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | FRAGMENTS OF NKp44 AND NKp46 FOR TARGETING VIRAL-INFECTED AND TUMOR CELLS |
| WO2005040219A1 (en) | 2003-10-28 | 2005-05-06 | Novo Nordisk A/S | Laminin-5 gamma2-binding peptides, related compositions, and use thereof |
| WO2005047327A2 (en) | 2003-11-12 | 2005-05-26 | Biogen Idec Ma Inc. | NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO |
| US20050238646A1 (en) | 2001-01-17 | 2005-10-27 | Trubion Pharmaceuticals, Inc. | Binding domain-immunoglobulin fusion proteins |
| WO2005105858A1 (fr) | 2004-04-30 | 2005-11-10 | China Petroleum & Chemical Corporation | Composant catalyseur pour reaction de polymerisation d'olefines et catalyseur de cette reaction |
| WO2005110474A2 (en) | 2004-05-10 | 2005-11-24 | Macrogenics, Inc. | HUMANIZED FcϜRIIB SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| WO2005115452A2 (en) | 2004-04-16 | 2005-12-08 | Macrogenics, Inc. | Fcϝriib-specific antibodies and methods of use thereof |
| WO2006064136A1 (fr) | 2004-12-16 | 2006-06-22 | Centre National De La Recherche Scientifique (Cnrs) | Production de formats d'anticorps et applications immunologiques de ces formats |
| WO2006088494A2 (en) | 2004-07-12 | 2006-08-24 | Macrogenics, Inc. | Identification and engineering of antibodies with variant fc regions and methods of using the same |
| WO2007021841A2 (en) | 2005-08-10 | 2007-02-22 | Macrogenics, Inc. | Identification and engineering of antibodies with variant fc regions and methods of using same |
| US7183387B1 (en) | 1999-01-15 | 2007-02-27 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2007024249A2 (en) | 2004-11-10 | 2007-03-01 | Macrogenics, Inc. | Engineering fc antibody regions to confer effector function |
| WO2007106707A2 (en) | 2006-03-10 | 2007-09-20 | Macrogenics, Inc. | Identification and engineering of antibodies with variant heavy chains and methods of using same |
| WO2008002933A2 (en) | 2006-06-26 | 2008-01-03 | Macrogenics, Inc. | Combination of fcgammariib antibodies and cd20-specific antibodies and methods of use thereof |
| WO2008105886A2 (en) | 2006-05-26 | 2008-09-04 | Macrogenics, Inc. | HUMANIZED FCγRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| US7425619B2 (en) | 2002-08-14 | 2008-09-16 | Macrogenics, Inc. | FcγRIIB specific antibodies and methods of use thereof |
| WO2011109400A2 (en) | 2010-03-04 | 2011-09-09 | Macrogenics,Inc. | Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof |
| WO2012089814A1 (en) | 2010-12-30 | 2012-07-05 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Antigen binding formats for use in therapeutic treatments or diagnostic assays |
| US8586713B2 (en) | 2009-06-26 | 2013-11-19 | Regeneron Pharmaceuticals, Inc. | Readily isolated bispecific antibodies with native immunoglobulin format |
Family Cites Families (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6673986B1 (en) | 1990-01-12 | 2004-01-06 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| ES2434961T5 (es) | 1998-04-20 | 2018-01-18 | Roche Glycart Ag | Ingeniería de glicosilación de anticuerpos para mejorar la citotoxicidad celular dependiente del anticuerpo |
| PT1176195E (pt) | 1999-04-09 | 2013-07-18 | Kyowa Hakko Kirin Co Ltd | Processo para controlar a actividade de uma molécula funcional sob o ponto de vista imunológico |
| JP2005518336A (ja) | 2001-06-26 | 2005-06-23 | イムクローン システムズ インコーポレイティド | Vegf受容体に結合する二重特異性抗体 |
