WO2016164503A1 - Alk7:actriib heteromultimers and uses thereof - Google Patents
Alk7:actriib heteromultimers and uses thereof Download PDFInfo
- Publication number
- WO2016164503A1 WO2016164503A1 PCT/US2016/026277 US2016026277W WO2016164503A1 WO 2016164503 A1 WO2016164503 A1 WO 2016164503A1 US 2016026277 W US2016026277 W US 2016026277W WO 2016164503 A1 WO2016164503 A1 WO 2016164503A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- heteromultimer
- seq
- actriib
- alk7
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/45—Transferases (2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/08—Drugs for disorders of the urinary system of the prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/11—Protein-serine/threonine kinases (2.7.11)
- C12Y207/1103—Receptor protein serine/threonine kinase (2.7.11.30)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- TGF-beta The transforming growth factor-beta (TGF-beta) superfamily contains a variety of growth factors that share common sequence elements and structural motifs. These proteins are known to exert biological effects on a large variety of cell types in both vertebrates and invertebrates. Members of the superfamily perform important functions during embryonic development in pattern formation and tissue specification and can influence a variety of differentiation processes, including adipogenesis, myogenesis, chondrogenesis,
- TGF-beta family members have diverse, often complementary biological effects. By manipulating the activity of a member of the TGF-beta family, it is often possible to cause significant physiological changes in an organism.
- GDF8 also called myostatin
- inactive alleles of GDF8 are associated with increased muscle mass and, reportedly, exceptional strength [Schuelke et al. (2004) N Engl J Med 350:2682-8].
- Changes in fibrosis, muscle, bone, fat, red blood cells, and other tissues may be achieved by enhancing or inhibiting intracellular signaling (e.g., SMAD 1, 2, 3, 5, and/or 8) that is mediated by ligands of the TGF-beta family.
- intracellular signaling e.g., SMAD 1, 2, 3, 5, and/or 8
- an ALK7:ActRIIB heterodimer protein complex is a unique antagonist of ligands of the TGF-beta superfamily, exhibiting a different ligand-binding profile/selectivity compared to corresponding ActRIIB and ALK7 homodimers.
- an exemplary ALK7:ActRIIB heterodimer displays enhanced binding to activin AC, activin C, and BMP5 compared to either homodimer, retains strong binding to activin B as observed with ActRIIB homodimer, and exhibits reduced binding to GDF11, GDF8, activin A, BMP10, BMP6, GDF3, and BMP9.
- ALK7: ActRIIB heterodimer displays low to no observable affinity for BMP9, whereas this ligand binds strongly to ActRIIB homodimer. See Figure 6. These results therefore demonstrate that ALK7:ActRIIB heterodimers are a more selective antagonists (inhibitors) of certain ligands of the TGF-beta superfamily compared to ActRIIB homodimers. Accordingly, an
- ALK7: ActRIIB heterodimer will be more useful than an ActRIIB homodimer in certain applications where such selective antagonism is advantageous. Examples include therapeutic applications where it is desirable to antagonize one or more of activin B, activin AC, activin C, and BMP5 with decreased antagonism of one or more of activin A, BMP10, BMP6, GDF3, and BMP9. Moreover, an ALK7:ActRIIB heterodimer was shown to have therapeutic effects in a mouse model of kidney disease as well as a beneficial catabolic effects on adipose cells.
- ALK7 ActRIIB heteromultimers, as well as variants thereof, that bind to/inhibit at least one or more of activin (e.g., activin A, activin B, activin AB, activin C, activin E, activin AC, activin AE, activin BC and activin BE), GDF8, GDF11, BMP10, BMP6, BMP5, GDF3, and/or nodal will be useful agents for treating kidney disease, particularly certain disorders of kidney disease such as inflammation and fibrosis, and/or promoting beneficial catabolic effects on adipose tissue.
- activin e.g., activin A, activin B, activin AB, activin C, activin E, activin AC, activin AE, activin BC and activin BE
- GDF8 GDF11, BMP10, BMP6, BMP5, GDF3, and/or nodal
- ALK7 ActRIIB heterodimers as well as agents that directly or indirectly antagonize ALK7 and/or ActRIIB receptors, agents that directly or indirectly antagonize ALK7 and/or
- ActRIIB-binding ligands agents that directly or indirectly antagonize downstream signaling mediator (e.g., Smads), and/or agents that directly or indirectly antagonize TGFP superfamily co-receptors (e.g., Cripto or Cryptic) will have similar biological effects.
- Smads e.g., Smads
- agents that directly or indirectly antagonize TGFP superfamily co-receptors e.g., Cripto or Cryptic
- ALK7 polypeptides comprising at least one ALK7 polypeptide and at least one ActRIIB polypeptide (ALK7:ActRIIB heteromultimers).
- ALK7 polypeptides comprise a ligand-binding domain of an ALK7 receptor, for example, a portion of the ALK7
- ActRIIB polypeptides generally comprise a ligand-binding domain of an ActRIIB receptor, for example, a portion of the ActRIIB extracellular domain.
- ActRIIB polypeptides, as well as resultant heteromultimers thereof, are soluble.
- an ALK7:ActRIIB heteromultimer comprises an ALK7 amino acid sequence that is at least 70% identical to a polypeptide that begins at any one of amino acids 21-28 of SEQ ID NO: 9 (e.g., amino acids 21, 22, 23, 24, 25, 26, 27, or 28) and ends at any one of amino acids 92-113 of SEQ ID NO: 9 (e.g., amino acids 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, or 113) of SEQ ID NO: 9.
- amino acids 21-28 of SEQ ID NO: 9 e.g., amino acids 21, 22, 23, 24, 25, 26, 27, or 28
- amino acids 92-113 of SEQ ID NO: 9 e.g., amino acids 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105,
- ALK7:ActRIIB heteromultimers may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 28-92 of SEQ ID NO: 9.
- ALK7:ActRIIB heteromultimers may comprise an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 21-113 of SEQ ID NO: 9.
- ALK7:ActRIIB heteromultimers may comprise an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 10.
- ALK7:ActRIIB heteromultimers may comprise an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 20.
- ALK7:ActRIIB heteromultimers may comprise an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 39.
- ALK7:ActRIIB heteromultimers may comprise an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 43.
- ALK7: ActRIIB heteromultimers may comprise an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 46.
- an ALK7:ActRIIB heteromultimer comprises an ActRIIB amino acid sequence that is at least 70% identical to a polypeptide that begins at any one of amino acids 20-29 of SEQ ID NO: 1 (e.g., 20, 21, 22, 23, 24, 25 , 26, 27, 28, or 29) and ends at any one of amino acids 109-134 of SEQ ID NO: 1 (109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134) of SEQ ID NO: 1.
- ALK7: ActRIIB heteromultimers may comprise an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 29-109 of SEQ ID NO: 1.
- ALK7:ActRIIB heteromultimers may comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 25-131.
- ALK7:ActRIIB heteromultimers may comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 2.
- ALK7:ActRIIB heteromultimers may comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 3.
- ALK7:ActRIIB heteromultimers may comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 5.
- ALK7:ActRIIB heteromultimers may comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 6.
- ALK7:ActRIIB heteromultimers do not comprise an ActRIIB polypeptide comprising an acidic amino acid (e.g., the naturally occurring amino acids E or D or an artificial acidic amino acid) at the position corresponding to L79 of SEQ ID NO: 1.
- an acidic amino acid e.g., the naturally occurring amino acids E or D or an artificial acidic amino acid
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 28-92 of SEQ ID NO: 9; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
- an ALK7: ActRIIB heteromul timer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%>, 85%>, 86%>, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 21-113 of SEQ ID NO: 9; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to amino acids 25-131 of SEQ ID NO: 1.
- an ALK7: ActRIIB heteromul timer may comprise, consist essentially of or
- ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 10; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 2.
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 20; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 2.
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 39; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 2.
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 43; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 2.
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 46; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 2.
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 10; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 3.
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 20; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 3.
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 39; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 3.
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 43; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 3.
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 46; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 3.
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 10; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%,
- an ALK7:ActRIIB heteromultimer may comprise, consist essentially of or consist of a) a polypeptide comprising, consisting essentially of, or consisting of an ALK7 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 10; and b) a polypeptide comprising, or consisting essentially of, or consisting of an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 6.
- ALK7:ActRIIB heteromultimer structures include, for example, heterodimers, heterotrimers, heterotetramers, heteropentamers, and higher order
- heteromultimer complexes See, e.g., Figures 1, 2, and 8-10.
- Figures 1, 2, and 8-10 In certain preferred embodiments
- ALK7:ActRIIB heteromultimers are heterodimers.
- ALK7 and/or ActRIIB polypeptides may be fusion proteins.
- an ALK7 polypeptide may be a fusion protein comprising an ALK7 polypeptide domain and one or more heterologous (non-ALK7) polypeptide domains.
- an ActRIIB polypeptide may be a fusion protein comprising an ActRIIB polypeptide domain and one or more heterologous (non- ActRIIB) polypeptide domains.
- ALK7 polypeptides are connected directly (fused) to one or more heterologous domains, or an intervening sequence, such as a linker, may be positioned between the amino acid sequence of the ALK7 polypeptide and the one or more heterologous domains.
- the ActRIIB polypeptide may be connected directly (fused) to one or more heterologous domains, or an intervening sequence, such as a linker, may be positioned between the amino acid sequence of the ActRIIB polypeptide and the one or more
- Linkers may correspond to the roughly 15 amino acid unstructured region at the C-terminal end of the extracellular domain of ActRIIB or ALK7 (the “tail"), or it may be an artificial sequence of between 5 and 15, 20, 30, 50, 100 or more amino acids that are relatively free of secondary structure.
- a linker may be rich in glycine and proline residues and may, for example, contain repeating sequences of threonine/serine and glycines.
- linkers include, but are not limited to, the sequences TGGG (SEQ ID NO: 17), SGGG (SEQ ID NO: 18), TGGGG (SEQ ID NO: 15), SGGGG (SEQ ID NO: 16), GGGGS (SEQ ID NO: 58), GGGG (SEQ ID NO: 14), and GGG (SEQ ID NO: 13).
- the one or more heterologous domains that provide a desirable property to the ALK7 and/or ActRIIB fusion proteins including, for example, improved pharmacokinetics, easier purification, targeting to particular tissues, etc.
- a heterologous domain of a fusion protein may enhance one or more of in vivo stability, in vivo half-life,
- An ALK7 or ActRIIB fusion protein may include an immunoglobulin Fc domain (wild-type or mutant) or a serum albumin.
- an ALK7 and/or ActRIIB polypeptides may comprise a purification subsequence, such as an epitope tag, a FLAG tag, a polyhistidine sequence, and a GST fusion.
- ALK7:ActRIIB heteromultimers described herein comprise an ALK7 polypeptide covalently, or non-covalently, associated with an ActRIIB polypeptide wherein the ALK7 polypeptide comprises an ALK7 domain and an amino acid sequence of a first member (or second member) of an interaction pair and the ActRIIB polypeptide comprises an ActRIIB polypeptide and an amino acid sequence of a second member (or first member) of the interaction pair.
- Interaction pairs described herein are designed to promote dimerization or form higher order multimers. See, e.g., Figures 1, 2, and 8-10.
- the interaction pair may be any two polypeptide sequences that interact to form a complex, particularly a heterodimeric complex although operative embodiments may also employ an interaction pair that forms a homodimeric sequence.
- the first and second members of the interaction pair may be an asymmetric pair, meaning that the members of the pair preferentially associate with each other rather than self-associate (i.e., guided interaction pairs). Accordingly, first and second members of an asymmetric interaction pair may associate to form a heterodimeric complex.
- the interaction pair may be unguided, meaning that the members of the pair may associate with each other or self- associate without substantial preference and thus may have the same or different amino acid sequences.
- first and second members of an unguided interaction pair may associate to form a homodimer complex or a heterodimeric complex.
- the first member of the interaction action pair e.g., an asymmetric pair or an unguided interaction pair
- the first member of the interaction action pair associates covalently with the second member of the interaction pair.
- the first member of the interaction action pair e.g., an asymmetric pair or an unguided interaction pair
- the first member of the interaction action pair (e.g., an asymmetric pair or an unguided interaction pair) associates through both covalent and non-covalent mechanisms with the second member of the interaction pair.
- ALK7 polypeptides are fusion proteins that comprise an Fc domain of an immunoglobulin.
- ActRIIB polypeptides are fusion proteins that comprise an Fc domain of an immunoglobulin.
- Traditional Fc fusion proteins and antibodies are examples of unguided interaction pairs, whereas a variety of engineered Fc domains have been designed as asymmetric interaction pairs [Spiess et al
- a first member and/or a second member of an interaction pair described herein may comprise a constant domain of an immunoglobulin, including, for example, the Fc portion of an immunoglobulin.
- a first member of an interaction pair may comprise an amino acid sequence that is derived from an Fc domain of an IgG (IgGl, IgG2, IgG3, or IgG4), IgA (IgAl or IgA2), IgE, or IgM immunoglobulin.
- immunoglobulin domains may comprise one or more amino acid modifications (e.g., deletions, additions, and/or substitutions) that promote ALK7:ActRIIB heteromultimer formation.
- the first member of an interaction pair may comprise, consist essentially of, or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 23-37.
- a second member of an interaction pair may comprise an amino acid sequence that is derived from an Fc domain of an IgG (IgGl, IgG2, IgG3, or IgG4), IgA (IgAl or IgA2), IgE, or IgM.
- immunoglobulin domains may comprise one or more amino acid modifications (e.g., deletions, additions, and/or
- the second member of an interaction pair may comprise, consist essentially of, or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 23-37.
- a first member and a second member of an interaction pair comprise Fc domains derived from the same immunoglobulin class and subtype.
- a first member and a second member of an interaction pair comprise Fc domains derived from different immunoglobulin classes or subtypes.
- an ALK7:ActRIIB heterodimer comprises i) an ALK7 polypeptide comprising, consisting essentially of, or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 76, and ii) an ActRIIB polypeptide comprising, consisting essentially of, or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 73.
- an ALK7:ActRIIB heterodimer comprises i) an ALK7 polypeptide comprising, consisting essentially of, or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 80, and ii) an ActRIIB polypeptide comprising, consisting essentially of, or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 78.
- a first member and/or a second member of an interaction pair comprise a modified constant domain of an immunoglobulin, including, for example, a modified Fc portion of an immunoglobulin.
- protein complexes of the disclosure may comprise a first modified Fc portion of an IgG comprising, consisting essentially of, or consisting of an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from the group: SEQ ID NOs: 23-37 and a second modified Fc portion of an IgG, which may be the same or different from the amino acid sequence of the first modified Fc portion of the IgG, comprising, consisting essentially of, or consisting of an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%), or 99% identical to an amino acid sequence selected from the group: SEQ ID NOs: 23- 37.
- ALK7:ActRIIB heteromultimers comprise, consist essentially of, or consist of: a) an ALK7 (or ActRIIB) fusion protein comprising an immunoglobulin domain that comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 23, optionally wherein the immunoglobulin domain comprises a positively charged amino acid (e.g., K, R, or H) at the positions corresponding to residues 134 and 177 of SEQ ID NO: 23, and further optionally wherein the immunoglobulin domain does not comprise a positively charged amino acid (e.g., K, R, or H) at the position corresponding to residue 225 of SEQ ID NO: 23, and b) an ActRIIB (or ALK7) fusion protein comprising an immunoglobulin domain that comprises, consisting
- ALK7:ActRIIB heteromultimers comprise, consist essentially of, or consist of: a) an ALK7 (or ActRIIB) fusion protein comprising an immunoglobulin domain that comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 27, optionally wherein the immunoglobulin domain comprises a C at the position corresponding to residue 132 of SEQ ID NO: 27 and a W at the position corresponding to residue 144 of SEQ ID NO: 27, and further optionally wherein the immunoglobulin domain does not comprise a positively charged amino acid (e.g., K, R, or H) at the position corresponding to residue 225 of SEQ ID NO: 27, and b) an ActRIIB (or ALK7) fusion protein comprising an immunoglobulin domain that comprises, consisting
- an ALK7 and/or ActRIIB polypeptide includes one or more modified amino acid residues selected from: a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, and an amino acid conjugated to an organic derivatizing agent.
- ALK7 and/or ActRIIB polypeptides may comprise at least one N-linked sugar, and may include two, three or more N-linked sugars. Such polypeptides may also comprise O-linked sugars.
- ALK7 and/or ActRIIB polypeptides may be produced in a variety of cell lines that glycosylate the protein in a manner that is suitable for patient use, including engineered insect or yeast cells, and mammalian cells such as COS cells, CHO cells, HEK cells and NSO cells.
- an ALK7 and/or ActRIIB polypeptide is glycosylated and has a glycosylation pattern obtainable from a Chinese hamster ovary cell line.
- a Chinese hamster ovary cell line Preferably
- ALK7:ActRIIB heteromultimer complexes of the disclosure exhibit a serum half-life of at least 4, 6, 12, 24, 36, 48, or 72 hours in a mammal (e.g., a mouse or a human).
- ALK7:ActRIIB heteromultimers may exhibit a serum half-life of at least 6, 8, 10, 12, 14, 20, 25, or 30 days in a mammal (e.g., a mouse or a human).
- ALK7:ActRIIB heteromultimers of the disclosure bind to one or more TGF-beta superfamily ligands.
- ALK7:ActRIIB heteromultimers bind to one or more of these ligands with a K D of less than or equal to 10 "8 , 10 "9 , 10 "10 , 10 "11 , or 10 "12 M.
- ALK7:ActRIIB heteromultimers bind to activin.
- ALK7:ActRIIB heteromultimers bind to activin A.
- ALK7:ActRIIB heteromultimers bind to activin B. In some embodiments, ALK7:ActRIIB heteromultimers bind to activin C. In some embodiments, ALK7:ActRIIB heteromultimers bind to activin AB. In some embodiments, ALK7:ActRIIB heteromultimers bind to activin AC. In some embodiments, ALK7:ActRIIB heteromultimers bind to activin BC. In some embodiments, ALK7:ActRIIB heteromultimers bind to activin E. In some embodiments, ALK7:ActRIIB heteromultimers bind to activin AE. In some embodiments, ALK7:ActRIIB heteromultimers bind to activin BE.
- ALK7:ActRIIB heteromultimers bind to GDF 1 1. In some embodiments, ALK7: ActRIIB heteromultimers bind to GDF8. In some embodiments, ALK7:ActRIIB heteromultimers bind to BMP6. In some embodiments, ALK7:ActRIIB heteromultimers bind to BMP10. In some embodiments, ALK7:ActRIIB heteromultimers bind to BMP5. In some embodiments, ALK7:ActRIIB heteromultimers bind to GDF3. In some embodiments, ALK7: ActRIIB heteromultimers bind to nodal. In some embodiments, ALK7:ActRIIB heteromultimers do not bind to or do not substantially bind to BMP9.
- the ALK7:ActRIIB heteromultimer binds to BMP 10 with weaker affinity compared to a corresponding ActRIIB homomultimer. In some embodiments, the ALK7: ActRIIB heteromultimer binds to BMP9 with weaker affinity compared to a corresponding ActRIIB homomultimer. In some embodiments, the ALK7: ActRIIB heteromultimer binds to GDF3 with weaker affinity compared to a corresponding ActRIIB homomultimer. In some embodiments, the ALK7: ActRIIB heteromultimer binds to BMP6 with weaker affinity compared to a corresponding ActRIIB homomultimer.
- the ALK7: ActRIIB heteromultimer binds to GDF8 with weaker affinity compared to a corresponding ActRIIB homomultimer. In some embodiments, the ALK7: ActRIIB heteromultimer binds to GDF11 with weaker affinity compared to a corresponding ActRIIB homomultimer. In some embodiments, the
- ALK7: ActRIIB heteromultimer binds to activin C with stronger affinity compared to a corresponding ActRIIB homomultimer. In some embodiments, the ALK7: ActRIIB heteromultimer binds to activin AC with stronger affinity compared to a corresponding ActRIIB homomultimer. In some embodiments, the ALK7: ActRIIB heteromultimer binds to BMP5 with stronger affinity compared to a corresponding ActRIIB homomultimer.