| PL213948B1 (pl) | 2001-10-25 | 2013-05-31 | Genentech Inc | Kompozycje zawierajace glikoproteine, czasteczka kwasu nukleinowego kodujaca te glikoproteine, komórka gospodarza, sposób wytwarzania glikoproteiny, kompozycja do zastosowania do leczenia, zastosowanie kompozycji i zestaw zawierajacy kompozycje |
| JP3814585B2 (ja) | 2002-03-20 | 2006-08-30 | キヤノン株式会社 | 画像処理装置、画像処理方法、プログラム及び記憶媒体 |
| RU2356909C2 (ru) | 2003-11-13 | 2009-05-27 | Ханми Фарм. Инд. Ко., Лтд. | Белковый комплекс, полученный с использованием фрагмента иммуноглобулина, и способ получения такого комплекса |
| US7235641B2 (en) | 2003-12-22 | 2007-06-26 | Micromet Ag | Bispecific antibodies |
| WO2006031994A2 (en) | 2004-09-14 | 2006-03-23 | Xencor, Inc. | Monomeric immunoglobulin fc domains |
| CA2587617C (en) | 2004-11-12 | 2011-02-01 | Xencor, Inc. | Fc variants with altered binding to fcrn |
| CA2608818A1 (en) | 2005-06-03 | 2006-12-14 | Genentech, Inc. | Method of producing antibodies with modified fucosylation level |
| AU2006327175A1 (en) | 2005-12-21 | 2007-06-28 | Medimmune, Llc | Epha2 bite molecules and uses thereof |
| EP2139924B1 (en) | 2007-03-29 | 2016-07-06 | Genmab A/S | Bispecific antibodies and methods for production thereof |
| CA2694488A1 (en) | 2007-07-31 | 2009-02-05 | Medimmune, Llc | Multispecific epitope binding proteins and uses thereof |
| PT2235064E (pt) | 2008-01-07 | 2016-03-01 | Amgen Inc | Método de preparação de moléculas heterodiméricas de fc de anticorpos utilizando efeitos de indução eletrostática |
| WO2010032269A2 (en) | 2008-09-18 | 2010-03-25 | Vasisht, Karan | Anti-inflammatory activity of the iridoid glycosides |
| US9676845B2 (en) | 2009-06-16 | 2017-06-13 | Hoffmann-La Roche, Inc. | Bispecific antigen binding proteins |
| ES2688978T3 (es) | 2009-11-23 | 2018-11-07 | Amgen Inc. | Anticuerpo monomérico Fc |
| KR101791430B1 (ko) | 2009-11-30 | 2017-10-30 | 얀센 바이오테크 인코포레이티드 | 이펙터 기능이 제거된 항체 Fc 돌연변이체 |
| EP2507381A4 (en) | 2009-12-04 | 2016-07-20 | Hoffmann La Roche | MULTISPECIFIC ANTIBODIES, ANTIBODY ANALOGS, COMPOSITIONS AND METHODS |
| CA2796181C (en) | 2010-04-20 | 2023-01-03 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| RU2624027C2 (ru) | 2010-04-23 | 2017-06-30 | Дженентек, Инк. | Получение гетеромультимерных белков |
| WO2012088302A2 (en) | 2010-12-22 | 2012-06-28 | Abbott Laboratories | Half immunoglobulin binding proteins and uses thereof |
| JP6408993B2 (ja) * | 2012-09-07 | 2018-10-17 | ジェネンテック, インコーポレイテッド | タイプII抗CD20抗体と選択的Bcl−2インヒビターの併用療法 |
| EP2897980B1 (en) | 2012-09-19 | 2019-11-06 | Innate Pharma | Kir3dl2 binding agents |
| JP6822849B2 (ja) * | 2014-06-27 | 2021-01-27 | イナート・ファルマ・ソシエテ・アノニムInnate Pharma Pharma S.A. | 多重特異的NKp46結合タンパク質 |
| AU2015279321B2 (en) | 2014-06-27 | 2021-03-04 | Innate Pharma, S.A. | Multispecific antigen binding proteins |
| EP3313876B1 (en) | 2015-06-23 | 2025-01-22 | Innate Pharma | Multispecific antigen binding proteins |
| AU2016284871B2 (en) * | 2015-06-23 | 2022-09-29 | Innate Pharma | Multispecific NK engager proteins |
| EP3397645A1 (en) * | 2015-12-28 | 2018-11-07 | Innate Pharma | VARIABLE REGIONS FOR NKp46 BINDING PROTEINS |
-
2016
- 2016-06-23 AU AU2016284871A patent/AU2016284871B2/en active Active
- 2016-06-23 JP JP2017566332A patent/JP6971153B2/ja active Active
- 2016-06-23 US US15/190,337 patent/US10113003B2/en active Active
- 2016-06-23 EP EP16734592.5A patent/EP3313881A1/en active Pending
- 2016-06-23 WO PCT/EP2016/064537 patent/WO2016207278A1/en not_active Ceased
-
2018
- 2018-10-29 US US16/173,150 patent/US12252543B2/en active Active
- 2018-10-29 US US16/173,114 patent/US11267897B2/en active Active
-
2025