- ALK7:ActRIIB heteromultimers of the disclosure antagonize (inhibit) one or more activities of at least one TGF-beta superfamily ligand, and such alterations in activity may be measured using various assays known in the art, including, for example, a cell-based assay such as those described herein.
- ALK7:ActRIIB heteromultimers may be used to inhibit signaling (e.g., Smad 2/3 and/or Smad 1/5/8 signaling) mediated by one or more TGFp superfamily ligands in, for example, a cell-based assay.
- ALK7:ActRIIB heteromultimers inhibit activin signaling in a cell-based assay.
- ALK7:ActRIIB heteromultimers inhibit activin A signaling in a cell-based assay. In some embodiments, ALK7:ActRIIB heteromultimers inhibit activin B signaling in a cell-based assay. In some embodiments, ALK7:ActRIIB heteromultimers inhibit activin C signaling in a cell-based assay. In some embodiments, ALK7:ActRIIB heteromultimers inhibit activin AB signaling in a cell-based assay. In some embodiments, ALK7:ActRIIB heteromultimers inhibit activin AC signaling in a cell-based assay. In some embodiments, ALK7:ActRIIB heteromultimers inhibit activin BC signaling in a cell-based assay.
- ALK7:ActRIIB heteromultimers inhibit activin E signaling in a cell-based assay. In some embodiments, ALK7:ActRIIB heteromultimers inhibit activin AE signaling in a cell-based assay. In some embodiments, ALK7:ActRIIB heteromultimers inhibit activin BE signaling in a cell-based assay. In some embodiments, ALK7:ActRIIB heteromultimers inhibit GDF11 signaling in a cell-based assay. In some embodiments, ALK7:ActRIIB heteromultimers inhibit GDF8 signaling in a cell-based assay. In some embodiments, ALK7: ActRIIB heteromultimers inhibit BMP6 signaling in a cell-based assay.
- ALK7:ActRIIB heteromultimers inhibit BMP10 signaling in a cell- based assay. In some embodiments, ALK7:ActRIIB heteromultimers inhibit BMP5 signaling in a cell-based assay. In some embodiments, ALK7:ActRIIB heteromultimers may inhibit GDF3 signaling in a cell-based assay. In some embodiments, ALK7:ActRIIB
- heteromultimers may inhibit nodal signaling in a cell-based assay.
- ALK7: ActRIIB heteromultimers do not inhibit or do not substantially inhibit BMP9 signaling in a cell-based assay.
- ALK7:ActRIIB heteromultimers are weaker inhibitors of BMP9 signaling in a cell-based assay compared to a corresponding ActRIIB homomultimer.
- ALK7:ActRIIB heteromultimers are weaker inhibitors of BMP 10 signaling in a cell-based assay compared to a corresponding ActRIIB homomultimer.
- ALK7:ActRIIB heteromultimers are weaker inhibitors of BMP6 signaling in a cell-based assay compared to a corresponding ActRIIB homomultimer. In some embodiments, ALK7:ActRIIB heteromultimers are weaker inhibitors of GDF3 signaling in a cell-based assay compared to a corresponding ActRIIB homomultimer. In some embodiments, ALK7:ActRIIB heteromultimers are weaker inhibitors of GDF11 signaling in a cell-based assay compared to a corresponding ActRIIB homomultimer.
- ALK7:ActRIIB heteromultimers are weaker inhibitors of GDF8 signaling in a cell-based assay compared to a corresponding ActRIIB homomultimer. In some embodiments, ALK7:ActRIIB heteromultimers are weaker inhibitors of activin A signaling in a cell-based assay compared to a corresponding ActRIIB homomultimer. In some embodiments, ALK7:ActRIIB heteromultimers are stronger inhibitors of activin C signaling in a cell-based assay compared to a corresponding ActRIIB homomultimer.
- ALK7:ActRIIB heteromultimers are stronger inhibitors of activin AC signaling in a cell-based assay compared to a corresponding ActRIIB homomultimer. In some embodiments, ALK7:ActRIIB heteromultimers are stronger inhibitors of BMP5 signaling in a cell-based assay compared to a corresponding ActRIIB homomultimer.
- Any of the ALK7:ActRIIB heteromultimers as well as ALK7:ActRIIB antagonists described herein may be formulated as a pharmaceutical preparation (compositions).
- pharmaceutical preparations comprise a pharmaceutically acceptable carrier.
- a pharmaceutical preparation will preferably be pyrogen-free (meaning pyrogen free to the extent required by regulations governing the quality of products for therapeutic use).
- a pharmaceutical preparation may also include one or more additional compounds such as a compound that is used to treat a disorder/condition described herein.
- ALK7:ActRIIB heteromultimer pharmaceutical preparations are substantially free of ALK7 and/or ActRIIB homomultimers.
- ALK7:ActRIIB heteromultimer pharmaceutical preparations comprise less than about 10%, 9%, 8%, 7%, 6%, 5%), 4%), 3%), 2%), or less than about 1% ALK7 homomultimers.
- ALK7:ActRIIB heteromultimer pharmaceutical preparations comprise less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% ActRIIB homomultimers.
- the disclosure provides nucleic acids encoding an ALK7 or
- an ActRIIB nucleic acid may comprise, consists essentially of, or consists of a nucleic acid that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of 73-396 of SEQ ID NO: 7 or one that hybridizes under stringent conditions to the complement of nucleotides 73-396 of SEQ ID NO: 7.
- Such an nucleic acid may be one that comprises the sequence of SEQ ID NOs: 8 or 72.
- an ActRIIB nucleic acids comprises, consists essentially of, or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID Nos: 7, 8, and 72.
- an ALK7 nucleic acid may comprise, consists essentially of, or consists of a nucleic acid that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of 61-339 of SEQ ID NO: 11 or one that hybridizes under stringent conditions to the complement of nucleotides 61-339 of SEQ ID NO: 11.
- Such an ALK7 nucleic acid may be one that comprises the sequence of SEQ ID NOs: 12, 22, 41, 45, or 75.
- an ALK7 nucleic acids comprises, consists essentially of, or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOs: 11, 12, 22, 41, 45, or 75.
- nucleic acids of the disclosure comprises, consists essentially of, or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOs: 1 1, 12, 21, 22, 40, 41, 44, 45, or 75, and b) comprises, consists essentially of, or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOs: 1 1, 12, 21, 22, 40, 41, 44, 45, or 75, and b) comprises, consists essentially of, or consists of a nucleotide sequence that is at least 70%, 75%,
- ALK7 and/or ActRIIB nucleic acids are isolated and/or recombinant nucleic acids. Nucleic acids disclosed herein may be operably linked to a promoter for expression.
- the present disclosure further provides vectors comprising such ALK7 and/or ActRIIB polynucleotides as well as cells (e.g., CHO cells), preferably cells isolated from a human or other vertebrate species, comprising such ALK7 and/or ActRIIB polynucleotides as well as vectors comprising such ALK7 and/or ActRIIB polynucleotides.
- ALK7 polypeptides and/or ActRIIB polypeptides may be expressed in a mammalian cell line, optionally a cell line that mediates suitably natural glycosylation of the ActRIIB or ALK7 protein so as to diminish the likelihood of an unfavorable immune response in a patient (including the possibility of veterinary patients).
- Human and CHO cell lines have been used successfully, and it is expected that other common mammalian expression vectors will be useful.
- cultured cells comprising any of the nucleic acids disclosed herein.
- Such cells may be mammalian cells, including CHO cells, NSO cells, HEK cells and COS cells. Other cells may be chosen depending on the species of the intended patient. Other cells are disclosed herein. Cultured cells are
- the disclosure provides methods for making any of the ALK7 and
- a method of making a heteromultimer comprising an ALK7 polypeptide and an ActRIIB polypeptide comprises: a) culturing a cell under conditions suitable for expression of an ALK7 polypeptide and an ActRIIB polypeptide, wherein the cell comprises an ALK7 polynucleotide and an ActRIIB polynucleotide; and b) recovering the heteromultimer so expressed.
- a method of making a heteromultimer comprising an ALK7 polypeptide and an ActRIIB polypeptide may comprise: a) culturing a first cell under conditions suitable for expression of an ALK7 polypeptide, wherein the first cell comprises an ALK7 polynucleotide; b) recovering the ALK7 polypeptide so expressed; c) culturing a second cell under conditions suitable for expression of an ActRIIB polypeptide, wherein the second cell comprises an ActRIIB polynucleotide; d) recovering the ActRIIB polypeptide so expressed; e) combining the recovered ALK7 polypeptide and the recovered ActRIIB polypeptide under conditions suitable for ALK7:ActRIIB heteromultimer formation; and f) recovering the ALK7:ActRIIB heteromultimer.
- ALK7 and/or ActRIIB polypeptides are expressed using a TPA leader sequence (e.g., SEQ ID NO: 70). In certain embodiments, ALK7 and/or ActRIIB polypeptides are expressed in a CHO cell.
- ALK7 and ActRIIB polypeptides described herein, as well as protein complexes of the same may be recovered as crude, partially purified, or highly purified fractions using any of the well-known techniques for obtaining protein from cell cultures.
- such methods result in ALK7:ActRIIB complexes that are substantially free of ALK7 and/or ActRIIB homomultimers.
- methods for producing ALK7:ActRIIB heteromultimers result in less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% ALK7 homomultimers.
- ALK7: ActRIIB heteromultimers result in less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%), 2%), or less than about 1% ActRIIB homomultimers. In some embodiments, methods for producing ALK7: ActRIIB heteromultimers result in less than about 10%, 9%, 8%, 7%, 6%, 5%), 4%), 3%), 2%), or less than about 1% ALK7 homomultimers and In some embodiments, methods for producing ALK7:ActRIIB heteromultimers result in less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% ActRIIB homomultimers.
- ALK7: ActRIIB heteromultimers for use in the treatment or prevention of various activin C-associated diseases and conditions.
- ALK7:ActRIIB heteromultimers may be used to increase fertility, increase sperm production, increase seminiferous tubule volume, decrease prostate inflammation, decrease liver inflammation in a patient in need thereof.
- ALK7:ActRIIB heteromultimers may be used to treat or prevent hepatic cancer, testicular cancer, or prostate cancer.
- ALK7:ActRIIB heteromultimers may be used to decrease levels (e.g., serum levels) of activin C in a patient in need thereof.
- the disclosure further provides methods and ALK7:ActRIIB antagonists (e.g., ALK7: ActRIIB heteromultimers) for use in the treatment or prevention of various
- ALK7:ActRIIB-associated diseases and conditions associated with, for example, kidney, fat, fibrosis, and other tissues include, for example, chronic kidney disease or failure, acute kidney disease or failure, patients that have stage 1 kidney disease, patients that have stage 2 kidney disease, patients that have stage 3 kidney disease, patients that have stage 4 kidney disease, patients that have stage 5 kidney disease, non-diabetic kidney diseases, glomerulonephritis, interstitial nephritis, diabetic kidney diseases, diabetic nephropathy, glomerulosclerosis, rapid progressive glomerulonephritis, renal fibrosis, Alport syndrome, IDDM nephritis, mesangial proliferative glomerulonephritis,
- membranoproliferative glomerulonephritis crescentic glomerulonephritis, renal interstitial fibrosis, focal segmental glomerulosclerosis, membranous nephropathy, minimal change disease, pauci-immune rapid progressive glomerulonephritis, IgA nephropathy, polycystic kidney disease, Dent's disease, nephrocytinosis, Heymann nephritis, autosomal dominant (adult) polycystic kidney disease, autosomal recessive (childhood) polycystic kidney disease, acute kidney injury, nephrotic syndrome, renal ischemia, podocyte diseases or disorders, proteinuria, glomerular diseases, membranous glomerulonephritis, focal segmental glomerulonephritis, pre-eclampsia, eclampsia, kidney lesions, collagen vascular diseases, benign orthostatic (postural) proteinuria, IgM n
- glomerulonephritis chronic allograft nephropathy, nephrotoxicity, renal toxicity, kidney necrosis, kidney damage, glomerular and tubular injury, kidney dysfunction, nephritic syndrome, acute renal failure, chronic renal failure, proximal tubal dysfunction, acute kidney transplant rejection, chronic kidney transplant rejection, non-IgA mesangioproliferative glomerulonephritis, postinfectious glomerulonephritis, vasculitides with renal involvement of any kind, any hereditary renal disease, any interstitial nephritis, renal transplant failure, kidney cancer, kidney disease associated with other conditions (e.g., hypertension, diabetes, and autoimmune disease), Dent's disease, nephrocytinosis, Heymann nephritis, a primary kidney disease, a collapsing glomerulopathy, a dense deposit disease, a cryoglobulinemia- associated glomerulonephritis, an Henoch-Schon
- glomerulonephritis a bacterial endocarditis, a microscopic polyangitis, a Churg-Strauss syndrome, an anti-GBM-antibody mediated glomerulonephritis, amyloidosis, a monoclonal immunoglobulin deposition disease, a fibrillary glomerulonephritis, an immunotactoid glomerulopathy, ischemic tubular injury, a medication-induced tubulo-interstitial nephritis, a toxic tubulo-interstitial nephritis, an infectious tubulo-interstitial nephritis, a bacterial pyelonephritis, a viral infectious tubulo-interstitial nephritis which results from a
- a metabolic-induced tubulo-interstitial disease a mixed connective disease
- a cast nephropathy a crystal nephropathy which may results from urate or oxalate or drug-induced crystal deposition
- an acute cellular tubulo-interstitial allograft rejection a tumoral infiltrative disease which results from a lymphoma or a post- transplant lymphoproliferative disease
- an obstructive disease of the kidney vascular disease, a thrombotic microangiopathy, a nephroangiosclerosis, an atheroembolic disease, a mixed connective tissue disease, a polyarteritis nodosa, a calcineurin-inhibitor induced-vascular disease, an acute cellular vascular allograft rejection, an acute humoral allograft rejection, early renal function decline (ERFD), end stage renal disease (ESRD), renal vein thrombosis, acute tubular necros
- the disclosure further provides methods and ALK7:ActRIIB antagonists (e.g., ALK7: ActRIIB heteromultimers) for use in delaying or preventing progression from: stage 1 to stage 2 kidney disease, stage 2 to stage 3 kidney disease, stage 3 to stage 4 kidney disease, or stage 4 to stage 5 kidney disease.
- the disclosure further provides methods and ALK7: ActRIIB antagonists (e.g., ALK7: ActRIIB heteromultimers) for use in preventing or reducing kidney inflammation.
- the disclosure further provides methods and ALK7:ActRIIB antagonists (e.g., ALK7:ActRIIB heteromultimers) for use in preventing or reducing kidney damage.
- the disclosure further provides methods and ALK7:ActRIIB antagonists (e.g., ALK7:ActRIIB heteromultimers) for use in preventing or reducing kidney fibrosis. In some embodiments, the disclosure further provides methods and ALK7:ActRIIB antagonists (e.g., ALK7:ActRIIB heteromultimers) for use in lipolysis activity in a subject in need thereof. In some embodiments, the disclosure further provides methods and
- ALK7:ActRIIB antagonists e.g., ALK7:ActRIIB heteromultimers
- ALK7:ActRIIB antagonists for use in decreasing body fat content or reducing the rate of increase in body fat content in a subject in need thereof.
- the disclosure further provides methods and ALK7:ActRIIB antagonists (e.g., ALK7: ActRIIB heteromultimers) for use in treating a disorder or condition associated with undesirable body weight gain in a subject.
- Such disorders include, for example, obesity (e.g., abdominal obesity); overweight; insulin resistance; metabolic syndrome and other metabolic diseases or conditions; a lipid disorder such as, low HDL levels, high LDL levels, hyperlipidemia, hypertriglyceridemia or dyslipidemia; lipoprotein aberrations; decreased triglycerides; fatty liver disease; non-alcoholic fatty liver disease; hyperglycemia; impaired glucose tolerance (IGT); hyperinsulinemia; high cholesterol (e.g., high LDL levels and/or hypercholesterolemia); cardiovascular disease such as, heart disease including coronary heart disease, congestive heart failure, atherosclerosis; arteriosclerosis, and/or hypertension; Syndrome X; vascular restenosis; neuropathy; and/or other lipid disorder such as, low HDL levels, high LDL levels, hyperlipidemia, hypertriglyceridemia or dyslipidemia; lipoprotein aberrations; decreased triglycerides; fatty liver disease; non-alcoholic fatty liver disease; hyperglycemia; impaired glucose tolerance (
- the disclosure provides methods for decreasing body fat content or reducing the rate of increase in body fat content in a subject, comprising administering to a subject in need thereof an effective amount of an ALK7:ActRIIB antagonist, or combination of
- the disclosure provides methods for treating a disorder associated with undesirable body weight gain in a subject, comprising administering to a subject in need thereof an effective amount of an ALK7: ActRIIB antagonist, or combination of ALK7:ActRIIB antagonists.
- the disorder associated with undesirable body weight gain in a subject is selected from the group consisting of: obesity, non-insulin dependent diabetes mellitus (NIDDM), cardiovascular disease, hypertension, osteoarthritis, stroke, respiratory problems, and gall bladder disease.
- the disclosure provides methods for reducing cholesterol and/or triglycerides in a patient, comprising administering to a subject patient in need thereof an effective amount of an ALK7:ActRIIB antagonist, or combination of ALK7:ActRIIB antagonists.
- the disclosure further provides methods and ALK7:ActRIIB antagonists (e.g., ALK7:ActRIIB heteromultimers) for use in treating and/or ameliorating cancer or a condition associated with cancer.
- the subject has a cancer selected from the group consisting of melanoma, breast, colon, and endometrial, pancreatic, gastric, and uterine cancer.
- the subject has myeloma (e.g., multiple myeloma, plasmacytoma, localized myeloma, and extramedullary myeloma).
- the ALK7:ActRIIB antagonist is administered to treat or prevent lymphatic metastasis, bloodstream metastasis, tumor growth, or tumor invasion.
- the disclosure further provides methods and ALK7:ActRIIB antagonists (e.g., ALK7: ActRIIB heteromultimers) for use in treating or preventing fibrosis or a disorder or condition associated with fibrosis in a patient in need thereof.
- ALK7:ActRIIB antagonists e.g., ALK7: ActRIIB heteromultimers
- Such disorders or conditions include, for example, pulmonary fibrosis, hypersensitivity pneumonitis, idiopathic fibrosis, tuberculosis, pneumonia, cystic fibrosis, asthma, chronic obstructive pulmonary disease (COPD), emphysema, renal (kidney) fibrosis, renal (kidney) failure, chronic renal (kidney) disease, bone fibrosis, myelofibrosis, rheumatoid arthritis, systemic lupus erythematosus, scleroderma, sarcoidosis, granulomatosis with polyangiitis, Peyronie's disease, liver fibrosis, Wilson's disease, glycogen storage diseases (particularly types III, IV, IX, and X), iron-overload, Gaucher disease, Zellweger syndrome, nonalcoholic and alcoholic steatohepatitis, biliary cirrhosis, sclerosing cholangitis, Budd
- nephrogeneic fibrosis retroperitoneal fibrosis, atrial fibrosis, endomyocardial fibrosis, pancreatic fibrosis.
- Figure 1A and IB show two schematic examples of heteromeric protein complexes comprising type I receptor and type II receptor polypeptides.
- Figure 1 A depicts a
- heterodimeric protein complex comprising one type I receptor fusion polypeptide and one type II receptor fusion polypeptide, which can be assembled covalently or noncovalently via a multimerization domain contained within each polypeptide chain. Two assembled multimerization domains constitute an interaction pair, which can be either guided or unguided.
- Figure IB depicts a heterotetrameric protein complex comprising two
- FIG. 1A shows a schematic example of a heteromeric protein complex comprising a type I receptor polypeptide (indicated as "I") (e.g.
- polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ALK7 protein from humans or other species such as those described herein, e.g., SEQ ID Nos: 9, 10, 19, 20, 38, 39, 42, 43, 46, 74, 76, 79, and 80) and a type II receptor polypeptide (indicated as ' ⁇ ') (e.g.
- the type I receptor polypeptide is part of a fusion polypeptide that comprises a first member of an interaction pair ("Ci")
- the type II receptor polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair ("C 2 ").
- a linker may be positioned between the type I or type II receptor polypeptide and the corresponding member of the interaction pair.
- the first and second members of the interaction pair may be a guided (asymmetric) pair, meaning that the members of the pair associate preferentially with each other rather than self-associate, or the interaction pair may be unguided, meaning that the members of the pair may associate with each other or self-associate without substantial preference and may have the same or different amino acid sequences.
- Figure 3 shows an alignment of extracellular domains of human ActRIIA (SEQ ID NO: 49) and human ActRIIB (SEQ ID NO: 2) with the residues that are deduced herein, based on composite analysis of multiple ActRIIB and ActRIIA crystal structures, to directly contact ligand indicated with boxes.
- Figure 4 shows a multiple sequence alignment of various vertebrate ActRIIB precursor proteins without their intracellular domains (SEQ ID NOs: 50-55) human ActRIIA precursor protein without its intracellular domain (SEQ ID NO: 56), and a consensus ActRII precursor protein (SEQ ID NO: 57).
- Figure 5 shows multiple sequence alignment of Fc domains from human IgG isotypes using Clustal 2.1. Hinge regions are indicated by dotted underline. Double underline indicates examples of positions engineered in IgGl Fc to promote asymmetric chain pairing and the corresponding positions with respect to other isotypes IgG2, IgG3 and IgG4.
- Figure 6 shows comparative ligand binding data for an ALK7-Fc: ActRIIB-Fc heterodimeric protein complex compared to ActRIIB-Fc homodimer and ALK7-Fc
- ligands are ranked by k 0ff , a kinetic constant that correlates well with ligand signaling inhibition, and listed in descending order of binding affinity (ligands bound most tightly are listed at the top).
- yellow, red, green, and blue lines indicate magnitude of the off-rate constant.
- Solid black lines indicate ligands whose binding to heterodimer is enhanced or unchanged compared with homodimer, whereas dashed red lines indicate substantially reduced binding compared with homodimer.
- four of the five ligands with strong binding to ActRIIB-Fc homodimer exhibit reduced binding to the ActRIIB-Fc:ALK7-Fc
- Figures 8A-8D show schematic examples of heteromeric protein complexes comprising an ALK7 polypeptide (e.g. a polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ALK7 protein from humans or other species such as those described herein, e.g., SEQ ID Nos: 9, 10, 19, 20, 38, 39, 42, 43, 46, 74, 76, 79, and 80) and an ActRIIB
- an ALK7 polypeptide e.g. a polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ALK7 protein from humans or other species such as those described herein, e.g., SEQ ID Nos: 9, 10, 19, 20, 38, 39, 42, 43,
- polypeptide e.g. a polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ActRIIB protein from humans or other species such as those described herein, e.g., SEQ ID Nos: 1, 2, 3, 4, 5, 6, 71, 73, 77, and 78).
- the ALK7 polypeptide is part of a fusion polypeptide that comprises a first member of an interaction pair ("Ci")
- the ActRIIB polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair ("C 2 ").
- Suitable interaction pairs included, for example, heavy chain and/or light chain immunoglobulin interaction pairs, truncations, and variants thereof such as those described herein [e.g., Spiess et al (2015) Molecular Immunology 67(2A): 95-106].
- a linker may be positioned between the ALK7 or ActRIIB polypeptide and the corresponding member of the interaction pair.
- the first and second members of the interaction pair may be unguided, meaning that the members of the pair may associate with each other or self-associate without substantial preference, and they may have the same or different amino acid sequences. See Figure 8A.
- the interaction pair may be a guided (asymmetric) pair, meaning that the members of the pair associate preferentially with each other rather than self-associate. See Figure 8B. Complexes of higher order can be envisioned. See Figure 8C and 8D.
- Figures 9A-9G show schematic examples of heteromeric protein complexes comprising two ALK7 polypeptides (e.g. polypeptide that are independently at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ALK7 protein from humans or other species such as those described herein, e.g., SEQ ID Nos: 9, 10, 19, 20, 38, 39, 42, 43, 46, 74, 76, 79, and 80) and two ActRIIB polypeptides (e.g.
- ALK7 polypeptides e.g. polypeptide that are independently at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ALK7 protein from humans or other species such as those described herein, e.g., SEQ ID Nos: 9, 10, 19, 20,
- the first ALK7 polypeptide (from left to right) is part of a fusion polypeptide that comprises a first member of an interaction pair ("Ci") and further comprises an additional first member of an interaction pair ("Ai"); and the second ALK7 polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair ("C 2 ") and further comprises a first member of an interaction pair ("A 2 ").
- the first ActRIIB polypeptide (from left to right) is part of a fusion polypeptide that comprises a second member of an interaction pair (“Bi"); and the second ActRIIB polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair ("B 2 ").
- a linker may be positioned between the ALK7 or ActRIIB polypeptide and the corresponding member of the interaction pair as well as between interaction pairs.
- Figure 9A is an example of an association of unguided interaction pairs, meaning that the members of the pair may associate with each other or self-associate without substantial preference and may have the same or different amino acid sequences.
- the first ActRIIB polypeptide (from left to right) is part of a fusion polypeptide that comprises a first member of an interaction pair ("Ci") and further comprises an additional first member of an interaction pair ("Ai"); and the second ActRIIB polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair (“B 2 ")
- the first ALK7 polypeptide (from left to right) is part of a fusion polypeptide that comprises a second member of an interaction pair ("Bi"); and the second ALK7 polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair ("C 2 ") and further comprises a first member of an interaction pair ("A 2 ").
- a linker may be positioned between the ALK7 or ActRIIB
- Figure 9B is an example of an association of guided (asymmetric) interaction pairs, meaning that the members of the pair associate preferentially with each other rather than self-associate.
- Suitable interaction pairs included, for example, heavy chain and/or light chain immunoglobulin interaction pairs, truncations, and variants thereof as described herein [e.g., Spiess et al (2015) Molecular Immunology 67(2A): 95-106].
- Complexes of higher order can be envisioned. See Figure 9C-9F.
- interaction pairs may be used to produce ALK7:ActRIIB heterodimers that resemble antibody Fab and F(ab') 2 complexes [e.g., Spiess et al (2015) Molecular Immunology 67(2A): 95-106].
- Figure 9G See Figure 9G.
- Figures 10A and 10B show schematic examples of a heteromeric protein complex comprising an ALK7 polypeptide (e.g. a polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ALK7 protein from humans or other species as described herein, e.g., SEQ ID Nos: 9, 10, 19, 20, 38, 39, 42, 43, 46, 74, 76, 79, and 80), an ActRIIB polypeptide (e.g.
- an ALK7 polypeptide e.g. a polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ALK7 protein from humans or other species as described herein, e.g., SEQ ID Nos: 9, 10, 19, 20, 38, 39,
- a polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ActRIIB protein from humans or other species as such as those described herein, e.g., SEQ ID Nos: 1, 2, 3, 4, 5, 6, 71, 73, 77, and 78), and a ligand-binding domain of an antibody (e.g., a ligand binding domain derived from an antibody that binds to one or more ALK7: ActRIIB-binding ligands).
- an antibody e.g., a ligand binding domain derived from an antibody that binds to one or more ALK7: ActRIIB-binding ligands.
- the ALK7 polypeptide is part of a fusion polypeptide that comprises a first member of an interaction pair ("Ci"), and further comprises an additional first member of an interaction pair ("Ai").
- the ActRIIB polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair ("Bi").
- the variable heavy chain (V H ) polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair ("C 2 "), and further comprises a first member of an interaction pair ("A 2 ").
- variable heavy chain (V L ) polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair ("B 2 ")
- a linker may be positioned between the ALK7 or ActRIIB polypeptide and the corresponding member of the interaction pair, between interaction pairs, and between the V H and V L polypeptides and a member of the interaction pair.
- a 1 and A 2 may be the same or different;
- Bi and B 2 may be the same or different, and C 1 and C 2 may be the same or different.
- Suitable interaction pairs included, for example, constant heavy chain and/or light chain immunoglobulin interaction pairs, truncations, and variants thereof as described herein [e.g., Spiess et al (2015) Molecular Immunology 67(2A): 95-106].
- Figure 10A is an example of an association of guided (asymmetric) interaction pairs, meaning that the members of the pair associate preferentially with each other rather than self-associate.
- Figure 10B is an example of an association of unguided interaction pairs, meaning that the members of the pair may associate with each other or self-associate without substantial preference and may have the same or different amino acid sequences.
- Such antibody-ALK7:ActRIIB complexes may be useful in situations where it is desirable to further bind/antagonize an agent that is not an ALK7: ActRIIB ligand.
- antibody-ALK7:ActRIIB complexes may be useful in situations where it is desirable to further enhance ALK7:ActRIIB ligand binding/antagonism.
- an ALK7:ActRIIB heterodimer has high affinity for several ligands including, e.g., activin B and activin AC.
- ALK7:ActRIIB heterodimers bind to GDF3 but with weaker affinity.
- GDF3 may be outcompeted for binding to an ALK7:ActRIIB heterodimer.
- addition of binding domain of an anti-GDF3 antibody to the ALK7: ActRIIB heteromultimer complex would improve the capacity of the protein complex to antagonize GDF3 in addition to one or more of the higher affinity
- ALK7:ActRIIB binding-ligands e.g., activin B, and activin AC.
- Figure 11 shows schematic examples of ALK7:ActRIIB single-trap polypeptides.
- ALK7:ActRIIB single-trap polypeptides may contain multiple ALK7 domains (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more domains), having the same or different sequences, and multiple ActRIIB domains (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more domains), having the same or different sequences.
- ALK7 and ActRIIB domains may be arranged in any order and may comprise one or more linker domains positions between one or more of the ALK7 and ActRIIB domains.
- Such ligand traps may be useful as therapeutic agents to treat or prevent diseases or disorders described herein.
- Figure 12A-12D show schematic examples of multimeric protein complexes comprising at least one ALK7:ActRIIB single-chain trap polypeptide.
- a first ALK7: ActRIIB single-chain trap polypeptide (from left to right) is part of a fusion polypeptide that comprises a first member of an interaction pair ("Ci"); and a second ALK7:ActRIIB single-chain trap polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair ("C 2 ").
- Ci and C 2 may be the same or different.
- the first and second ALK7:ActRIIB single-chain trap polypeptides may be the same or different.
- a linker may be positioned between the ALK7:ActRIIB single-chain trap polypeptide and the corresponding member of the interaction pair.
- Suitable interaction pairs included, for example, heavy chain and/or light chain immunoglobulin interaction pairs, truncations, and variants thereof as described herein [e.g., Spiess et al (2015) Molecular Immunology 67(2A): 95-106].
- Figure 12A is an example of an association of unguided interaction pairs, meaning that the members of the pair may associate with each other or self-associate without substantial preference and may have the same or different amino acid sequences.
- Figure 12B is an example of an association of guided (asymmetric) interaction pairs, meaning that the members of the pair associate preferentially with each other rather than self-associate. Complexes of higher order can be envisioned.
- ALK7:ActRIIB single-chain trap polypeptides may be similarly be associated, covalently or non-covalently, with one or more ALK7 polypeptides and/or one or more ActRIIB polypeptides. See Figure 12C.
- ALK7:ActRIIB single-chain trap polypeptides may be similarly be associated, covalently or non-covalently, with one or more ligand-binding domain of an antibody (e.g., a ligand binding domain of an antibody that binds to one or more ALK7:ActRIIB binding-ligands). See Figure 12D.
- Figures 13A-13C shows gene expression profiles of fibrotic genes (Col lal, Col3al, Fibronectin, PAI-1, CTGF, and a-SMA), inflammatory genes (Tnfa, and MCP1), cytokine genes (Tgfb l, Tgfb2, Tgfb3, and activin A), kidney injury gene (NGAL), Hypoxia-inducible factor 1 -alpha (HIF la), and activin A receptor (Acvr2A) from mouse kidneys subjected to unilateral ureteral obstruction (UUO). Samples from the contralateral, non-surgery kidney were used as a control (Ctrl). Gene expression profiles were obtained at 3 days and 17 days post-surgery.
- mice were administered either PBS or an ALK7-Fc:ActRIIB-Fc homodimer at days 3, 7, 10, and 14 post-surgery.
- Statistics was performed using a one-way ANOVA followed by Tukey analysis.
- (*) denotes a statistical difference between i) control samples compared to UUO kidneys at 3 days or ii) control samples compared to UUO kidneys at 17 days in mice administered the ALK7-Fc: ActRIIB-Fc homodimer.
- ($) denotes a statistical difference between UUO kidneys at 17 days in mice administered only PBS compared with UUO kidneys at 17 days in mice administered the ALK7-Fc: ActRIIB-Fc homodimer.
- (@) denotes that no transcript was detected.
- heteromultimers comprising a TGFP superfamily type I receptor polypeptide and a TGFP superfamily type II receptor polypeptide, uses thereof, and methods of making such heteromultimers. See, e.g., Figures 1 and 2.
- heteromultimers comprise an extracellular domain of a TGFp superfamily type I receptor polypeptide and an extracellular domain of a TGFP superfamily type II receptor polypeptide.
- the disclosure provides heteromultimers comprising an ALK7 polypeptide and an ActRIIB polypeptide.
- ALK7:ActRIIB heteromultimers have an altered TGFP superfamily ligand binding profile/specificity compared to a corresponding sample of a homomultimer (e.g., an ALK7: ActRIIB heterodimer compared to an ActRIIB : ActRIIB homodimer or an
- TGF- ⁇ superfamily is comprised of over 30 secreted factors including TGF-betas, activins, nodals, bone morphogenetic proteins (BMPs), growth and differentiation factors (GDFs), and anti-Mullerian hormone (AMH) [Weiss et al. (2013) Developmental Biology, 2(1): 47-63].
- BMPs bone morphogenetic proteins
- GDFs growth and differentiation factors
- AMH anti-Mullerian hormone
- TGF- ⁇ superfamily proteins are key mediators of stem cell self-renewal, gastrulation, differentiation, organ morphogenesis, and adult tissue homeostasis. Consistent with this ubiquitous activity, aberrant TGF-beta superfamily signaling is associated with a wide range of human pathologies including, for example, autoimmune disease, cardiovascular disease, fibrotic disease, and cancer.
- Ligands of the TGF-beta superfamily share the same dimeric structure in which the central 3-1/2 turn helix of one monomer packs against the concave surface formed by the beta-strands of the other monomer.
- the majority of TGF-beta family members are further stabilized by an intermolecular disulfide bond. This disulfide bonds traverses through a ring formed by two other disulfide bonds generating what has been termed a 'cysteine knot' motif [Lin et al. (2006) Reproduction 132: 179-190; and Hinck et al. (2012) FEBS Letters 586: 1860-1870].
- TGF-beta superfamily signaling is mediated by heteromeric complexes of type I and type II serine/threonine kinase receptors, which phosphorylate and activate downstream
- SMAD proteins ⁇ e.g., SMAD proteins 1, 2, 3, 5, and 8 upon ligand stimulation [Massague (2000) Nat. Rev. Mol. Cell Biol. 1 : 169-178].
- type I and type II receptors are transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine- rich region, a transmembrane domain, and a cytoplasmic domain with predicted
- type I receptors mediate intracellular signaling while the type II receptors are required for binding TGF-beta superfamily ligands.
- Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors.
- the TGF-beta family can be divided into two phylogenetic branches based on the type I receptors they bind and the Smad proteins they activate.
- the other branch comprises the more distantly related proteins of the superfamily and includes, e.g., BMP2, BMP4, BMP5, BMP6, BMP7, BMP 8 a, BMP 8b, BMP9, BMP 10, GDF1, GDF5, GDF6, and GDF7, which signal through Smads 1, 5, and 8.
- BMP2, BMP4, BMP5, BMP6, BMP7, BMP 8 a, BMP 8b, BMP9, BMP 10, GDF1, GDF5, GDF6, and GDF7 which signal through Smads 1, 5, and 8.
- TGF-beta isoforms are the founding members of the TGF-beta superfamily, of which there are 3 known isoforms in mammals designated as TGF-betal, TGF-beta2 and TGF-beta3. Mature bioactive TGF-beta ligands function as homodimers and predominantly signal through the type I receptor ALK5, but have also been found to additionally signal through ALK1 in endothelial cells [Goumans et al. (2003) Mol Cell 12(4): 817-828]. TGF-betal is the most abundant and ubiquitously expressed isoform.
- TGF-betal is known to have an important role in wound healing, and mice expressing a constitutively active TGF-betal transgene develop fibrosis [Clouthier et al. (1997) J Clin. Invest. 100(11): 2697-2713]. TGF- betal is also involved in T cell activation and maintenance of T regulatory cells [Li et al. (2006) Immunity 25(3): 455-471]. TGF-beta2 expression was first described in human glioblastoma cells, and is occurs in neurons and astroglial cells of the embryonic nervous system. TGF-beta2 is known to suppress interleukin-2-dependent growth of T lymphocytes.
- TGF-beta3 was initially isolated from a human rhabdomyosarcoma cell line and since has been found in lung adenocarcinoma and kidney carcinoma cell lines. TGF-beta3 is known to be important for palate and lung morphogenesis [Kubiczkova et al. (2012) Journal of
- Activins are members of the TGF-beta superfamily and were initially discovered as regulators of secretion of follicle-stimulating hormone, but subsequently various reproductive and non-reproductive roles have been characterized.
- the human genome also encodes an activin C and an activin E, which are primarily expressed in the liver, and heterodimeric forms containing p c or ⁇ ⁇ are also known.
- activins are unique and multifunctional factors that can stimulate hormone production in ovarian and placental cells, support neuronal cell survival, influence cell-cycle progress positively or negatively depending on cell type, and induce mesodermal differentiation at least in amphibian embryos [DePaolo et al. (1991) Proc Soc Ep Biol Med. 198:500-512; Dyson et al. (1997) Curr Biol. 7:81-84; and Woodruff (1998)
- activin signaling is antagonized by its related heterodimer, inhibin.
- FSH follicle-stimulating hormone
- Other proteins that may regulate activin bioactivity and/or bind to activin include follistatin (FS), follistatin-related protein (FSRP, also known as FLRG or FSTL3), and a2-macroglobulin.
- agents that bind to "activin A” are agents that specifically bind to the PA subunit, whether in the context of an isolated PA subunit or as a dimeric complex (e.g., a PAPA homodimer or a PAPB heterodimer).
- agents that bind to "activin A” are specific for epitopes present within the PA subunit, but do not bind to epitopes present within the non-p A subunit of the complex (e.g., the PB subunit of the complex).
- agents disclosed herein that antagonize (inhibit) "activin A” are agents that inhibit one or more activities as mediated by a PA subunit, whether in the context of an isolated PA subunit or as a dimeric complex (e.g., a PAPA homodimer or a PAPB heterodimer).
- agents that inhibit "activin A” are agents that specifically inhibit one or more activities of the PA subunit, but do not inhibit the activity of the non-PA subunit of the complex (e.g., the PB subunit of the complex). This principle applies also to agents that bind to and/or inhibit "activin B", "activin C", and
- activin E Agents disclosed herein that antagonize "activin AB” are agents that inhibit one or more activities as mediated by the PA subunit and one or more activities as mediated by the PB subunit. The same principle also applies to agents that bind to and/or inhibit "activin AC", “activin AE”, “activin BC” or “activin BE”. Nodal proteins have functions in mesoderm and endoderm induction and formation, as well as subsequent organization of axial structures such as heart and stomach in early embryogenesis. It has been demonstrated that dorsal tissue in a developing vertebrate embryo contributes predominantly to the axial structures of the notochord and pre-chordal plate while it recruits surrounding cells to form non-axial embryonic structures.