- 2025-01-06 US US19/010,723 patent/US20250215107A1/en active Pending
Patent Citations (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| WO1992011018A1 (en) | 1990-12-19 | 1992-07-09 | Protein Design Labs, Inc. | Improved humanized immunoglobulins |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5573905A (en) | 1992-03-30 | 1996-11-12 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| US6821505B2 (en) | 1997-03-03 | 2004-11-23 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US20020161201A1 (en) | 1997-04-30 | 2002-10-31 | Enzon, Inc. | Single-chain antigen-binding proteins capable of glycosylation, production and uses thereof |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7122637B2 (en) | 1999-01-15 | 2006-10-17 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7416727B2 (en) | 1999-01-15 | 2008-08-26 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7371826B2 (en) | 1999-01-15 | 2008-05-13 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7335742B2 (en) | 1999-01-15 | 2008-02-26 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7332581B2 (en) | 1999-01-15 | 2008-02-19 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7183387B1 (en) | 1999-01-15 | 2007-02-27 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US20050238646A1 (en) | 2001-01-17 | 2005-10-27 | Trubion Pharmaceuticals, Inc. | Binding domain-immunoglobulin fusion proteins |
| US7425619B2 (en) | 2002-08-14 | 2008-09-16 | Macrogenics, Inc. | FcγRIIB specific antibodies and methods of use thereof |
| WO2004103269A2 (en) | 2002-10-18 | 2004-12-02 | Macrogenics, Inc. | Methods and compositions for vaccination comprising nucleic acid and/or polypeptide sequences of the genus borrelia |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| US7355008B2 (en) | 2003-01-09 | 2008-04-08 | Macrogenics, Inc. | Identification and engineering of antibodies with variant Fc regions and methods of using same |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| WO2005000086A2 (en) * | 2003-06-30 | 2005-01-06 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | FRAGMENTS OF NKp44 AND NKp46 FOR TARGETING VIRAL-INFECTED AND TUMOR CELLS |
| WO2005040219A1 (en) | 2003-10-28 | 2005-05-06 | Novo Nordisk A/S | Laminin-5 gamma2-binding peptides, related compositions, and use thereof |
| WO2005047327A2 (en) | 2003-11-12 | 2005-05-26 | Biogen Idec Ma Inc. | NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO |
| WO2005115452A2 (en) | 2004-04-16 | 2005-12-08 | Macrogenics, Inc. | Fcϝriib-specific antibodies and methods of use thereof |
| WO2005105858A1 (fr) | 2004-04-30 | 2005-11-10 | China Petroleum & Chemical Corporation | Composant catalyseur pour reaction de polymerisation d'olefines et catalyseur de cette reaction |
| US7521542B2 (en) | 2004-05-10 | 2009-04-21 | Macrogenics, Inc. | Humanized FcγRIIB-specific antibodies and methods of use thereof |
| WO2005110474A2 (en) | 2004-05-10 | 2005-11-24 | Macrogenics, Inc. | HUMANIZED FcϜRIIB SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| WO2006088494A2 (en) | 2004-07-12 | 2006-08-24 | Macrogenics, Inc. | Identification and engineering of antibodies with variant fc regions and methods of using the same |
| US7632497B2 (en) | 2004-11-10 | 2009-12-15 | Macrogenics, Inc. | Engineering Fc Antibody regions to confer effector function |
| WO2007024249A2 (en) | 2004-11-10 | 2007-03-01 | Macrogenics, Inc. | Engineering fc antibody regions to confer effector function |
| WO2006064136A1 (fr) | 2004-12-16 | 2006-06-22 | Centre National De La Recherche Scientifique (Cnrs) | Production de formats d'anticorps et applications immunologiques de ces formats |
| WO2007021841A2 (en) | 2005-08-10 | 2007-02-22 | Macrogenics, Inc. | Identification and engineering of antibodies with variant fc regions and methods of using same |
| WO2007106707A2 (en) | 2006-03-10 | 2007-09-20 | Macrogenics, Inc. | Identification and engineering of antibodies with variant heavy chains and methods of using same |
| WO2008105886A2 (en) | 2006-05-26 | 2008-09-04 | Macrogenics, Inc. | HUMANIZED FCγRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| WO2008002933A2 (en) | 2006-06-26 | 2008-01-03 | Macrogenics, Inc. | Combination of fcgammariib antibodies and cd20-specific antibodies and methods of use thereof |
| US8586713B2 (en) | 2009-06-26 | 2013-11-19 | Regeneron Pharmaceuticals, Inc. | Readily isolated bispecific antibodies with native immunoglobulin format |
| WO2011109400A2 (en) | 2010-03-04 | 2011-09-09 | Macrogenics,Inc. | Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof |
| WO2012089814A1 (en) | 2010-12-30 | 2012-07-05 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Antigen binding formats for use in therapeutic treatments or diagnostic assays |
Non-Patent Citations (61)
| Title |
|---|
| "Biocomputing: Informatics and Genome Projects", 1993, ACADEMIC PRESS |
| "Computational Molecular Biology", 1988, OXFORD UNIVERSITY PRESS |
| "Computer Analysis of Sequence Data", 1994, HUMANA PRESS |
| "Current Protocols in Immunology", 1992, GREENE PUBLISHING ASSOC. AND WILEY INTERSCIENCE |
| "Natural Killer Cells Protocols", 2000, HUMANA PRESS, pages: 219 - 238 |
| "Sequence Analysis in Molecular Biology", 1987, ACADEMIC PRESS |
| "Sequence Analysis Primer", 1991, M. STOCKTON PRESS |
| "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, pages: 269 - 315 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL.: "BLAST Manual", NCB/NLM/NIH BETHESDA |
| ATWELL, J. MOL. BIOL., vol. 270, 1997, pages 26 - 35 |
| BAEUERLE, P. A. ET AL., CANCER RES, vol. 69, no. 12, 2009, pages 4941 - 4944 |
| BRANDO ET AL., J. LEUKOC. BIOL., vol. 78, 2005, pages 359 - 371 |
| C. GERMAIN ET AL: "Redirecting NK cells mediated tumor cell lysis by a new recombinant bifunctional protein", PROTEIN ENGINEERING DESIGN AND SELECTION, vol. 21, no. 11, 1 January 2008 (2008-01-01), pages 665 - 672, XP055053514, ISSN: 1741-0126, DOI: 10.1093/protein/gzn047 * |
| CARILLO ET AL., SIAM J. APPLIED MATH., vol. 48, 1988, pages 1073 |
| CHAMES PATRICK ET AL: "Bispecific antibodies for cancer therapy. The light at the end of the tunnel?", MABS, LANDES BIOSCIENCE, US, vol. 1, no. 6, 1 November 2009 (2009-11-01), pages 539 - 547, XP002688758, ISSN: 1942-0862 * |
| CHOTHIA; LESK, J. MOL. BIOL, vol. 196, 1987, pages 901 - 917 |
| DEVEREUX ET AL., NUCL. ACID. RES., vol. 12, 1984, pages 387 |
| E. HARLOW; D. LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| E. KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1983 |
| EI-SHERBINY ET AL., CANCER RESEARCH, vol. 67, no. 18, 2007, pages 8444 - 8449 |
| FLANAGAN; NINA: "Mapping Epitopes with H/D-Ex Mass Spec: ExSAR Expands Repertoire of Technology Platform Beyond Protein Characterization", GENETIC ENGINEERING & BIOTECHNOLOGY NEWS, vol. 31, no. 10, 15 May 2011 (2011-05-15) |
| GEBAUER; SKERRA, CURRENT OPINION IN CHEMICAL BIOLOGY, vol. 13, 2009, pages 245 - 255 |
| GERSHONI, JONATHAN M; ROITBURD-BERMAN, ANNA; SIMAN-TOV; DROR D; TARNOVITSKI FREUND; NATALIA; WEISS, YAEL: "Epitope Mapping", BIODRUGS, vol. 21, no. 3, 2007, pages 145 - 156, XP009103541, DOI: doi:10.2165/00063030-200721030-00002 |