- ActRIIA and ActRIIB serve as type II receptors for nodal [Sakuma et al. (2002) Genes Cells. 2002, 7:401-12]. It is suggested that Nodal ligands interact with their co-factors (e.g., Crypto or Cryptic) to activate activin type I and type II receptors, which phosphorylate SMAD2.
- Nodal proteins are implicated in many events critical to the early vertebrate embryo, including mesoderm formation, anterior patterning, and left-right axis specification.
- the BMPs and GDFs together form a family of cysteine-knot cytokines sharing the characteristic fold of the TGF-beta superfamily [Rider et al. (2010) Biochem J., 429(1): 1-12].
- This family includes, for example, BMP2, BMP4, BMP6, BMP7, BMP2a, BMP3, BMP3b (also known as GDF10), BMP4, BMP5, BMP6, BMP7, BMP8, BMP8a, BMP 8b, BMP9 (also known as GDF2), BMP 10, BMP11 (also known as GDF11), BMP 12 (also known as GDF7), BMP 13 (also known as GDF6), BMP 14 (also known as GDF5), BMP15, GDF1, GDF3 (also known as VGR2), GDF8 (also known as myostatin), GDF9, GDF15, and decapentaplegic.
- BMP/GDFs display morphogenetic activities in the development of a wide range of tissues.
- BMP/GDF homo- and hetero-dimers interact with combinations of type I and type II receptor dimers to produce multiple possible signaling complexes, leading to the activation of one of two competing sets of SMAD transcription factors.
- BMP/GDFs have highly specific and localized functions. These are regulated in a number of ways, including the developmental restriction of BMP/GDF expression and through the secretion of several specific BMP antagonist proteins that bind with high affinity to the cytokines. Curiously, a number of these antagonists resemble TGF-beta superfamily ligands.
- GDF8 Growth and differentiation factor-8
- GDF8 is a negative regulator of skeletal muscle mass and is highly expressed in developing and adult skeletal muscle.
- the GDF8 null mutation in transgenic mice is characterized by a marked hypertrophy and hyperplasia of skeletal muscle [McPherron et al. Nature (1997) 387:83-90].
- Similar increases in skeletal muscle mass are evident in naturally occurring mutations of GDF8 in cattle and, strikingly, in humans [Ashmore et al. (1974) Growth, 38:501-507;
- GDF8 can modulate the production of muscle-specific enzymes ⁇ e.g., creatine kinase) and modulate myoblast cell proliferation [International Patent Application Publication No. WO 00/43781].
- the GDF8 propeptide can noncovalently bind to the mature GDF8 domain dimer, inactivating its biological activity [Miyazono et al. (1988) J. Biol. Chem., 263 : 6407-6415; Wakefield et al. (1988) J. Biol. Chem., 263; 7646-7654; and Brown et al. (1990) Growth Factors, 3 : 35-43].
- Other proteins which bind to GDF8 or structurally related proteins and inhibit their biological activity include follistatin, and potentially, follistatin-related proteins [Gamer et al. (1999) Dev. Biol., 208: 222-232].
- GDF11 also known as BMP11, is a secreted protein that is expressed in the tail bud, limb bud, maxillary and mandibular arches, and dorsal root ganglia during mouse
- GDF11 plays a unique role in patterning both mesodermal and neural tissues [Gamer et al. (1999) Dev Biol., 208:222-32]. GDF11 was shown to be a negative regulator of chondrogenesis and myogenesis in developing chick limb [Gamer et al. (2001) Dev Biol., 229:407-20]. The expression of GDF11 in muscle also suggests its role in regulating muscle growth in a similar way to GDF8.
- GDF11 may also possess activities that relate to the function of the nervous system.
- GDF11 was found to inhibit neurogenesis in the olfactory epithelium [Wu et al. (2003) Neuron., 37: 197-207].
- inhibitors of GDF11 may have in vitro and in vivo applications in the treatment of diseases such as muscle diseases and neurodegenerative diseases ⁇ e.g., amyotrophic lateral sclerosis).
- BMP7 also called osteogenic protein-1 (OP-1)
- OP-1 osteogenic protein-1
- BMP7 regulates a wide array of physiological processes.
- BMP7 may be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. It is also found that BMP7 plays a role in calcium regulation and bone homeostasis.
- BMP7 binds to type II receptors, ActRIIA and ActRIIB.
- BMP7 and activin recruit distinct type I receptors into heteromeric receptor complexes.
- the ALK7:ActRIIB heterodimer displays enhanced binding to activin C, activin AC, and BMP5 compared to either homodimer, and retains strong binding to activin B as observed with the ActRIIB homodimer.
- the ALK7:ActRIIB heterodimer exhibits reduced binding to GDF11, GDF8, activin A, BMP 10, BMP6, GDF3, and BMP9 compared to the ActRIIB homodimer.
- BMP9 displays low or no observable affinity for the ALK7:ActRIIB heterodimer, whereas this ligand binds tightly to ActRIIB homodimer.
- ActRIIB heterodimers are more selective antagonists of activin B, activin C, activin AC, and BMP5 compared to ActRIIB homodimers. Additionally, it is expected that such heterodimers will bind tightly to Activin BC, given the binding to Activins B and C. Additionally, it is expected that such
- an ALK7:ActRIIB heterodimer may be more useful than an ActRIIB homodimer in certain applications where such selective antagonism is advantageous. Examples include therapeutic applications where it is desirable to retain antagonism of one or more of activin B, activin C, activin AC, activin BC, activin E, activin AE, activin BE and BMP5 but minimize antagonism of one or more of activin A, BMP9, BMP10, GDF3, and BMP6.
- ALK7: ActRIIB heterodimers exert beneficial catabolic effects on adipose tissue.
- the ALK7:ActRIIB heterodimers described herein are shown to have potent protective effects in a model of chronic kidney disease, with effects including the inhibition of fibrosis and inflammation.
- an ActRIIB :ALK7 heterodimer exhibits only low-affinity or transient binding to BMP9 and so will have little to no concurrent inhibition on processes mediated by BMP9, such as angiogenesis. This novel selectivity will be useful, for example, in treating patients in need of inhibitory effects on fat, or protective effects on the kidney, but not in need of altered angiogenesis.
- heteromer or “heteromultimer” is a complex comprising at least a first polypeptide chain and a second polypeptide chain, wherein the second polypeptide chain differs in amino acid sequence from the first polypeptide chain by at least one amino acid residue.
- the heteromer can comprise a "heterodimer” formed by the first and second polypeptide chains or can form higher order structures where one or more polypeptide chains in addition to the first and second polypeptide chains are present.
- heteromultimer examples include heterodimers, heterotrimers, heterotetramers and further oligomeric structures.
- Heterodimers are designated herein as X: Y or equivalently as X-Y, where X represents a first polypeptide chain and Y represents a second polypeptide chain.
- Higher-order heteromers and oligomeric structures are designated herein in a corresponding manner.
- a heteromultimer is recombinant (e.g., one or more polypeptide components may be a recombinant protein), isolated and/or purified.
- the term “homologous,” when modified with an adverb such as "highly,” may refer to sequence similarity and may or may not relate to a common evolutionary origin.
- sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin.
- Percent (%) sequence identity with respect to a reference polypeptide (or nucleotide) sequence is defined as the percentage of amino acid residues (or nucleic acids) in a candidate sequence that are identical to the amino acid residues (or nucleic acids) in the reference polypeptide (nucleotide) sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
- Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid (nucleic acid) sequence identity values are generated using the sequence comparison computer program ALIGN-2.
- the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U. S.
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif, or may be compiled from the source code.
- the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- Alternize in all its grammatical forms, refers to the process of activating a protein and/or gene (e.g., by activating or amplifying that protein' s gene expression or by inducing an inactive protein to enter an active state) or increasing a protein' s and/or gene's activity.
- “Antagonize”, in all its grammatical forms, refers to the process of inhibiting a protein and/or gene (e.g., by inhibiting or decreasing that protein' s gene expression or by inducing an active protein to enter an inactive state) or decreasing a protein's and/or gene' s activity.
- does not substantially bind to JL is intended to mean that an agent has a K D that is greater than about 10 "7 , 10 "6 , 10 “5 , 10 “4 , or greater (e.g., no detectable binding by the assay used to determine the K D ) for "JL", wherein "JL” is a specified agent such as protein or nucleic acid.
- the terms “about” and “approximately” may mean values that are within an order of magnitude, preferably ⁇ 5 -fold and more preferably ⁇ 2-fold of a given value.
- ActRIIB ALK7 Antagonists
- ALK7:ActRIIB heterodimers have a unique ligand-binding profile/selectivity compared to corresponding ActRIIB and ALK7 homodimers.
- four of the five ligands with the strongest binding to ActRIIB homodimer exhibit reduced binding to the
- ALK7 ActRIIB heterodimer, the exception being activin B which retains tight binding to the heterodimer.
- three of the four ligands with intermediate binding to ActRIIB homodimer exhibit reduced binding to the
- ALK7:ActRIIB heterodimer whereas binding to activin AC is increased to become the second strongest ligand interaction with the heterodimer overall.
- activin C and BMP5 unexpectedly bind the ALK7: ActRIIB heterodimer with intermediate strength despite no binding (activin C) or weak binding (BMP5) to ActRIIB homodimer. Given the binding to activin B and activin C, it is expected that the ALK7: ActRIIB heterodimer binds tightly to activin BC.
- ALK7: ActRIIB heterodimer possesses a ligand-binding profile distinctly different from that of either ActRIIB homodimer or ALK7 homodimer, which binds none of the foregoing ligands.
- ALK7: ActRIIB heteromultimers are more selective antagonist of activin B, activin AC and Activin BC compared to ActRIIB homomultimers.
- ALK7:ActRIIB heterodimer exhibits the unusual property of robust binding to activin C. Accordingly, an ALK7:ActRIIB heteromultimers will be more useful than an ActRIIB homomultimers in certain applications where such selective antagonism is advantageous.
- ALK7:ActRIIB heteromultimers are surprisingly effective in ameliorating various complications of kidney disease (e.g., treating or preventing kidney injury, inflammation, and damage) as well as exerting beneficial anabolic adipose cells.
- ALK7: ActRIIB heteromultimers may exert biological effects through a mechanism other than ligand inhibition [e.g., inhibition of one or more of activin B, activin AC, activin C, GDF11, GDF8, activin A, BMP 10, BMP6, BMP5, nodal, and GDF3 may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of additional agents, including, perhaps, other members of the TGF-beta superfamily, and such collective inhibition may lead to a desired effect on, for example, kidney disease or a metabolic disorder], other types of TGF-beta superfamily ligand antagonists as well as type I and type II receptor antagonists (e.g., natural ligand traps such as follistatin and Lefty, antibodies, inhibitor
- the present disclosure relates to heteromultimers comprising one or more ALK7 receptor polypeptides (e.g., SEQ ID NOs: 9, 10, 19, 20, 38, 39, 42, 43, 46, 74, 76, 79, and 80) and one or more ActRIIB receptor polypeptides (e.g., SEQ ID NOs: 1, 2, 3, 4, 5, 6, 71, 73, 77, and 78), which are generally referred to herein as "ALK7:ActRIIB
- heteromultimer complexes or "ALK7:ActRIIB heteromultimers”.
- ALK7:ActRIIB heteromultimers Preferably,
- ALK7:ActRIIB heteromultimers of the disclosure are soluble, for example, a heteromultimer may comprises a soluble portion (domain) of an ALK7 receptor and a soluble portion
- heteromultimers of the disclosure comprise an extracellular domain of an ALK7 receptor and an extracellular domain of an ActRIIB receptor.
- Example extracellular domains of ALK7 and ActRIIB receptors are disclosed herein and these sequences, as well as fragments, functional variants, and modified forms thereof, may be used in accordance with the inventions of the disclosure (e.g., ALK7: ActRIIB heteromultimers and uses thereof).
- ALK7:ActRIIB heteromultimers of the disclosure include, e.g., heterodimers, heterotrimers, heterotetramers and higher order oligomeric structures. See, e.g., Figures 1, 2, and 8-10.
- heteromultimers of the disclosure are ALK7:ActRIIB heterodimers.
- ALK7:ActRIIB heteromultimers of the disclosure bind to one or more TGF-beta superfamily ligands.
- ALK7:ActRIIB heteromultimers bind to one or more of activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin AE, activin BC, and activin BE), GDF8, and GDF11.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin AE, activin BC, and activin BE
- GDF8 GDF11
- ALK7: ActRIIB heteromultimers further bind to BMP6.
- ALK7:ActRIIB heteromultimers further bind to BMPIO.
- ALK7:ActRIIB heteromultimers further bind to BMP5.
- ALK7: ActRIIB heteromultimers further bind to GDF3.
- ALK7: ActRIIB heteromultimers further bind to nodal.
- ALK7:ActRIIB heteromultimers further bind to BMP10.
- ALK7: ActRIIB heteromultimers do not bind or do not substantially bind to BMP9.
- ALK7:ActRIIB heteromultimers bind one or more of GDF11, GDF8, activin A, BMP10, BMP6, GDF3, and BMP9 with weaker affinity compared to a corresponding ActRIIB homomultimer.
- ALK7:ActRIIB heteromultimers bind one or more of activin C, activin AC, activin BC, and BMP5 with stronger affinity compared to a corresponding ActRIIB homomultimer.
- ALK7:ActRIIB heteromultimers further bind to one or more of BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP7, BMP8a, BMP8b, GDF5, GDF6/BMP13, GDF7,
- GDF9b/BMP15 GDF15/MIC1, TGF- ⁇ , TGF-p2, TGF-p3, glial cell-derived neurotrophic factor (GD F), neurturin, artemin, persephin, MIS, and Lefty.
- GD F glial cell-derived neurotrophic factor
- TGF-beta superfamily ligand-binding ALK7: ActRIIB heteromultimers may be used to inhibit (antagonize) signaling (e.g., Smad 2/3 and/or Smad 1/5/8 signaling) mediated by one or more TGFP superfamily ligands.
- ALK7:ActRIIB heteromultimers of the disclosure may be used to inhibit signaling by one or more TGFP superfamily ligands in, for example, a cell-based assay such as those described herein.
- ALK7:ActRIIB heteromultimers inhibit signaling mediated by one or more of e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF11, GDF8, BMP10, BMP6, BMP 5, nodal, and GDF3 in a cell-based assay.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- ALK7:ActRIIB heteromultimers may further inhibit BMP6 signaling in a cell-based assay.
- ALK7:ActRIIB heteromultimers may further inhibit GDF3 signaling in a cell-based assay.
- ALK7:ActRIIB heteromultimers may further inhibit nodal signaling in a cell-based assay.
- ALK7:ActRIIB heteromultimers may further inhibit BMP5 signaling in a cell-based assay.
- ALK7:ActRIIB heteromultimers may further inhibit signaling BMPIO signaling in a cell- based assay.
- ALK7:ActRIIB heteromultimers do not inhibit or do not substantially inhibit signaling mediated by BMP9 in a cell-based assay.
- ALK7:ActRIIB heteromultimers have a weaker inhibitory effect on signaling mediated by one or more of GDF11, GDF8, activin A, BMP10, BMP6, GDF3, and BMP9 compared to a corresponding ActRIIB homomultimer in a cell-based assay.
- ALK7:ActRIIB heteromultimers have a stronger inhibitory effect on signaling mediated by one or more of activin AC, activin BC, activin C, and BMP5 compared to a corresponding ActRIIB homomultimer in a cell-based assay.
- ALK7:ActRIIB heteromultimers may further inhibit signaling by one or more of BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP7, BMP 8 a, BMP8b, GDF5, GDF6/BMP13, GDF7, GDF9b/BMP15, GDF15/MIC1, TGF- ⁇ , TGF-p2, TGF-p3, glial cell-derived neurotrophic factor (GD F), neurturin, artemin, persephin, MIS, and Lefty in a cell-based assay.
- BMP2/7 BMP3, BMP4, BMP4/7
- BMP7, BMP 8 a BMP8b
- GDF5 GDF6/BMP13
- GDF7 GDF9b/BMP15
- GDF15/MIC1 TGF- ⁇ , TGF-p2, TGF-p3, glial cell-derived neurotrophic factor (GD F), neurturin, artemin, persephin, MIS
- ActRIIB refers to a family of activin receptor type IIB (ActRIIB) proteins from any species and variants derived from such ActRIIB proteins by mutagenesis or other modification. Reference to ActRIIB herein is understood to be a reference to any one of the currently identified forms. Members of the ActRIIB family are generally transmembrane proteins, composed of a ligand-binding extracellular domain comprising a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
- ActRIIB polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ActRIIB family member as well as any variants thereof
- the human ActRIIB precursor protein sequence is as follows:
- the signal peptide is indicated with a single underline; the extracellular domain is indicated in bold font; and the potential, endogenous N-linked glycosylation sites are indicated with a double underline.
- the processed (mature) extracellular ActRIIB polypeptide sequence is as follows:
- the protein may be produced with an "SGR" sequence at the N-terminus.
- the C-terminal "tail" of the extracellular domain is indicated by a single underline.
- the sequence with the "tail” deleted is as follows:
- a form of ActRIIB with an alanine at position 64 of SEQ ID NO: 1 (A64) is also reported in the literature. See, e.g., Hilden et al. (1994) Blood, 83(8): 2163-2170. Applicants have ascertained that an ActRIIB-Fc fusion protein comprising an extracellular domain of ActRIIB with the A64 substitution has a relatively low affinity for activin and GDF11. By contrast, the same ActRIIB-Fc fusion protein with an arginine at position 64 (R64) has an affinity for activin and GDF11 in the low nanomolar to high picomolar range. Therefore, sequences with an R64 are used as the "wild-type" reference sequence for human ActRIIB this disclosure.
- the signal peptide is indicated by single underline and the extracellular domain is indicated by bold font.
- the processed (mature) extracellular ActRIIB polypeptide sequence of the alternative A64 form is as follows:
- the protein may be produced with an "SGR" sequence at the N-terminus.
- the C-terminal "tail" of the extracellular domain is indicated by single underline.
- the sequence with the "tail” deleted (a ⁇ 15 sequence) is as follows:
- a nucleic acid sequence encoding the human ActRIIB precursor protein is shown below (SEQ ID NO: 7), representing nucleotides 25-1560 of Genbank Reference Sequence NM OOl 106.3, which encode amino acids 1-513 of the ActRIIB precursor.
- the sequence as shown provides an arginine at position 64 and may be modified to provide an alanine instead.
- the signal sequence is underlined.
- a nucleic acid sequence encoding processed extracellular human ActRIIB polypeptide is shown below (SEQ ID NO: 8). The sequence as shown provides an arginine at position 64, and may be modified to provide an alanine instead.
- FIG. 3 An alignment of the amino acid sequences of human ActRIIB extracellular domain and human ActRIIA extracellular domain are illustrated in Figure 3. This alignment indicates amino acid residues within both receptors that are believed to directly contact ActRII ligands.
- the composite ActRII structures indicated that the ActRIIB-ligand binding pocket is defined, in part, by residues Y31, N33, N35, L38 through T41, E47, E50, Q53 through K55, L57, H58, Y60, S62, K74, W78 through N83, Y85, R87, A92, and E94 through F101. At these positions, it is expected that conservative mutations will be tolerated.
- an active, human ActRIIB variant polypeptide useful in accordance with the presently disclosed methods may include one or more amino acids at corresponding positions from the sequence of another vertebrate
- ActRIIB may include a residue that is similar to that in the human or other vertebrate sequences. Without meaning to be limiting, the following examples illustrate this approach to defining an active ActRIIB variant.
- L46 in the human extracellular domain (SEQ ID NO: 53) is a valine in Xenopus ActRIIB (SEQ ID NO: 55), and so this position may be altered, and optionally may be altered to another hydrophobic residue, such as V, I or F, or a non- polar residue such as A.
- E52 in the human extracellular domain is a K in Xenopus, indicating that this site may be tolerant of a wide variety of changes, including polar residues, such as E, D, K, R, H, S, T, P, G, Y and probably A.
- T93 in the human extracellular domain is a K in Xenopus, indicating that a wide structural variation is tolerated at this position, with polar residues favored, such as S, K, R, E, D, H, G, P, G and Y.
- F108 in the human extracellular domain is a Y in Xenopus, and therefore Y or other hydrophobic group, such as I, V or L should be tolerated.
- El 11 in the human extracellular domain is K in Xenopus, indicating that charged residues will be tolerated at this position, including D, R, K and H, as well as Q and N.
- Rl 12 in the human extracellular domain is K in Xenopus, indicating that basic residues are tolerated at this position, including R and H.
- a at position 119 in the human extracellular domain is relatively poorly conserved, and appears as P in rodents and V in Xenopus, thus essentially any amino acid should be tolerated at this position.
- ActRII proteins have been characterized in the art in terms of structural and functional characteristics, particularly with respect to ligand binding [Attisano et al. (1992) Cell 68(1):97-108; Greenwald et al. (1999) Nature Structural Biology 6(1): 18-22; Allendorph et al. (2006) PNAS 103(20: 7643-7648; Thompson et al. (2003) The EMBO Journal 22(7): 1555-1566; as well as U.S. Patent Nos: 7,709,605, 7,612,041, and 7,842,663].
- these references provide amply guidance for how to generate ActRIIB variants that retain one or more normal activities (e.g., ligand-binding activity).
- a defining structural motif known as a three-finger toxin fold is important for ligand binding by type I and type II receptors and is formed by conserved cysteine residues located at varying positions within the extracellular domain of each monomelic receptor [Greenwald et al. (1999) Nat Struct Biol 6: 18-22; and Hinck (2012) FEBS Lett 586: 1860-1870]. Accordingly, the core ligand-binding domains of human ActRIIB, as demarcated by the outermost of these conserved cysteines, corresponds to positions 29-109 of SEQ ID NO: 1 (ActRIIB precursor).
- the structurally less-ordered amino acids flanking these cysteine-demarcated core sequences can be truncated by about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 residues at the N-terminus and/or by about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 residues a the C-terminus without necessarily altering ligand binding.
- Exemplary ActRIIB extracellular domains for N-terminal and/or C-terminal truncation include SEQ ID NOs: 2, 3, 5, and 6. Attisano et al.
- An ActRIIB- Fc fusion protein containing amino acids 20-119 of present SEQ ID NO: 1, "ActRIIB(20- 119)-Fc”, has reduced binding to GDF11 and activin relative to an ActRIIB(20-134)-Fc, which includes the proline knot region and the complete juxtamembrane domain (see, e.g., U.S. Patent No. 7,842,663).
- an ActRIIB(20-129)-Fc protein retains similar, but somewhat reduced activity, relative to the wild-type, even though the proline knot region is disrupted.
- ActRIIB extracellular domains that stop at amino acid 134, 133, 132, 131, 130 and 129 are all expected to be active, but constructs stopping at 134 or 133 may be most active.
- mutations at any of residues 129-134 are not expected to alter ligand-binding affinity by large margins.
- mutations of P129 and P130 do not substantially decrease ligand binding.
- an ActRIIB polypeptide of the present disclosure may end as early as amino acid 109 (the final cysteine), however, forms ending at or between 109 and 119 (e.g., 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, or 119) are expected to have reduced ligand binding.
- Amino acid 119 (with respect to present SEQ ID NO: 1) is poorly conserved and so is readily altered or truncated.
- ActRIIB polypeptides ending at 128 (with respect to SEQ ID NO: 1) or later should retain ligand- binding activity.
- ActRIIB polypeptides ending at or between 119 and 127 ⁇ e.g., 119, 120, 121, 122, 123, 124, 125, 126, or 127), with respect to SEQ ID NO: 1, will have an
- ActRIIB polypeptides beginning at position 20, 21, 22, 23, and 24 should retain general ligand-biding activity
- ActRIIB polypeptides beginning at positions 25, 26, 27, 28, and 29 are also expected to retain ligand-biding activity. It has been demonstrated, e.g., U.S. Patent No. 7,842,663, that, surprisingly, an ActRIIB construct beginning at 22, 23, 24, or 25 will have the most activity.
- ActRIIB a general formula for an active portion (e.g., ligand-binding portion) of ActRIIB comprises amino acids 29-109 of SEQ ID NO: 1. Therefore ActRIIB
- polypeptides may, for example, comprise, consist essentially of, or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ActRIIB beginning at a residue corresponding to any one of amino acids 20-29 (e.g., beginning at any one of amino acids 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 and ending at a position corresponding to any one amino acids 109-134 (e.g., ending at any one of amino acids 109,
- Other examples include polypeptides that begin at a position from 20-29 (e.g., any one of positions 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29) or 21-29 (e.g., any one of positions 21, 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 and end at a position from 1 19-134 (e.g., any one of positions 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134), 1 19-133 (e.g., any one of positions 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, or 133), 129-134 (e.g., any one of positions 129, 130, 131, 132, 133, or 134), or 129-
- SEQ ID NO: 1 Other examples include constructs that begin at a position from 20-24 (e.g., any one of positions 20, 21, 22, 23, or 24), 21-24 (e.g., any one of positions 21, 22, 23, or 24), or 22-25 (e.g., any one of positions 22, 22, 23, or 25) of SEQ ID NO: 1 and end at a position from 109-134 (e.g., any one of positions 109, 1 10, 1 1 1, 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134), 1 19-134 (e.g., any one of positions 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134) or 129-134 (e.g., any one of positions 1 19, 120, 121, 122, 123
- ActRIIB variants comprise no more than 1, 2, 5, 6, 7, 8, 9, 10 or 15
- conservative amino acid changes in the ligand-binding pocket and zero, one, or more non- conservative alterations at positions 40, 53, 55, 74, 79 and/or 82 in the ligand-binding pocket.
- Sites outside the binding pocket include the amino and carboxy termini of the extracellular domain (as noted above), and positions 42-46 and 65-73 (with respect to SEQ ID NO: 1).
- An asparagine-to-alanine alteration at position 65 (N65 A) actually improves ligand binding in the A64 background, and is thus expected to have no detrimental effect on ligand binding in the R64 background [U.S. Patent No. 7,842,663].
- SEQ ID NO: 1 these include position 80 (acidic or hydrophobic amino acid), position 78 (hydrophobic, and particularly tryptophan), position 37 (acidic, and particularly aspartic or glutamic acid), position 56 (basic amino acid), position 60 (hydrophobic amino acid, particularly phenylalanine or tyrosine).
- positions that may be desirable to conserve are as follows: position 52 (acidic amino acid), position 55 (basic amino acid), position 81 (acidic), 98 (polar or charged, particularly E, D, R or K), all with respect to SEQ ID NO: 1.
- the disclosure relates to heteromultimers that comprise at least one ActRIIB polypeptide, which includes fragments, functional variants, and modified forms thereof.
- ActRIIB polypeptides for use in accordance with the disclosure are soluble (e.g., an extracellular domain of ActRIIB).
- ActRIIB polypeptides for use in accordance with the disclosure bind to one or more TGF- beta superfamily ligands. Therefore, in some embodiments, ActRIIB polypeptides for use in accordance with the disclosure inhibit (antagonize) activity (e.g., inhibition of Smad signaling) of one or more TGF-beta superfamily ligands.
- heteromultimers of the disclosure comprise at least one ActRIIB polypeptide that comprises, consists essentially of, or consists of an amino acid sequence that is at least 70%, 75%, 80%>, 85%>, 86%>, 87%, 88%>, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ActRIIB beginning at a residue corresponding to amino acids 20-29 (e.g., beginning at any one of amino acids 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 and ending at a position corresponding to amino acids 109-134 (e.g., ending at any one of amino acids 109, 110, 111, 112, 113, 114, 115, 1 16, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 13
- heteromultimers of the disclosure comprise at least one ActRIIB polypeptide that comprises, consists, or consists essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 29-109 of SEQ ID NO: 1.
- ActRIIB polypeptide that comprises, consists, or consists essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 29-109 of SEQ ID NO: 1.
- heteromultimers of the disclosure comprise at least one ActRIIB polypeptide that comprises, consists, or consists essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 25-131 of SEQ ID NO: 1.
- heteromultimers of the disclosure comprise at least one ActRIIB polypeptide that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%), or 100%) identical to the amino acid sequence of any one of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 71, 73, 77, and 78.
- heteromultimers of the disclosure comprise at least one ActRIIB polypeptide wherein the amino acid position corresponding to L79 of SEQ ID NO: 1 is not an acidic amino acid (i.e., is not a naturally occurring D or E amino acid residue or artificial acidic amino acid).
- the present disclosure relates to protein complexes that comprise an ALK7 polypeptide.
- ALK7 refers to a family of activin receptor- like kinase-7 proteins from any species and variants derived from such ALK7 proteins by mutagenesis or other modification. Reference to ALK7 herein is understood to be a reference to any one of the currently identified forms. Members of the ALK7 family are generally transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine- rich region, a transmembrane domain, and a cytoplasmic domain with predicted
- ALK7 polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ALK7 family member as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity.
- the signal peptide is indicated by a single underline and the extracellular domain is indicated in bold font.
- the processed extracellular ALK7 isoform 1 polypeptide sequence is as follows: ELSPGLKCVCLLCDSSNFTCQTEGACWAS ⁇ /MLTNGKEQVIKSCVSLPELNAQVFCHSSNNVT KTECCFTDFCNNITLHLPTASPNAPKLGPME (SEQ ID NO: 10)
- a nucleic acid sequence encoding human ALK7 isoform 1 precursor protein is shown below (SEQ ID NO: 11), corresponding to nucleotides 244-1722 of Genbank Reference Sequence NM 145259.2.
- the signal sequence is underlined and the extracellular domain is indicated in bold font.
- a nucleic acid sequence encoding the processed extracellular ALK7 polypeptide is as follows:
- amino acid sequence of an alternative isoform of human ALK7, isoform 2 (NCBI Ref Seq P 001104501.1), is shown in its processed form as follows (SEQ ID NO: 19), where the extracellular domain is indicated in bold font.
- amino acid sequence of the extracellular ALK7 polypeptide is as follows:
- a nucleic acid sequence encoding the processed ALK7 polypeptide (isoform 2) is shown below (SEQ ID NO: 21), corresponding to nucleotides 279-1607 of NCBI Reference Sequence NM 001111031.1. The extracellular domain is indicated in bold font.
- a nucleic acid sequence encoding the extracellular ALK7 polypeptide is as follows (SEQ ID NO: 22):
- amino acid sequence of an alternative human ALK7 precursor protein, isoform 3 (NCBI Ref Seq NP_001104502.1), is shown as follows (SEQ ID NO: 38), where the signal peptide is indicated by a single underline.
- the amino acid sequence of the processed ALK7 polypeptide is as follows (SEQ ID NO: 39). This isoform lacks a transmembrane domain and is therefore proposed to be soluble in its entirety (Roberts et al., 2003, Biol Reprod 68: 1719-1726). N- terminal variants of SEQ ID NO: 39 are predicted as described below.
- a nucleic acid sequence encoding the unprocessed ALK7 polypeptide precursor protein (isoform 3) is shown below (SEQ ID NO: 40), corresponding to nucleotides 244-1482 of NCBI Reference Sequence NM 001111032.1. The signal sequence is indicated by solid underline.
- amino acid sequence of an alternative human ALK7 precursor protein, isoform 4 (NCBI Ref Seq P_001104503.1), is shown as follows (SEQ ID NO: 42), where the signal peptide is indicated by a single underline.
- isoform 4 The amino acid sequence of the processed ALK7 polypeptide (isoform 4) is as follows (SEQ ID NO: 43). Like ALK7 isoform 3, isoform 4 lacks a transmembrane domain and is therefore proposed to be soluble in its entirety (Roberts et al., 2003, Biol Reprod 68: 1719-1726). N-terminal variants of SEQ ID NO: 43 are predicted as described below.
- a nucleic acid sequence encoding the unprocessed ALK7 polypeptide precursor protein (isoform 4) is shown below (SEQ ID NO: 44), corresponding to nucleotides 244-1244 of NCBI Reference Sequence NM OOl 111033.1. The signal sequence is indicated by solid underline.
- a nucleic acid sequence encoding the processed ALK7 polypeptide (isoform 4) is as follows (SEQ ID NO: 45): GAGCTCTCGCCAGGACTGAAGTGTGTATGTCTTTTGTGTGATTCTTCAAACTTTACCTGCCAAACAGA AGGAGCATGTTGGGCATCAGTCATGCTAACCAATGGAAAAGAGCAGGTGATCAAATCCTGTGTCTCCC TTCCAGAACTGAATGCTCAAGTCTTCTGTCATAGTTCCAACAATGTTACCAAAACCGAATGCTGCTTC ACAGATTTTTGCAACAACATAACACTGCACCTTCCAACAGATAATGGAACTTGGACTCAACTTTGGCT GGTATCTGAATATCATGAACAGGGCTCCT A ATGACTATTTGAATAGAAA A AGTGACCGTGGCTG GAATGATCAAGCTGGCTCTCAATTGCTAGTGGTCTGGCACACCTTCATATGGAGATTGTTGGTACA CAAGGTAAACCTGCTATTGCATCGAGACATAAAATCAAAAAAAAAAAAAAAAAAAAA
- Active variants of processed ALK7 isoform 1 are predicted in which SEQ ID NO: 10 is truncated by 1, 2, 3, 4, 5, 6, or 7 amino acids at the N-terminus and SEQ ID NO: 46 is truncated by 1 or 2 amino acids at the N-terminus. Consistent with SEQ ID NO: 46, it is further expected that leucine is the N-terminal amino acid in the processed forms of human ALK7 isoform 3 (SEQ ID NO: 39) and human ALK7 isoform 4 (SEQ ID NO: 43).
- the disclosure relates to heteromultimers that comprise at least one ALK7 polypeptide, which includes fragments, functional variants, and modified forms thereof.
- ALK7 polypeptides for use in accordance with inventions of the disclosure e.g., heteromultimers comprising an ALK7 polypeptide and uses thereof
- are soluble e.g., an extracellular domain of ALK7.
- ALK7 polypeptides for use in accordance with the disclosure bind to one or more TGF-beta superfamily ligands.
- ALK7 polypeptides for use in accordance with the disclosure inhibit (antagonize) activity (e.g., induction of Smad 2/3 and/or Smad 1/5/8 signaling) of one or more TGF-beta superfamily ligands.
- heteromultimers of the disclosure comprise at least one ALK7 polypeptide that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 9, 10, 19, 20, 38, 39, 42, 43, 46, 74, 75, 79, or 80.
- heteromultimer of the disclosure consist or consist essentially of at least one ALK7 polypeptide that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 9, 10, 19, 20, 38, 39, 42, 43, 46, 74, 75, 79, and 80.
- ALK7 is well-conserved among vertebrates, with large stretches of the extracellular domain completely conserved.
- Figure 7 depicts a multi-sequence alignment of a human ALK7 extracellular domain compared to various ALK7 orthologs.
- an active, human ALK7 variant polypeptide useful in accordance with the presently disclosed methods may include one or more amino acids at corresponding positions from the sequence of another vertebrate ALK7, or may include a residue that is similar to that in the human or other vertebrate sequences. Without meaning to be limiting, the following examples illustrate this approach to defining an active ALK7 variant.
- V61 in the human ALK7 extracellular domain is isoleucine in Callithrix jacchus ALK7 (SEQ ID NO: 62), and so the position may be altered, and optionally may be altered to another hydrophobic residue such as L, I, or F, or a non- polar residue such as A.
- L32 in the human extracellular domain is R in Tarsius syrichta (SEQ ID NO: 63) ALK7, indicating that this site may be tolerant of a wide variety of changes, including polar residues, such as E, D, K, R, H, S, T, P, G, Y, and probably a non-polar residue such as A.
- K37 in the human extracellular domain is R in Pan troglodytes ALK7 (SEQ ID NO: 60), indicating that basic residues are tolerated at this position, including R, K, and H.
- P4 in the human extracellular domain is relatively poorly conserved, appearing as A in Pan troglodytes ALK7 thus indicating that a wide variety of amino acid should be tolerated at this position.
- ALK7 proteins have been characterized in the art in terms of structural and functional characteristics [e.g., Romano et al (2012) Journal of Molecular Modeling 18(8): 3617-3625].
- a defining structural motif known as a three-finger toxin fold is important for ligand binding by type I and type II receptors and is formed by conserved cysteine residues located at varying positions within the extracellular domain of each monomelic receptor [Greenwald et al. (1999) Nat Struct Biol 6: 18-22; and Hinck (2012) FEBS Lett 586: 1860-1870].
- the core ligand-binding domains of human ALK7 corresponds to positions 28-92 of SEQ ID NO: 9.
- the structurally less-ordered amino acids flanking these cysteine- demarcated core sequences can be truncated by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, or 27 residues at the N-terminus and by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 21 residues at the C-terminus without necessarily altering ligand binding.
- Exemplary ALK7 extracellular domains for N-terminal and/or C-terminal truncation include SEQ ID NOs: 10, 20, 39, and 43.
- ALK7 polypeptides may, for example, comprise, consists essentially of, or consists of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%), or 100%) identical to a portion of ALK7 beginning at a residue corresponding to any one of amino acids 20-28 (e.g., beginning at any one of amino acids 20, 21, 22, 23, 24, 25, 26, 27, or 28) of SEQ ID NO: 9 and ending at a position corresponding to any one amino acids 92-1 13 (e.g., ending at any one of amino acids 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102,
- constructs that begin at a position from 21-28 (e.g., any one of positions 21, 22, 23, 24, 25, 26, 27, or 28), 24-28 (e.g., any one of positions 24, 25, 26, 27, or 28), or 25-28 (e.g., any one of positions 25, 26, 27, or 28) of SEQ ID NO: 9 and end at a position from 93-1 12 (e.g., any one of positions 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103,
- 93-1 10 e.g., any one of positions 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, or 1 10
- 93-100 e.g., any one of positions 93, 94, 95, 96, 97, 98, 99, or 100
- 93-95 e.g., any one of positions 93, 94, or 95 of SEQ ID NO: 9.
- ALK7 variants comprise no more than 1, 2, 5, 6, 7, 8, 9, 10 or 15 conservative amino acid changes in the ligand-binding pocket. Sites outside the binding pocket, at which variability may be particularly well tolerated, include the amino and carboxy termini of the extracellular domain (as noted above).
- the present disclosure relates to heteromultimers comprising one or more ALK7 receptor polypeptides (e.g., SEQ ID Nos: 9, 10, 19, 20, 38, 39, 42, 43, 46, 74, 76, 79, and 80) and one or more ActRIIB receptor polypeptides (e.g., SEQ ID NOs: 1, 2, 3, 4, 5, 6, 71, 73, 77, and 78), which are generally referred to herein as "ALK7:ActRIIB
- heteromultimer complexes or "ALK7: ActRIIB heteromultimers”.
- ALK7 ActRIIB heteromultimers
- ALK7 ActRIIB heteromultimers are soluble, e.g., a heteromultimer comprises a soluble portion (domain) of an ALK7 receptor and a soluble portion (domain) of an ActRIIB receptor.
- a heteromultimer comprises a soluble portion (domain) of an ALK7 receptor and a soluble portion (domain) of an ActRIIB receptor.
- the extracellular domains of ALK7 and ActRIIB correspond to soluble portion of these receptors. Therefore, in some embodiments, heteromultimers comprise an extracellular domain of an ALK7 receptor and an extracellular domain of an ActRIIB receptor.
- Example extracellular domains of ALK7 and ActRIIB receptors are disclosed herein and such sequences, as well as fragments, functional variants, and modified forms thereof, may be used in accordance with the inventions of the disclosure (e.g., ALK7:ActRIIB heteromultimer compositions and uses thereof).
- ALK7:ActRIIB heteromultimers comprise at least one ALK7 polypeptide that comprises, consists essentially of, or consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 9, 10, 19, 20, 38, 39, 42, 43, 46, 74, 76, 79, and 80.