| GLIENKE ET AL.: "Advantages and applications of CAR-expressing natural killer cells", FRONT. PHARMACOL. 6, 2015, pages 1 - 6 |
| GRIFFITH ET AL., EMBO J., vol. 12, 1993, pages 725 - 734 |
| GUNASEKARAN ET AL., J. BIOL. CHEM., vol. 285, 2010, pages 19637 - 19646 |
| HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| HERMANSON; KAUFMAN, FRONT. IMMUNOL., vol. 6, 2015, pages 1 - 6 |
| HOLLANDER NURIT: "Bispecific antibodies for cancer therapy", IMMUNOTHERAPY, FUTURE MEDICINE LTD, UK, vol. 1, no. 2, 1 March 2009 (2009-03-01), pages 211 - 222, XP001525697, ISSN: 1750-743X * |
| HOLLIGER; HUDSON, NAT BIOTECHNOL, vol. 23, 2005, pages 1126 - 1136 |
| IDUSOGIE ET AL., J. IMMUNOL., vol. 164, no. 8, 2000, pages 4178 - 4184 |
| III ET AL., PROTEIN ENG, vol. 10, 1997, pages 949 - 957 |
| JACKMAN ET AL., J. BIOL. CHEM., vol. 285, 2010, pages 20850 - 20859 |
| JAKOBOVITZ, NATURE, vol. 362, 1993, pages 255 |
| JARON-MENDELSON ET AL., J. IMMUNOL., vol. 88, no. 12, 2012, pages 6165 - 6174 |
| JONES, NATURE, vol. 321, 1986, pages 522 - 525 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, UNITED STATES PUBLIC HEALTH SERVICE |
| KELLNER ET AL., CANCER LETT., vol. 303, no. 2, 2011, pages 128 - 139 |
| LABRIJN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 110, 2013, pages 5145 - 5150 |
| LAZAR ET AL., PROC. NAT. ACAD. SCI. USA, vol. 103, no. 11, 2006, pages 405 - 410 |
| MARKUS BOLZHAUSER: "Immuntherapie der kindlichen ALL: Einfluss eines bispezifischen CD19*NKp46-Antikörpers auf die zytotoxische Aktivität von NK-Zellen gegenüber CD19 + ALL-Blasten pädiatrischer Patienten", INAUGURAL-DISSERTATION ZUR ERLANGUNG DES DOKTORGRADES DER MEDIZIN DER MEDIZINISCHEN FAKULTÄT DER EBERHARD-KARLS-UNIVERSITÄT ZU TÜBINGEN, 1 January 2010 (2010-01-01), pages 116 pp., XP055209900, Retrieved from the Internet <URL:http://d-nb.info/1003819621/34> [retrieved on 20150827] * |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 553 |
| MOORE ET AL., MABS, vol. 3, 2011, pages 546 - 557 |
| MULLER, METH. ENZYMOL., vol. 92, 1983, pages 589 - 601 |
| NOLTE-'T HOEN ET AL., BLOOD, vol. 109, 2007, pages 670 - 673 |
| PENDE ET AL., J. EXP. MED., vol. 184, 1996, pages 505 - 518 |
| PESSINO ET AL., J. EXP. MED, vol. 188, no. 5, 1998, pages 953 - 960 |
| PRESTA, L.G. ET AL., BIOCHEM. SOC. TRANS., vol. 30, no. 4, 2002, pages 487 - 490 |
| RIDGWAY ET AL., PROTEIN ENG., vol. 9, 1996, pages 617 - 621 |
| SHIELDS, R.L. ET AL., J. BIOL. CHEM. 26, vol. 277, no. 30, 2002, pages 26733 - 26740 |
| SHIELDS, R.L. ET AL., J. BIOL. CHEM., vol. 276, no. 9, 2001, pages 6591 - 6604 |
| SHIELDS, R.L. ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 26740 |
| SIVORI ET AL., EUR J IMMUNOL, vol. 29, 1999, pages 1656 - 1666 |
| STROP ET AL., J. MOL. BIOL., vol. 420, 2012, pages 204 - 219 |
| TONG ET AL.: "Methods and Protocols for prediction of immunogenic epitopes", BRIEFINGS IN BIOINFORMATICS, vol. 8, no. 2, pages 96 - 108, XP055322956, DOI: doi:10.1093/bib/bbl038 |
| UMAÑA P. ET AL, NAT. BIOTECH., vol. 17, no. 2, 1999, pages 176 - 180 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VINAY ET AL., MOL. CANCER THER., vol. 11, no. 5, 2012, pages 1062 - 1070 |
| VON KREUDENSTEIN ET AL., MABS, vol. 5, 2013, pages 646 - 654 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 |
Cited By (53)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10519234B2 (en) | 2014-06-27 | 2019-12-31 | Innate Pharma | NKp46 binding proteins |
| US11208480B2 (en) | 2014-06-27 | 2021-12-28 | Innate Pharma | Multispecific antigen binding proteins |