- ALK7:ActRIIB heteromultimers comprise at least one ALK7 polypeptide that comprises, consists essentially of, or consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 9, 10, 19, 20, 38, 39, 42, 43, 46, 74, 76,
- ALK7:ActRIIB heteromultimers comprise at least one ALK7 polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%>, 85%>, 86%>, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to a portion of ALK7 beginning at a residue corresponding to any one of amino acids 21-28, 22-28, 23-28, 24-28, 25-28, 26-28, or 27-28 of SEQ ID NO: 9 and ending at a position from 93-1 12, 93, 1 10, 93-100, 93-95 of SEQ ID NO: 9.
- heteromultimers comprise at least one ALK7 polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to amino acids 28-92 of SEQ ID NO: 9.
- ALK7-ActRIIB heteromultimers comprise at least one ActRIIB polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of any one of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 71, 73, 77, and 78.
- ALK7:ActRIIB heteromultimers comprise at least one ActRIIB polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to a portion of ActRIIB beginning at a residue corresponding to any one of amino acids 20-29, 20-24, 21-24, 22-25, or 21-29 and end at a position from 109-134, 119-134, 119-133, 129-134, or 129-133 of SEQ ID NO: 1.
- ALK7:ActRIIB heteromultimers comprise at least one ActRIIB polypeptide that comprises, consists essentially of, or consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to amino acids 29-109 of SEQ ID NO: 1.
- ALK7: ActRIIB heteromultimers comprise at least one ActRIIB polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to amino acids 25-125 of SEQ ID NO: 1.
- ALK7: ActRIIB ActRIIB heteromultimers comprise at least one ActRIIB polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to amino acids 25-125 of SEQ ID NO: 1.
- heteromultimers comprise at least one ActRIIB polypeptide wherein the position
- ALK7 ActRIIB
- heteromultimers include, e.g. , heterodimers, heterotrimers, heterotetramers and further higher order oligomeric structures. See, e.g., Figures 1, 2, and 8-10. In certain preferred embodiments, heterodimers, heterotrimers, heterotetramers and further higher order oligomeric structures. See, e.g., Figures 1, 2, and 8-10. In certain preferred embodiments, heterodimers, heterotrimers, heterotetramers and further higher order oligomeric structures. See, e.g., Figures 1, 2, and 8-10. In certain preferred
- heteromultimers of the disclosure are ALK7:ActRIIB heterodimers.
- the present disclosure contemplates making functional variants by modifying the structure of an ALK7 polypeptide and/or an ActRIIB polypeptide.
- Variants can be produced by amino acid substitution, deletion, addition, or combinations thereof. For instance, it is reasonable to expect that an isolated replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar replacement of an amino acid with a structurally related amino acid (e.g., conservative mutations) will not have a major effect on the biological activity of the resulting molecule.
- Conservative replacements are those that take place within a family of amino acids that are related in their side chains.
- Whether a change in the amino acid sequence of a polypeptide of the disclosure results in a functional homolog can be readily determined by assessing the ability of the variant polypeptide to produce a response in cells in a fashion similar to the wild-type polypeptide, or to bind to one or more TGF-beta superfamily ligands including, for example, BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP 5, BMP6, BMP7, BMP 8 a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7, GDF8, GDF9b/BMP15, GDF11/BMP11, GDF15/MIC1, TGF- ⁇ , TGF-p2, TGF-p3, activin A, activin B, activin C, activin E, activin AB, activin AC, activin AE, activin BC, activin BE, nodal, glial cell-derived neurotrophic factor (GD F), neurturi
- the present disclosure contemplates making functional variants by modifying the structure of an ALK7 polypeptide and/or an ActRIIB polypeptide for such purposes as enhancing therapeutic efficacy or stability (e.g., shelf-life and resistance to proteolytic degradation in vivo).
- the present disclosure contemplates specific mutations of an ALK7 polypeptide and/or an ActRIIB polypeptide so as to alter the glycosylation of the polypeptide.
- Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O-linked or N-linked glycosylation sites.
- Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X- threonine or asparagine-X-serine (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the polypeptide (for O-linked glycosylation sites).
- a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non- glycosylation at the modified tripeptide sequence.
- Another means of increasing the number of carbohydrate moieties on a polypeptide is by chemical or enzymatic coupling of glycosides to the polypeptide.
- the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine. Removal of one or more carbohydrate moieties present on a polypeptide may be accomplished chemically and/or enzymatically.
- Chemical deglycosylation may involve, for example, exposure of a polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N- acetylgalactosamine), while leaving the amino acid sequence intact.
- Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al. [Meth. Enzymol. (1987) 138:350].
- sequence of a polypeptide may be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect, and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide.
- heteromeric complexes of the present disclosure for use in humans may be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines are expected to be useful as well.
- the present disclosure further contemplates a method of generating mutants, particularly sets of combinatorial mutants of an ALK7 and/or an ActRIIB polypeptide as well as truncation mutants. Pools of combinatorial mutants are especially useful for identifying functionally active (e.g., TGF-beta superfamily ligand binding) ALK7 and/or ActRIIB sequences.
- the purpose of screening such combinatorial libraries may be to generate, for example, polypeptides variants which have altered properties, such as altered
- ALK7:ActRIIB complex variants may be screened for ability to bind to one or more TGF-beta superfamily ligands, to prevent binding of a TGF-beta superfamily ligand to a TGF-beta superfamily receptor, and/or to interfere with signaling caused by an TGF-beta superfamily ligand.
- the activity of a ALK7:ActRIIB heteromultimer may be tested, for example, in a cell- based or in vivo assay.
- the effect of an ALK7:ActRIIB heteromultimer on the expression of genes or the activity of proteins involved in fat metabolism, kidney damage, kidney inflammation, and/or kidney fibrosis may be assessed. This may, as needed, be performed in the presence of one or more recombinant TGF-beta superfamily ligand proteins, and cells may be transfected so as to produce an ALK7:ActRIIB heteromultimer, and optionally, a TGF-beta superfamily ligand.
- an ALK7:ActRIIB heteromultimer may be administered to a mouse or other animal, and one or more measurements, such as fat metabolism or kidney damage, inflammation, fibrosis and/or function may be assessed using art-recognized methods.
- the activity of an ALK7:ActRIIB heteromultimer, or variants thereof may be tested in, for example, adipocytes and/or glomerular cells for any effect on growth of these cells, for example, by the assays as described herein and those of common knowledge in the art.
- a SMAD-responsive reporter gene may be used in such cell lines to monitor effects on downstream signaling.
- Combinatorial-derived variants can be generated which have increased selectivity or generally increased potency relative to a reference ALK7:ActRIIB heteromultimer. Such variants, when expressed from recombinant DNA constructs, can be used in gene therapy protocols. Likewise, mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding unmodified ALK7: ActRIIB heteromultimer. For example, the altered protein can be rendered either more stable or less stable to
- proteolytic degradation or other cellular processes which result in destruction, or otherwise inactivation, of an unmodified polypeptide can be utilized to alter polypeptide complex levels by modulating the half-life of the polypeptide. For instance, a short half-life can give rise to more transient biological effects and, when part of an inducible expression system, can allow tighter control of recombinant polypeptide complex levels within the cell.
- mutations may be made in the linker (if any) and/or the Fc portion to alter one or more activities of the
- ALK7:ActRIIB heteromultimer including, for example, immunogenicity, half-life, and solubility.
- a combinatorial library may be produced by way of a degenerate library of genes encoding a library of polypeptides which each include at least a portion of potential ALK7 and/or ActRIIB sequences.
- a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential ALK7 and/or ActRIIB encoding nucleotide sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display).
- the library of potential homologs can be generated from a degenerate oligonucleotide sequence.
- Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes can then be ligated into an appropriate vector for expression.
- the synthesis of degenerate oligonucleotides is well known in the art [Narang, SA (1983) Tetrahedron 39:3; Itakura et al. (1981) Recombinant DNA, Proc. 3rd Cleveland Sympos. Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp273-289; Itakura et al. (1984) Annu. Rev. Biochem.
- ALK7:ActRIIB heteromultimers can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis [Ruf et al. (1994) Biochemistry 33 : 1565-1572; Wang et al. (1994) J. Biol. Chem. 269:3095-3099; Balint et a/. (1993) Gene 137: 109-118; Grodberg et al. (1993) Eur. J. Biochem. 218:597-601; Nagashima et al. (1993) J. Biol. Chem. 268:2888-2892; Lowman et al.
- Linker scanning mutagenesis is an attractive method for identifying truncated (bioactive) forms of ALK7 and/or ActRIIB polypeptides.
- combinatorial mutagenesis of ALK7 ActRIIB heteromultimers.
- the most widely used techniques for screening large gene libraries typically comprise cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected.
- Preferred assays include TGF-beta superfamily ligand (e.g., BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP 5, BMP6, BMP7, BMP 8 a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7, GDF8, GDF9b/BMP15, GDF11/BMP11,
- TGF-beta superfamily ligand e.g., BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP 5, BMP6, BMP7, BMP 8 a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7, GDF8, GDF9b/BMP15, GDF11/BMP11,
- ALK7:ActRIIB heteromultimers may further comprise post- translational modifications in addition to any that are naturally present in the ALK7 and/or ActRIIB polypeptide.
- ALK7:ActRIIB heteromultimers may comprise non-amino acid elements, such as polyethylene glycols, lipids, polysaccharide or monosaccharide, and phosphates. Effects of such non-amino acid elements on the functionality of a heteromultimer complex may be tested as described herein for other heteromultimer variants.
- post- translational processing may also be important for correct folding and/or function of the protein.
- heteromultimers described herein comprise at least one ALK7 polypeptide associated, covalently or non-covalently, with at least one ActRIIB polypeptide.
- polypeptides disclosed herein form heterodimeric complexes, although higher order heteromultimeric complexes are also included such as, but not limited to, heterotrimers, heterotetramers, and further oligomeric structures (see, e.g., Figure 1, 2, and 8-10).
- ALK7 and/or ActRIIB polypeptides comprise at least one multimerization domain.
- the term "multimerization domain" refers to an amino acid or sequence of amino acids that promote covalent or non-covalent interaction between at least a first polypeptide and at least a second polypeptide.
- Polypeptides disclosed herein may be joined covalently or non-covalently to a multimerization domain.
- a multimerization domain promotes interaction between a first polypeptide (e.g., an ALK7 polypeptide) and a second polypeptide (e.g., an ActRIIB polypeptide) to promote
- heteromultimer formation e.g., heterodimer formation
- optionally hinders or otherwise disfavors homomultimer formation e.g., homodimer formation
- homomultimer formation e.g., homodimer formation
- Many methods known in the art can be used to generate ALK7:ActRIIB
- non-naturally occurring disulfide bonds may be constructed by replacing on a first polypeptide (e.g., an ALK7 polypeptide) a naturally occurring amino acid with a free thiol-containing residue, such as cysteine, such that the free thiol interacts with another free thiol-containing residue on a second polypeptide (e.g., an ActRIIB polypeptide) such that a disulfide bond is formed between the first and second polypeptides.
- a first polypeptide e.g., an ALK7 polypeptide
- a naturally occurring amino acid with a free thiol-containing residue, such as cysteine, such that the free thiol interacts with another free thiol-containing residue on a second polypeptide (e.g., an ActRIIB polypeptide) such that a disulfide bond is formed between the first and second polypeptides.
- a second polypeptide e.g., an ActRIIB polypeptid
- a multimerization domain may comprise one component of an interaction pair.
- the polypeptides disclosed herein may form protein complexes comprising a first polypeptide covalently or non-covalently associated with a second polypeptide, wherein the first polypeptide comprises the amino acid sequence of an ALK7 polypeptide and the amino acid sequence of a first member of an interaction pair; and the second polypeptide comprises the amino acid sequence of an ActRIIB polypeptide and the amino acid sequence of a second member of an interaction pair.
- the interaction pair may be any two polypeptide sequences that interact to form a complex, particularly a
- heterodimeric complex although operative embodiments may also employ an interaction pair that can form a homodimeric complex.
- One member of the interaction pair may be fused to an ALK7 or ActRIIB polypeptide as described herein, including for example, a polypeptide sequence comprising, consisting essentially of, or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of any one of SEQ ID NOs: 2, 3, 5, 6, 10, 20, 39, 43, and 46.
- An interaction pair may be selected to confer an improved property/activity such as increased serum half-life, or to act as an adaptor on to which another moiety is attached to provide an improved property/activity.
- a polyethylene glycol moiety may be attached to one or both components of an interaction pair to provide an improved property/activity such as improved serum half-life.
- the first and second members of the interaction pair may be an asymmetric pair, meaning that the members of the pair preferentially associate with each other rather than self- associate. Accordingly, first and second members of an asymmetric interaction pair may associate to form a heterodimeric complex (see, e.g., Figure 2).
- the interaction pair may be unguided, meaning that the members of the pair may associate with each other or self-associate without substantial preference and thus may have the same or different amino acid sequences. Accordingly, first and second members of an unguided interaction pair may associate to form a homodimer complex or a heterodimeric complex.
- the first member of the interaction pair (e.g., an asymmetric pair or an unguided interaction pair) associates covalently with the second member of the interaction pair.
- the first member of the interaction pair (e.g., an asymmetric pair or an unguided interaction pair) associates non-covalently with the second member of the interaction pair.
- the present disclosure provides fusion proteins comprising
- immunoglobulin such as a CHI, CH2, or CH3 domain of an immunoglobulin or an Fc domain.
- Fc domains derived from human IgGl, IgG2, IgG3, and IgG4 are provided herein.
- Other mutations are known that decrease either CDC or ADCC activity, and collectively, any of these variants are included in the disclosure and may be used as advantageous components of a heteromultimeric complex of the disclosure.
- the IgGl Fc domain of SEQ ID NO: 31 has one or more mutations at residues such as Asp-265, Lys-322, and Asn-434 (numbered in accordance with the corresponding full-length IgGl).
- the mutant Fc domain having one or more of these mutations has reduced ability of binding to the Fey receptor relative to a wildtype Fc domain.
- the mutant Fc domain having one or more of these mutations e.g., Asn-434 mutation
- GIFc human IgGl
- SEQ ID NO: 31 An example of a native amino acid sequence that may be used for the Fc portion of human IgGl (GIFc) is shown below (SEQ ID NO: 31). Dotted underline indicates the hinge region, and solid underline indicates positions with naturally occurring variants.
- the disclosure provides polypeptides comprising, consisting essentially of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 31.
- Naturally occurring variants in GIFc would include E134D and M136L according to the numbering system used in SEQ ID NO: 31 (see Uniprot P01857).
- SEQ ID NO: 32 An example of a native amino acid sequence that may be used for the Fc portion of human IgG2 (G2Fc) is shown below (SEQ ID NO: 32). Dotted underline indicates the hinge region and double underline indicates positions where there are data base conflicts in the sequence (according to UniProt P01859).
- the disclosure provides polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 32.
- G3Fc Two examples of amino acid sequences that may be used for the Fc portion of human IgG3 (G3Fc) are shown below.
- the hinge region in G3Fc can be up to four times as long as in other Fc chains and contains three identical 15-residue segments preceded by a similar 17-residue segment.
- the first G3Fc sequence shown below (SEQ ID NO: 33) contains a short hinge region consisting of a single 15-residue segment, whereas the second G3Fc sequence (SEQ ID NO: 34) contains a full-length hinge region.
- dotted underline indicates the hinge region
- solid underline indicates positions with naturally occurring variants according to UniProt P01859.
- polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NOs: 33 and 34.
- Naturally occurring variants in G3Fc include E68Q, P76L, E79Q, Y81F, D97N, N100D, T124A, S169N, S169del, F221Y when converted to the numbering system used in SEQ ID NO: 33, and the present disclosure provides fusion proteins comprising G3Fc domains containing one or more of these variations.
- the human immunoglobulin IgG3 gene (IGHG3) shows a structural polymorphism characterized by different hinge lengths [see Uniprot P01859]. Specifically, variant WIS is lacking most of the V region and all of the CHI region.
- Variant ZUC lacks most of the V region, all of the CHI region, and part of the hinge.
- Variant OMM may represent an allelic form or another gamma chain subclass.
- the present disclosure provides additional fusion proteins comprising G3Fc domains containing one or more of these variants.
- G4Fc human IgG4
- SEQ ID NO: 35 An example of a native amino acid sequence that may be used for the Fc portion of human IgG4 (G4Fc) is shown below (SEQ ID NO: 35). Dotted underline indicates the hinge region.
- the disclosure provides polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 35.
- a given amino acid position in an immunoglobulin sequence consisting of hinge, C H 2, and C H 3 regions will be identified by a different number than the same position when numbering encompasses the entire IgGl heavy-chain constant domain (consisting of the CHI, hinge, CH2, and CH3 regions) as in the Uniprot database.
- correspondence between selected CH3 positions in a human GIFc sequence (SEQ ID NO: 31), the human IgGl heavy chain constant domain (Uniprot P01857), and the human IgGl heavy chain is as follows.
- chain association issue A problem that arises in large-scale production of asymmetric immunoglobulin-based proteins from a single cell line is known as the "chain association issue".
- the chain association issue concerns the challenge of efficiently producing a desired multichain protein from among the multiple combinations that inherently result when different heavy chains and/or light chains are produced in a single cell line [Klein et al (2012) mAbs 4:653-663].
- This problem is most acute when two different heavy chains and two different light chains are produced in the same cell, in which case there are a total of 16 possible chain combinations (although some of these are identical) when only one is typically desired. Nevertheless, the same principle accounts for diminished yield of a desired multichain fusion protein that incorporates only two different (asymmetric) heavy chains.
- Methods to obtain desired pairing of Fc-containing chains include, but are not limited to, charge-based pairing (electrostatic steering), "knobs- into-holes” steric pairing, SEEDbody pairing, and leucine zipper-based pairing [Ridgway et al (1996) Protein Eng 9:617-621; Merchant et al (1998) Nat Biotech 16:677-681; Davis et al (2010) Protein Eng Des Sel 23 : 195-202; Gunasekaran et al (2010); 285: 19637-19646;
- Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide (e.g., a first interaction pair) with larger side chains (e.g., tyrosine or tryptophan).
- Complementary "cavities" of identical or similar size to the protuberances are optionally created on the interface of the second polypeptide (e.g., a second interaction pair) by replacing large amino acid side chains with smaller ones (e.g., alanine or threonine).
- protein complexes disclosed herein make use of the attractive interactions for promoting heteromultimer formation (e.g., heterodimer formation), and optionally repulsive interactions for hindering homodimer formation (e.g., homodimer formation) by carrying out site directed mutagenesis of charged interface residues.
- the IgGl CH3 domain interface comprises four unique charge residue pairs involved in domain-domain interactions: Asp356-Lys439', Glu357-Lys370', Lys392- Asp399', and Asp399-Lys409' [residue numbering in the second chain is indicated by (')].
- the numbering scheme used here to designate residues in the IgGl CH3 domain conforms to the EU numbering scheme of Kabat. Due to the 2-fold symmetry present in the CH3-CH3 domain interactions, each unique interaction will represented twice in the structure (e.g., Asp-399-Lys409' and Lys409-Asp399').
- K409-D399' favors both heterodimer and homodimer formation.
- a single mutation switching the charge polarity (e.g., K409E; positive to negative charge) in the first chain leads to unfavorable interactions for the formation of the first chain homodimer. The unfavorable interactions arise due to the repulsive interactions occurring between the same charges (negative-negative; K409E-D399' and D399-K409E').
- a similar mutation switching the charge polarity (D399K' ; negative to positive) in the second chain leads to unfavorable interactions (K409'-D399K' and D399K-K409') for the second chain homodimer formation. But, at the same time, these two mutations (K409E and D399K') lead to favorable interactions (K409E-D399K' and D399-K409') for the heterodimer formation.
- the electrostatic steering effect on heterodimer formation and homodimer discouragement can be further enhanced by mutation of additional charge residues which may or may not be paired with an oppositely charged residue in the second chain including, for example, Arg355 and Lys360.