| US11845795B2 (en) | 2014-06-27 | 2023-12-19 | Innate Pharma | NKp46 binding proteins |
| US12252543B2 (en) | 2015-06-23 | 2025-03-18 | Innate Pharma | Multispecific NK engager protein |
| US11267897B2 (en) | 2015-06-23 | 2022-03-08 | Innate Pharma | Multispecific NK engager protein |
| US10113003B2 (en) | 2015-06-23 | 2018-10-30 | Innate Pharma | Multispecific NK engager proteins |
| US11891444B2 (en) | 2015-12-28 | 2024-02-06 | Innate Pharma | Variable regions for NKp46 binding proteins |
| WO2017114694A1 (en) * | 2015-12-28 | 2017-07-06 | Innate Pharma | VARIABLE REGIONS FOR NKp46 BINDING PROTEINS |
| CN108779175A (zh) * | 2015-12-28 | 2018-11-09 | 依奈特制药公司 | NKp46结合蛋白的可变区 |
| US11001629B2 (en) | 2015-12-28 | 2021-05-11 | Innate Pharma | Variable regions for NKp46 binding proteins |
| CN108779175B (zh) * | 2015-12-28 | 2022-07-08 | 依奈特制药公司 | NKp46结合蛋白的可变区 |
| US11834506B2 (en) | 2017-02-08 | 2023-12-05 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| US11884732B2 (en) | 2017-02-20 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Proteins binding HER2, NKG2D and CD16 |
| US11192951B2 (en) | 2017-06-05 | 2021-12-07 | Janseen Biotech, Inc. | Methods of engineering surface charge for bispecific antibody production |
| EP3634994A4 (en) * | 2017-06-05 | 2021-06-30 | Janssen Biotech, Inc. | SURFACE LOAD ENGINEERING PROCESSES FOR THE PRODUCTION OF A BISPECIFIC ANTIBODY |
| WO2019101695A1 (en) | 2017-11-21 | 2019-05-31 | Innate Pharma | Multispecific antigen binding proteins |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
| US12129300B2 (en) | 2018-02-08 | 2024-10-29 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12264200B2 (en) | 2018-02-08 | 2025-04-01 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US11939384B1 (en) | 2018-02-08 | 2024-03-26 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US11884733B2 (en) | 2018-02-08 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12215157B2 (en) | 2018-02-20 | 2025-02-04 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use |
| JP2025081307A (ja) * | 2018-04-13 | 2025-05-27 | アフィメド ゲーエムベーハー | Nk細胞結合抗体融合構築物 |
| CN112119097B (zh) * | 2018-04-13 | 2021-10-15 | 艾菲默德有限责任公司 | 自然杀伤细胞接合抗体融合构建体 |
| US11001633B2 (en) | 2018-04-13 | 2021-05-11 | Affimed Gmbh | NK cell engaging antibody fusion constructs |
| CN112119097A (zh) * | 2018-04-13 | 2020-12-22 | 艾菲默德有限责任公司 | 自然杀伤细胞接合抗体融合构建体 |
| RU2774711C2 (ru) * | 2018-04-13 | 2022-06-22 | Аффимед Гмбх | Слитые конструкции антител для вовлечения nk-клеток |
| WO2019198051A3 (en) * | 2018-04-13 | 2019-11-14 | Affimed Gmbh | Nk cell engaging antibody fusion constructs |
| JP2021521275A (ja) * | 2018-04-13 | 2021-08-26 | アフィメド ゲーエムベーハー | Nk細胞結合抗体融合構築物 |
| WO2019226617A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Compositions and methods for enhancing the killing of target cells by nk cells |
| US12384851B2 (en) | 2018-08-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12157771B2 (en) | 2020-05-06 | 2024-12-03 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and CLEC12A |
| US11692039B2 (en) | 2020-12-31 | 2023-07-04 | Innate Pharma | Multifunctional natural killer (NK) cell engagers binding to NKp46 and CD123 |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
| WO2022200525A1 (en) | 2021-03-26 | 2022-09-29 | Innate Pharma | Multispecific proteins comprising an nkp46-binding site, a cancer antgienge binding site fused to a cytokine for nk cell engaging |
| WO2022216744A3 (en) * | 2021-04-05 | 2022-11-17 | Cytovia Therapeutics, Llc. | Bispecific antibodies targeting nkp46 and gpc3 and methods of use thereof |