- additional charge residues which may or may not be paired with an oppositely charged residue in the second chain including, for example, Arg355 and Lys360.
- the table below lists possible charge change mutations that can be used, alone or in combination, to enhance ALK7:ActRIIB heteromultimer formation.
- one or more residues that make up the CH3-CH3 interface in a fusion protein of the instant application are replaced with a charged amino acid such that the interaction becomes electrostatically unfavorable.
- a positive-charged amino acid in the interface e.g., a lysine, arginine, or histidine
- a negatively charged amino acid e.g., aspartic acid or glutamic acid
- a negative-charged amino acid in the interface is replaced with a positive-charged amino acid.
- the amino acid is replaced with a non-naturally occurring amino acid having the desired charge characteristic.
- the disclosure provides desired pairing of asymmetric Fc-containing
- Fc sequences engineered to be complementary on the basis of charge pairing (electrostatic steering).
- charge pairing electrostatic steering
- One of a pair of Fc sequences with electrostatic complementarity can be arbitrarily fused to the ALK7 or ActRIIB polypeptide of the construct, with or without an optional linker, to generate an ALK7: ActRIIB heteromultimer.
- This single chain can be coexpressed in a cell of choice along with the Fc sequence
- SEQ ID NO: 23 [human GlFc(E134K/D177K)] and SEQ ID NO: 24 [human GlFc(K170D/K187D)] are examples of complementary Fc sequences in which the engineered amino acid substitutions are double underlined, and the TGF-beta superfamily type I or type II receptor polypeptide of the construct can be fused to either SEQ ID NO: 23 or SEQ ID NO: 24, but not both.
- the disclosure provides desired pairing of asymmetric Fc-containing polypeptide chains using Fc sequences engineered for steric complementarity.
- the disclosure provides knobs-into-holes pairing as an example of steric complementarity.
- One of a pair of Fc sequences with steric complementarity can be arbitrarily fused to the ALK7 or ActRIIB polypeptide of the construct, with or without an optional linker, to generate an ALK7:ActRIIB heteromultimer.
- This single chain can be co-expressed in a cell of choice along with the Fc sequence complementary to the first Fc to favor generation of the desired multi-chain construct.
- SEQ ID NO: 25 [human GlFc(T144Y)]
- SEQ ID NO: 26 [human GlFc(Y185T)] are examples of complementary Fc sequences in which the engineered amino acid substitutions are double underlined, and the ALK7 or ActRIIB polypeptide of the construct can be fused to either SEQ ID NO: 25 or SEQ ID NO: 26, but not both.
- SEQ ID NO: 26 An example of Fc complementarity based on knobs-into-holes pairing combined with an engineered disulfide bond is disclosed in SEQ ID NO: 27 [hGlFc(S132C/T144W)] and SEQ ID NO: 28 [hGlFc(Y127C/T144S/L146A/Y185V)].
- the engineered amino acid substitutions in these sequences are double underlined, and the TGF-beta superfamily type I or type II polypeptide of the construct can be fused to either SEQ ID NO: 27 or SEQ ID NO: 28, but not both.
- the disclosure provides desired pairing of asymmetric Fc-containing polypeptide chains using Fc sequences engineered to generate interdigitating ⁇ -strand segments of human IgG and IgA C H 3 domains.
- Fc sequences engineered to generate interdigitating ⁇ -strand segments of human IgG and IgA C H 3 domains include the use of strand-exchange engineered domain (SEED) C H 3 heterodimers allowing the formation of SEEDbody fusion proteins [Davis et al. (2010) Protein Eng Design Sel 23 : 195-202].
- SEED strand-exchange engineered domain
- One of a pair of Fc sequences with SEEDbody complementarity can be arbitrarily fused to the ALK7 or ActllB of the construct, with or without an optional linker, to generate an ALK7 or ActRIIB fusion polypeptide.
- This single chain can be co-expressed in a cell of choice along with the Fc sequence complementary to the first Fc to favor generation of the desired multi-chain construct.
- SEQ ID NO: 29 [hGlFc(Sb AG )] and SEQ ID NO: 30 [hGlFc(Sb GA )] are examples of complementary IgG Fc sequences in which the engineered amino acid substitutions from IgA Fc are double underlined, and the ALK7 or ActRIIB polypeptide of the construct can be fused to either SEQ ID NO: 29 or SEQ ID NO: 30, but not both.
- the disclosure provides desired pairing of asymmetric Fc-containing
- one of a pair of Fc sequences attached to a leucine zipper-forming strand can be arbitrarily fused to the ALK7 or ActRIIB polypeptide of the construct, with or without an optional linker, to generate an ALK7 or ActRIIB fusion polypeptide. This single chain can be co-expressed in a cell of choice along with the Fc sequence attached to a
- SEQ ID NO: 36 [hGlFc-Apl (acidic)] and SEQ ID NO: 37 [hGlFc-Bpl (basic)] are
- complementary IgG Fc sequences in which the engineered complimentary leucine zipper sequences are underlined, and the ALK7 or ActRIIB polypeptide of the construct can be fused to either SEQ ID NO: 36 or SEQ ID NO: 37, but not both.
- ALK7:ActRIIB heteromultimers may be generated using a combination of heavy and light chain fusion proteins comprising either an ALK7 or ActRIIB polypeptide.
- an ALK7 polypeptide may be fused, with or without a linker domain, to an immunoglobulin heavy chain (IgGl, IgG2, IgG3, IgG4, IgM, IgAl, or IgA2) that comprises at least a portion of the C H I domain.
- an ActRIIB polypeptide may be fused, with or without a linker domain, to an immunoglobulin light chain (kappa or lambda) that comprises at least a portion of the light chain constant domain (C L ).
- an ActRIIB polypeptide may be fused, with or without a linker domain, to an immunoglobulin heavy chain (IgGl, IgG2, IgG3, IgG4, IgM, IgAl, or IgA2) that comprises at least a portion of the C H 1 domain
- an ALK7 polypeptide may be fused, with or without a linker domain, to an immunoglobulin light chain (kappa or lambda) that comprises at least a portion of the light chain constant domain (C L ).
- heterodimerization of a heavy and light chain occurs between the C H 1 with the C L, which is generally stabilized by covalent linking of the two domains via a disulfide bridge.
- Constructs employing the full-length heavy chain, or at least a portion of the heavy chain comprising the hinge region, could give rise to antibody-like molecules comprising two "light chains” and two "heavy chains”. See Figure 9.
- a potential advantage of this design is that it may more closely mimic the naturally occurring ALK7-ligand-ActRIIB complex and may display higher affinity for the ligand than comparable single heterodimers.
- this design may be modified by incorporating various heavy chain truncations including, for example, truncations that comprise the C H 1 domain and some or all of the hinge domain (giving rise to F(ab') 2 -like molecules) as well as truncations that only comprise the C H I domain or a fragment thereof (giving rise to Fab-like molecules).
- various heavy chain truncations including, for example, truncations that comprise the C H 1 domain and some or all of the hinge domain (giving rise to F(ab') 2 -like molecules) as well as truncations that only comprise the C H I domain or a fragment thereof (giving rise to Fab-like molecules). See Figure 9G.
- Various methods for designing such heteromultimer constructs are described in US 2009/0010879, Klein et al [(2012) mAbs 4:653-663], and Spiess et al [(2015) Molecular Immunology 67(2A): 95-106] the contents of which are incorporated in their entirety
- ALK7:ActRIIB heterodimers comprising at least one branch of the complex comprising an ALK7- C L :ActRIIB-C H l heterodimer pair and at least a second branch comprising an ActRIIB- C L :ALK7-C H 1 heterodimer pair.
- Such heterodimer complexes can be generated, for example, using combinations of heavy chain and light chain asymmetrical pairing technologies [Spiess et al (2015) Molecular Immunology 67(2A): 95-106]. For example, in CrossMab technology, [Schaefer et al (2011). Proc. Natl. Acad. Sci.
- heterodimerization strategy to facilitate efficient IgG production in a single host cell.
- Electrostatic steering may also be used to generate orthogonal Fab interfaces to facilitate the construction of such heterodimers.
- Peptide linkers may be used to ensure cognate pairing of light and heavy chains in a format known as "LUZ-Y" [Wranik et al (2012) J. Biol. Chem. 287: 43331-43339], wherein heavy chain heterodimerization is accomplished using leucine zippers which may be subsequently removed by proteolysis in vitro.
- ALK7:ActRIIB heteromultimers may comprise one or more single- chain ligand traps as described herein, optionally which may be covalently or non-covalently associated with one or more ALK7 or ActRIIB polypeptides as well as additional
- single-chain ligand traps do not require fusion to any multimerization domain such as coiled-coil Fc domains to be multivalent.
- single- chain ligand traps of the present disclosure comprise at least one ALK7 polypeptide domain and one ActRIIB polypeptide domain.
- the ALK7 and ActRIIB polypeptide domains generally referred to herein as binding domains (BD), optionally may be joined by a linker region.
- the present disclosure provides heteromultimers comprising a polypeptide having the following structure: ( ⁇ BDl>-linkerl) k -[ ⁇ BD2>-linker2- ⁇ BD3>-linker3 ⁇ f ] n -( ⁇ BD4>) m -(linker4-BD5> d ) h where: n and h are independently greater than or equal to one; d, f, m, and k are independently equal to or greater than zero; BDl, BD2, BD3, BD4, and BD5 are
- ALK7: ActRIIB single- chain traps comprise at least two different ALK7 polypeptides.
- ALK7:ActRIIB single-chain traps comprise at least two different ActRIIB polypeptides.
- ALK7:ActRIIB single-chain traps comprise at least two different linkers.
- the heteromultimer structure may comprise a large number of repeating units in various combinations or may be a relatively simple structure.
- the present disclosure provides heteromultimers comprising a polypeptide having the following structure: ⁇ BDl>-linkerl- ⁇ BD2>
- the present disclosure provides heteromultimers comprising a polypeptide having the following structure: ⁇ BD 1 >-(linker2- ⁇ BD2>)n where n is greater than or equal one.
- heteromultimers comprising a polypeptide having the following structure: ( ⁇ BD 1 >-linker 1 - ⁇ BD 1 > Hnker2-( ⁇ BD2>-linker3 - ⁇ BD3 >) g wherein f and g are greater than or equal to one.
- BD2 and BD3 are the same, and f and g are the same number, this can result in a substantially mirror symmetric structure around linker 2, subject to differences in the linkers.
- BD2 is different from BD3 and/or where f and g are different numbers, different structures will be produced. It is within the capacity of one of ordinary skill in the art to select suitable binding domains, linkers, and repeat frequencies in light of the disclosure herein and knowledge in the art. Specific, non-limiting examples of such single-chain ligand traps in accordance with the present disclosure are represented schematically in Figure 11.
- the linkers (1, 2, 3, and 4) may be the same or different.
- the linker region provides a segment that is distinct from the structured ligand-binding domains of ALK7 and ActRIIB and thus can be used for conjugation to accessory molecules (e.g., molecules useful in increasing stability such as PEGylation moieties) without having to chemically modify the binding domains.
- the linker may include an unstructured amino acid sequence that may be either the same as or derived from conservative modifications to the sequence of a natural unstructured region in the extracellular portion of the receptor for the ligand of interest or another receptor in the TGF- ⁇ superfamily.
- linkers may be entirely artificial in composition and origin but will contain amino acids selected to provide an unstructured flexible linker with a low likelihood of encountering electrostatic or steric hindrance complications when brought into close proximity to the ligand of interest.
- Linker length will be considered acceptable when it permits binding domains located on each of the N- and C-termini of the linker to bind their natural binding sites on their natural ligand such that, with both binding domains so bound, the ligand is bound with a higher affinity than it would be bound by binding of only one of the binding domains.
- the number of amino acid residues in the linker of either natural or artificial origin is selected to be equal to or greater than the minimum required distance for simultaneous (bridged) binding to two binding sites on the ALK7 and/or ActRIIB ligand.
- the linker length may be between about 1- 10 amino acids, 10- 20 amino acids, 18-80 amino acids, 25-60 amino acids, 35-45 amino acids, or any other suitable length.
- Linkers may be designed to facilitate purification of the polypeptide.
- the exact purification scheme chosen will determine what modifications are needed, for example and without wishing to be limiting, additions of purification "tags" such as His tags is
- the linker may include regions to facilitate the addition of cargo or accessory molecules.
- the linker length will be made to ensure that the two binding domains are able to bind their respective sites on the ligand.
- single-chain polypeptides can be modified to add one or more cargo and/or accessory molecules (referred to collectively herein by Rl, R2, R3, R4, etc.):
- Rl, R2, R3, R4, R5, R6, R7, R8, R9 may or may not be present; when present, they may be the same or different, and may independently be one or more of: a fusion protein for targeting, for example, but not limited to such as an antibody fragment (e.g. single chain Fv) and/or a single domain antibody (sdAb); a radiotherapy and/or imaging agent, for example, but not limited to a radionuceotide (,e.g. I, In, F, C, Y, I, I, Y, Lu, Cu, Bi, At), a fluorescent dye (e.g. Alexa Fluor, Cy dye) and/or a fluorescent protein tag (e.g. GFP, DsRed); a cytotoxic agent for chemotherapy, for example, but not limited to doxorubicin,
- a radionuceotide e.g. I, In, F, C, Y, I, I, Y, Lu, Cu, Bi, At
- calicheamicin a maytansinoid derivatives (e.g. DM1, DM4), a toxin (eg. truncated
- Pseudomonas endotoxin A diphteria toxin
- a nanoparticle-based carrier for example, but not limited to polyethylene glycol (PEG), a polymer-conjugated to drug, nanocarrier or imaging agent (e.g.
- a polymer N-(2-hydorxylpropyl) methacrylamide HPMA
- glutamic acid PEG, dextran
- a drug for example, but not limited to doxorubicin, camptothecin, paclitaxel, palatinate
- a nanocarrier for example, but not limited to a nanoshell or liposome
- an imaging agent for example, but not limited to Supermagnetic Iron Oxide (SPIO); a dendrimer; and/or a solid support for use in ligand purification, concentration or sequestration (e.g. nanoparticles, inert resins, suitable silica supports).
- SPIO Supermagnetic Iron Oxide
- a dendrimer e.g. nanoparticles, inert resins, suitable silica supports
- the cargo or accessory molecule may be added to the linker portion of the agent, rather to the binding domain, to reduce the likelihood of interference in binding function.
- addition to the binding domain is possible and could be desirable in some instances and the effect of such an addition can be determined routinely in advance by modeling the binding agent and the linker with the proposed addition as described herein.
- Conjugation methodologies may be performed using commercial kits that enable conjugation via common reactive groups such as primary amines, succinimidyl (NHS) esters and sulfhydral-reactive groups.
- Some non-limiting examples are: Alexa Fluor 488 protein labeling kit (Molecular Probes, Invitrogen detection technologies) and PEGylation kits (Pierce Biotechnology Inc.).
- ALK7:ActRIIB single-chain traps may be covalently or non- covalently associated with one or more ALK7 or ActRIIB polypeptides as well as additional ALK7:ActRIIB single chain ligand traps to form higher order heteromultimers, which may be used in accordance with the methods described herein. See, e.g., Figure 12.
- an ALK7:ActRIIB single chain ligand trap may further comprise a multimerization domain as described herein.
- ALK7:ActRIIB single chain ligand traps comprise a constant domain of an Ig immunoglobulin.
- Such immunoglobulins constant domains may be selected to promote symmetrical or asymmetrical complexes comprising at least one single- chain ALK7: ActRIIB trap.
- an ALK7:ActRIIB single-chain trap, or combinations of such traps may be used as ALK7:ActRIIB antagonists to treat or prevent an ALK7:ActRIIB disorder or disease as described herein (e.g., kidney disease and/or a metabolic disorder or condition).
- fusion proteins e.g., immunoglobulin Fc fusion proteins
- elements of the fusion proteins may be arranged in any manner that is consistent with desired
- an ALK7 and/or ActRIIB polypeptide domain may be placed C- terminal to a heterologous domain, or alternatively, a heterologous domain may be placed C- terminal to an ALK7 and/or ActRIIB polypeptide domain.
- the ALK7 and/or ActRIIB polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
- an ALK7 and/or ActRIIB receptor fusion protein may comprise an amino acid sequence as set forth in the formula A-B-C.
- the B portion corresponds to an ALK7 or ActRIIB polypeptide domain.
- the A and C portions may be independently zero, one, or more than one amino acid, and both the A and C portions when present are heterologous to B.
- the A and/or C portions may be attached to the B portion via a linker sequence.
- a linker may be rich in glycine (e.g., 2-10, 2-5, 2-4, 2-3 glycine residues) or glycine and proline residues and may, for example, contain a single sequence of
- threonine/serine and glycines or repeating sequences of threonine/serine and/or glycines e.g., GGG (SEQ ID NO: 13), GGGG (SEQ ID NO: 14), TGGGG (SEQ ID NO: 15), SGGGG
- an ALK7 and/or ActRIIB fusion protein comprises an amino acid sequence as set forth in the formula A-B-C, wherein A is a leader (signal) sequence, B consists of an ALK7 and/or ActRIIB polypeptide domain, and C is a polypeptide portion that enhances one or more of in vivo stability, in vivo half-life, uptake/administration, tissue localization or distribution, formation of protein complexes, and/or purification.
- an ALK7 and/or ActRIIB fusion protein comprises an amino acid sequence as set forth in the formula A-B-C, wherein A is a TPA leader sequence, B is an ALK7 or ActRIIB receptor polypeptide domain, and C is an immunoglobulin Fc domain.
- Preferred fusion proteins comprise the amino acid sequence set forth in any one of SEQ ID NOs: 71, 73, 74, 76, 77, 78, 79 and 80.
- ALK7:ActRIIB heteromultimers further comprise one or more heterologous portions (domains) so as to confer a desired property.
- some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
- Well-known examples of such fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S-transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy-chain constant region (Fc), maltose binding protein (MBP), or human serum albumin.
- matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used. Many of such matrices are available in "kit” form, such as the Pharmacia GST purification system and the QIAexpressTM system (Qiagen) useful with (HIS 6 ) fusion partners.
- kit such as the Pharmacia GST purification system and the QIAexpressTM system (Qiagen) useful with (HIS 6 ) fusion partners.
- a fusion domain may be selected so as to facilitate detection of the ligand trap polypeptides. Examples of such detection domains include the various
- the fusion domains have a protease cleavage site, such as for factor Xa or thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent protease cleavage site, such as for factor Xa or thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent
- ALK7 and/or ActRIIB polypeptides may contain one or more modifications that are capable of stabilizing the polypeptides.
- modifications that are capable of stabilizing the polypeptides.
- stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an ALK7 and/or ActRIIB polypeptide domain and a stabilizer domain), modifications of a glycosylation site (including, for example, addition of a glycosylation site to a polypeptide of the disclosure), and modifications of carbohydrate moiety (including, for example, removal of carbohydrate moieties from a polypeptide of the disclosure).
- stabilizer domain not only refers to a fusion domain ⁇ e.g., an immunoglobulin Fc domain) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous moiety, such as polyethylene glycol.
- ALK7:ActRIIB heteromultimers to be used in accordance with the methods described herein are isolated complexes.
- an isolated protein (or protein complex) or polypeptide (or polypeptide complex) is one which has been separated from a component of its natural environment.
- a component of its natural environment In some embodiments, a
- heteromultimer of the disclosure is purified to greater than 95%, 96%, 97%, 98%, or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC).
- electrophoretic e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis
- chromatographic e.g., ion exchange or reverse phase HPLC.
- heteromultimer preparations are substantially free of ALK7 and/or ActRIIB homomultimers.
- ALK7:ActRIIB heteromultimers preparations comprise less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% ALK7 homomultimers.
- ALK7:ActRIIB heteromultimer preparations comprise less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% ActRIIB homomultimers.
- ALK7:ActRIIB heteromultimer preparations comprise less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% ALK7 homomultimers and less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% ActRIIB homomultimers.