| WO2022216723A1 (en) * | 2021-04-05 | 2022-10-13 | Cytovia Therapeutics, Llc. | Bispecific antibodies targeting nkp46 and cd38 and methods of use thereof |
| WO2022258673A1 (en) * | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific antibodies binding to cd20, nkp46, cd16 and conjugated to il-2 |
| WO2022258662A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkp46, a cytokine receptor, a tumour antigen and cd16a |
| WO2023034740A1 (en) * | 2021-08-30 | 2023-03-09 | Inhibrx, Inc. | Nkp46-binding polypeptides and uses thereof |
| WO2023034741A1 (en) * | 2021-08-30 | 2023-03-09 | Inhibrx, Inc. | Nkp46-targeted modified il-2 polypeptides and uses thereof |
| US12195555B2 (en) | 2022-05-27 | 2025-01-14 | Sanofi | Natural killer (NK) cell engagers binding to NKp46 and BCMA variants with Fc-engineering |
| WO2024056862A1 (en) | 2022-09-15 | 2024-03-21 | Avidicure Ip B.V. | Multispecific antigen binding proteins for tumor-targeting of nk cells and use thereof |
| WO2024056861A1 (en) | 2022-09-15 | 2024-03-21 | Avidicure Ip B.V. | Multispecific antigen binding proteins for stimulating nk cells and use thereof |
| WO2024208818A1 (en) | 2023-04-04 | 2024-10-10 | Innate Pharma | Modular chimeric antigen receptor |
| WO2025193146A1 (en) | 2024-03-13 | 2025-09-18 | Berg Thoren Fredrik | Trail receptor binding molecules |
| WO2025191133A1 (en) | 2024-03-15 | 2025-09-18 | Avidicure Ip B.V. | Il-21 muteins, fusion proteins comprising the same and uses thereof |
| WO2025191136A1 (en) | 2024-03-15 | 2025-09-18 | Avidicure Ip B.V. | Muteins of 4-1bb ligand extracellular domain, fusion proteins comprising the same and uses thereof |
| WO2025191139A1 (en) | 2024-03-15 | 2025-09-18 | Avidicure Ip B.V. | Conjugates of her2-specific antigen binding proteins and cytokines |
| WO2025191144A1 (en) | 2024-03-15 | 2025-09-18 | Avidicure Ip B.V. | Conjugates of egfr-specific antigen binding proteins and cytokines |
| WO2025191137A1 (en) | 2024-03-15 | 2025-09-18 | Avidicure Ip B.V. | Conjugates of trop2-specific antigen binding proteins and cytokines |
Also Published As
| Publication number | Publication date |
|---|---|
| US10113003B2 (en) | 2018-10-30 |
| US20250215107A1 (en) | 2025-07-03 |
| JP2018524326A (ja) | 2018-08-30 |
| US20190055315A1 (en) | 2019-02-21 |
| AU2016284871A1 (en) | 2018-02-15 |
| US20160369002A1 (en) | 2016-12-22 |
| US20190048093A1 (en) | 2019-02-14 |
| US12252543B2 (en) | 2025-03-18 |
| CA2990518A1 (en) | 2016-12-29 |
| AU2016284871B2 (en) | 2022-09-29 |
| JP6971153B2 (ja) | 2021-11-24 |
| US11267897B2 (en) | 2022-03-08 |
| EP3313881A1 (en) | 2018-05-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250215107A1 (en) | Multispecific nk engager protein | |
| AU2021200972B2 (en) | MULTISPECIFIC NKp46 BINDING PROTEINS | |
| US20240174748A1 (en) | Variable regions for nkp46 binding proteins | |
| EP3313876B1 (en) | Multispecific antigen binding proteins | |
| EP3160994B1 (en) | Multispecific antigen binding proteins | |
| US20190322767A1 (en) | Heterodimeric antigen binding proteins | |
| CA2990518C (en) | Multispecific nk engager proteins |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16734592 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2990518 Country of ref document: CA Ref document number: 2017566332 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2016734592 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2016284871 Country of ref document: AU Date of ref document: 20160623 Kind code of ref document: A |