- ALK7 and/or ActRIIB polypeptides as well as
- heteromultimers comprising the same, can be produced by a variety of art-known techniques.
- polypeptides can be synthesized using standard protein chemistry techniques such as those described in Bodansky, M. Principles of Peptide Synthesis, Springer Verlag, Berlin (1993) and Grant G. A. (ed.), Synthetic Peptides: A User's Guide, W. H. Freeman and Company, New York (1992).
- automated peptide synthesizers are commercially available (Advanced ChemTech Model 396; Milligen/Biosearch 9600).
- the polypeptides and complexes, including fragments or variants thereof may be recombinantly produced using various expression systems [E. coli, Chinese Hamster Ovary (CHO) cells,
- the modified or unmodified polypeptides may be produced by digestion of recombinantly produced full- length ALK7 and/or ActRIIB polypeptides by using, for example, a protease, e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
- a protease e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
- Computer analysis using commercially available software, e.g., Mac Vector, Omega, PCGene, Molecular Simulation, Inc. can be used to identify proteolytic cleavage sites.
- nucleic Acids Encoding ALK7 and/or ActRIIB polypeptides the present disclosure provides isolated and/or recombinant nucleic acids encoding ALK7 and/or ActRIIB receptors (including fragments, functional variants, and fusion proteins thereof) disclosed herein.
- SEQ ID NO: 11 encodes a naturally occurring human ALK7 precursor polypeptide
- SEQ ID NO: 12 encodes a mature extracellular domain of ALK7.
- the subject nucleic acids may be single- stranded or double stranded.
- Such nucleic acids may be DNA or RNA molecules. These nucleic acids may be used, for example, in methods for making ALK7:ActRIIB
- isolated nucleic acid(s) refers to a nucleic acid molecule that has been separated from a component of its natural environment.
- An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
- nucleic acids encoding ALK7 and/or ActRIIB polypeptides of the present disclosure are understood to include any one of SEQ ID NOs: 7, 8, 11, 12, 21, 22, 40, 41, 44, 45, 72, or 75, as well as variants thereof.
- Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions, or deletions including allelic variants, and therefore, will include coding sequences that differ from the nucleotide sequence designated in any one of SEQ ID NOs: 7, 8, 11, 12, 21, 22, 40, 41, 44, 45, 72, or 75.
- TGFP superfamily ALK7 and/or ActRIIB polypeptides of the present disclosure are encoded by isolated or recombinant nucleic acid sequences that comprise, consist essentially of, or consists of a sequence that is least 70%, 75%>, 80%>, 85%>, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NOs: 7, 8, 11, 12, 21, 22, 40, 41, 44, 45, 72, or 75.
- nucleic acid sequences that comprise, consist essentially of, or consists of a sequence complementary to a sequence that is least 70%>, 75%>, 80%>, 85%>, 86%>, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NOs: 7, 8, 11, 12, 21, 22, 40, 41, 44, 45, 72, or 75 also within the scope of the present disclosure.
- the nucleic acid sequences of the disclosure can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence or in a DNA library.
- nucleic acids of the present disclosure also include nucleotide sequences that hybridize under stringent conditions to the nucleotide sequence designated in SEQ ID NOs: 7, 8, 11, 12, 21, 22, 40, 41, 44, 45, 72, or 75, the complement sequence of SEQ ID NOs: 7, 8, 11, 12, 21, 22, 40, 41, 44, 45, 72, or 75, or fragments thereof.
- SSC sodium chloride/sodium citrate
- the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 °C to a high stringency of about 0.2 x SSC at 50 °C.
- the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 °C, to high stringency conditions at about 65 °C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
- the disclosure provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
- Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NOs: 7, 8, 11, 12, 21, 22, 40, 41, 44, 45, 72, or 75 to degeneracy in the genetic code are also within the scope of the disclosure.
- a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein.
- CAU and CAC are synonyms for histidine
- nucleotide variations that do lead to changes in the amino acid sequences of the subject proteins will exist among mammalian cells.
- nucleotides up to about 3-5% of the nucleotides
- nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid
- the recombinant nucleic acids of the disclosure may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
- Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression.
- suitable regulatory sequences are known in the art for a variety of host cells.
- said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the disclosure.
- the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
- the subject nucleic acid is provided in an expression vector comprising a nucleotide sequence encoding an ALK7 and/or ActRIIB polypeptide and operably linked to at least one regulatory sequence.
- regulatory sequences are art-recognized and are selected to direct expression of ALK7 and/or ActRIIB polypeptide. Accordingly, the term regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression
- any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding a ALK7 and/or ActRIIB polypeptides.
- Such useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3 -phosphogly cerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast a-mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
- a recombinant nucleic acid of the present disclosure can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
- Expression vehicles for production of a recombinant ALK7 and/or ActRIIB polypeptides include plasmids and other vectors.
- suitable vectors include plasmids of the following types: pBR322- derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
- Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
- the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
- vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
- bacterial plasmids such as pBR322
- derivatives of viruses such as the bovine papilloma virus (BPV-1), or Epstein- Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
- BBV-1 bovine papilloma virus
- pHEBo Epstein- Barr virus
- examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
- the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
- baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the B-gal containing pBlueBac III).
- a vector will be designed for production of the subject ALK7 and/or ActRIIB polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors
- the subject gene constructs can be used to cause expression of the subject ALK7 and/or ActRIIB polypeptide in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for purification.
- This disclosure also pertains to a host cell transfected with a recombinant gene including a coding sequence for one or more of the subject ALK7 and/or ActRIIB
- the host cell may be any prokaryotic or eukaryotic cell.
- an ALK7 and/or ActRIIB polypeptide may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells [e.g. a Chinese hamster ovary (CHO) cell line].
- bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells [e.g. a Chinese hamster ovary (CHO) cell line].
- insect cells e.g., using a baculovirus expression system
- yeast e.g., Chinese hamster ovary (CHO) cell line
- mammalian cells e.g. a Chinese hamster ovary (CHO) cell line.
- Other suitable host cells are known to those skilled in the art.
- the present disclosure further pertains to methods of producing the subject ALK7 and/or ActRIIB polypeptides.
- a host cell transfected with an expression vector encoding an ALK7 and/or ActRIIB polypeptide can be cultured under appropriate conditions to allow expression of the ALK7 and/or ActRIIB polypeptide to occur.
- the polypeptide may be secreted and isolated from a mixture of cells and medium containing the polypeptide.
- ALK7 and/or ActRIIB polypeptide may be isolated from a cytoplasmic or membrane fraction obtained from harvested and lysed cells.
- a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
- the subject polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion- exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, immunoaffinity purification with antibodies specific for particular epitopes of ALK7 and/or ActRIIB polypeptides and affinity purification with an agent that binds to a domain fused to ALK7 and/or ActRIIB polypeptide (e.g., a protein A column may be used to purify ALK7-Fc and/or ActRIIB-Fc fusion proteins).
- the ALK7 and/or ActRIIB polypeptide is a fusion protein containing a domain which facilitates its purification.
- purification is achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenyl sepharose chromatography, size exclusion chromatography, and cation exchange chromatography.
- the purification could be completed with viral filtration and buffer exchange.
- An ALK7 and/or ActRIIB polypeptide, as well as fusion proteins and heteromeric complexes thereof, may be purified to a purity of >90%, >95%, >96%, >98%, or >99% as determined by size exclusion chromatography and >90%, >95%, >96%, >98%, or >99% as determined by SDS PAGE.
- a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant ALK7 and/or ActRIIB polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni 2+ metal resin.
- purification leader sequence can then be subsequently removed by treatment with
- enterokinase to provide the purified ALK7 and/or ActRIIB polypeptide, as well as
- the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
- PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence. See, e.g., Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992.
- an ALK7:ActRIIB antagonist is an antibody (ALK7:ActRIIB antagonist antibody), or combination of antibodies.
- An ALK7:ActRIIB antagonist antibody, or combination of antibodies may bind to, for example, one or more ALK7 ligands, ActRIIB ligands, ALK7:ActRIIB-binding ligands, an ALK7 receptor, an ActRIIB receptor, and/or a TGF-beta superfamily co-receptor (e.g., Crypto or Cryptic).
- ALK7:ActRIIB antagonist antibodies may be used, alone or in combination with one or more supportive therapies or active agents, to treat a patient in need thereof (e.g., patients having kidney disease and/or a metabolic disorder or condition).
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits one or more of the ligands bound or likely bound by an ALK7: ActRIIB heteromultimer, such as activin B, GDFl l, activin A, BMP10, BMP6, BMP5, GDF3, activin C, activin E, activin AC, activin BC, activin AE, nodal, or activin BE.
- an ALK7:ActRIIB antagonist antibody binds to at least one of such ligands.
- an activin C antibody or anti-activin C antibody generally refers to an antibody that can bind to activin C with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting activin C.
- the extent of binding of a activin C antibody to an unrelated, non-activin C protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to activin C as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an activin C antibody binds to an epitope of activin C that is conserved among activin C from different species.
- an anti-activin C antibody binds to human activin C.
- an activin C antibody may inhibit activin C from binding to a type I and/or type II receptor (e.g., ActRIIB and/or ALK7) and thus inhibit activin C-mediated signaling (e.g., Smad signaling).
- an activin C antibody may inhibit activin C from binding to a co-receptor and thus inhibit activin C-mediated signaling (e.g., Smad signaling). It should be noted that activin C shares some sequence homology to activin A, B and E and therefore antibodies that bind to activin C, in some instances, may also bind to and/or inhibit another activin.
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to, for example, activin C and further binds to, for example, one or more additional TGF- ⁇ superfamily ligands that bind to ALK7:ActRIIB heteromultimer [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, or activin BE), GDF11, GDF8, BMP10, BMP6, BMP5, nodal, and GDF3], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, or activin BE
- a multispecific antibody that binds to activin C does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a combination of antibodies that bind to, for example, two or more TGF- ⁇ superfamily ligand that bind to ALK7: ActRIIB heteromultimer [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, or activin BE), GDF11, GDF8, BMP10, BMP6, BMP 5, nodal, and GDF] one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- a combination of antibodies does not comprise a BMP9 antibody.
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least GDF8. Therefore, in some embodiments, an ALK7:ActRIIB antagonist antibody, or combination of antibodies, binds to at least GDF8.
- a GDF8 antibody or anti-GDF8 antibody generally refers to an antibody that binds to GDF8 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting GDF8.
- the extent of binding of a GDF8 antibody to an unrelated, non- GDF8 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to GDF8 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a GDF8 antibody binds to an epitope of GDF8 that is conserved among GDF8 from different species.
- an anti-GDF8 antibody binds to human GDF8.
- a GDF8 antibody may inhibit GDF8 from binding to a type I and/or type II receptor (e.g., ActRIIB and/or ALK7) and thus inhibit GDF8-mediated signaling (e.g., Smad signaling).
- a GDF8 antibody may inhibit GDF8 from binding to a co-receptor and thus inhibit GDF8-mediated signaling (e.g., Smad signaling).
- GDF8 has high sequence homology to GDF11 and therefore antibodies that bind to GDF8, in some instances, may also bind to and/or inhibit GDF11.
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to GDF8 and further binds to, for example, one or more additional TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF11, BMP10, BMP6, BMP 5, nodal, and GDF3], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE
- a multispecific antibody that binds to GDF8 does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a GDF8 antibody and one or more additional antibodies that bind to, for example, one or more additional TGF- ⁇ superfamily ligand [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF11, GDF3, BMP6, BMP10, nodal, and BMP5], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- a combination of antibodies that comprises a GDF8 antibody does not comprise a BMP9 antibody.
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least GDFl 1. Therefore, in some embodiments, an ALK7: ActRIIB antagonist antibody, or combination of antibodies, binds to at least GDFl 1.
- a GDFl 1 antibody or anti-GDFl 1 antibody generally refers to an antibody that binds to GDFl 1 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting GDFl 1.
- the extent of binding of a GDFl 1 antibody to an unrelated, non-GDFl 1 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to GDFl 1 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a GDFl 1 antibody binds to an epitope of GDFl 1 that is conserved among GDFl 1 from different species.
- an anti-GDFl 1 antibody binds to human GDFl 1.
- a GDFl 1 antibody may inhibit GDFl 1 from binding to a type I and/or type II receptor (e.g., ActRIIB and/or ALK7) and thus inhibit GDFl 1 -mediated signaling (e.g., Smad signaling).
- a GDFl 1 antibody may inhibit GDFl 1 from binding to a co-receptor and thus inhibit GDFl 1 -mediated signaling (e.g., Smad signaling).
- GDFl 1 has high sequence homology to GDF8 and therefore antibodies that bind to GDFl 1, in some instances, may also bind to and/or inhibit GDF8.
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to GDFl 1 and further binds to, for example, one or more additional TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDFl 1, BMP10, BMP6, BMP5, nodal, and GDF3], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE
- GDFl 1 BMP10, BMP6, BMP5, nodal, and GDF3
- a multispecific antibody that binds to GDFl 1 does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a GDFl 1 antibody and one or more additional antibodies that bind to, for example, one or more additional TGF- ⁇ superfamily ligand [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF8, GDF3, BMP6, BMP10, nodal, and BMP5], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE
- GDF8 GDF3, BMP6, BMP10 nodal, and BMP5
- type I receptor and/or type II receptors e
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least activin (activin A, activin B, activin C, activin E, activin AB, activin AC, activin AE, activin BC and/or activin BE). Therefore, in some embodiments, an ALK7:ActRIIB antagonist antibody, or combination of antibodies, binds to at least activin (activin A, activin B, activin C, activin E, activin AB, activin AC, activin AE, activin BC and/or activin BE).
- an activin antibody (or anti-activin antibody) generally refers to an antibody that can bind to a form of activin with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting that form of activin.
- the extent of binding of an activin antibody to an unrelated, non-activin protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to activin as measured, for example, by a
- an activin antibody binds to an epitope of activin that is conserved among activin from different species.
- an anti-activin antibody binds to human activin.
- a activin antibody may inhibit activin from binding to a type I and/or type II receptor (e.g., ActRIIB and/or ALK7) and thus inhibit activin-mediated signaling (e.g., Smad signaling).
- an activin antibody binds to activin B.
- an activin antibody binds to activin A.
- an activin antibody binds to activin A and activin B. In some embodiments, an activin antibody binds to activin AB. In some embodiments, an activin antibody binds to activin C. In some embodiments, an activin antibody binds to activin E. In some embodiments, an activin antibody binds to activin A and activin C. In some embodiments, an activin antibody binds to activin AC. In some embodiments, an activin antibody binds to activin A and activin E. In some embodiments, an activin antibody binds to activin AE. In some embodiments, an activin antibody binds to activin B and activin C. In some embodiments, an activin antibody binds to activin BC.
- an activin antibody binds to activin B and activin E. In some embodiments, an activin antibody binds to activin BE. In some embodiments, an activin antibody binds to activin A, activin B, and activin C. In some embodiments, an activin antibody binds to activin A, activin B, and activin E. Optionally, an activin antibody that binds to one or more of activin A, activin B, and activin C may further bind to activin E.
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to activin and further binds to, for example, one or more additional TGF- ⁇ superfamily ligands [e.g., GDFl 1, GDF8, BMP10, BMP6, BMP 5, nodal, and GDF3], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- TGF- ⁇ superfamily ligands e.g., GDFl 1, GDF8, BMP10, BMP6, BMP 5, nodal, and GDF3
- type I receptor and/or type II receptors e.g., ActRIIB and/or ALK7
- co-receptors e.g., ActRIIB and/or ALK7
- a multispecific antibody that binds to activin does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M.
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the
- combination of antibodies comprises an activin antibody and one or more additional antibodies that bind to, for example, one or more additional TGF- ⁇ superfamily ligand [e.g., GDFl 1, GDF8 GDF3, BMP6, BMP10, nodal, and BMP5], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- additional TGF- ⁇ superfamily ligand e.g., GDFl 1, GDF8 GDF3, BMP6, BMP10, nodal, and BMP5
- type I receptor and/or type II receptors e.g., ActRIIB and/or ALK7
- co-receptors e.g., ActRIIB and/or ALK7
- a combination of antibodies that comprises an activin antibody does not comprise a BMP9 antibody.
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least BMP6. Therefore, in some embodiments, an ALK7: ActRIIB antagonist antibody, or combination of antibodies, binds to at least BMP6.
- a BMP6 antibody or anti-BMP6 antibody generally refers to an antibody that can bind to BMP6 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting BMP6.
- the extent of binding of a BMP6 antibody to an unrelated, non-BMP6 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to BMP6 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a BMP6 antibody binds to an epitope of BMP6 that is conserved among BMP6 from different species.
- an anti-BMP6 antibody binds to human BMP6.
- a BMP6 antibody may inhibit BMP6 from binding to a type I and/or type II receptor (e.g., ActRIIB and/or ALK7) and thus inhibit BMP6-mediated signaling (e.g., Smad signaling).
- a BMP6 antibody may inhibit BMP6 from binding to a co-receptor and thus inhibit BMP6-mediated signaling (e.g., Smad signaling).
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to BMP6 and further binds to, for example, one or more additional TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF8, BMP10, GDF11, BMP5, nodal, and GDF3], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE
- GDF8 BMP10 e.g., GDF11, BMP5, nodal, and GDF3
- a multispecific antibody that binds to BMP6 does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a BMP6 antibody and one or more additional antibodies that bind to, for example, one or more additional TGF- ⁇
- a combination of antibodies that comprises a BMP6 antibody does not comprise a BMP9 antibody.
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least GDF3. Therefore, in some embodiments, an ALK7: ActRIIB antagonist antibody, or combination of antibodies, binds to at least GDF3.
- a GDF3 antibody or anti-GDF3 antibody generally refers to an antibody that binds to GDF3 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting GDF3.
- the extent of binding of a GDF3 antibody to an unrelated, non-GDF3 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%), 4%), 3%), 2%), or less than about 1% of the binding of the antibody to GDF3 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a GDF3 antibody binds to an epitope of GDF3 that is conserved among GDF3 from different species.
- a GDF3 antibody binds to human GDF3.
- a GDF3 antibody may inhibit GDF3 from binding to a type I and/or type II receptor (e.g., ActRIIB and/or ALK7) and thus inhibit GDF3-mediated signaling (e.g., Smad signaling).
- a GDF3 antibody may inhibit GDF3 from binding to a co-receptor and thus inhibit GDF3 -mediated signaling (e.g., Smad signaling).
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to GDF3 and further binds to, for example, one or more additional TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF11, BMP 10, BMP6, BMP5, and nodal , one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE
- GDF11 e.g., BMP 10, BMP6, BMP5, and nodal
- type I receptor and/or type II receptors
- a multispecific antibody that binds to GDF3 does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the
- combination of antibodies comprises a GDF3 antibody and one or more additional antibodies that bind to, for example, one or more additional TGF- ⁇ superfamily ligand [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, activin BE), GDF11, BMP 10, BMP6, BMP5, and nodal , one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- a combination of antibodies that comprises a GDF3 antibody does not comprise a BMP9 antibody.
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least BMP5. Therefore, in some embodiments, an ALK7:ActRIIB antagonist antibody, or combination of antibodies, binds to at least BMP5.
- a BMP5 antibody or anti-BMP5 antibody generally refers to an antibody that binds to BMP5 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting BMP5.
- the extent of binding of a BMP5 antibody to an unrelated, non-BMP5 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to BMP5 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a BMP5 antibody binds to an epitope of BMP5 that is conserved among BMP5 from different species.
- an anti-BMP5 antibody binds to human BMP5.
- a BMP5 antibody may inhibit BMP5 from binding to a type I and/or type II receptor (e.g., ActRIIB and/or ALK7) and thus inhibit BMP5 -mediated signaling (e.g., Smad signaling).
- a BMP5 antibody may inhibit BMP5 from binding to a co-receptor and thus inhibit BMP5-mediated signaling (e.g., Smad signaling).
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to BMP5 and further binds to, for example, one or more additional TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF8, BMPIO, BMP6, GDF11, nodal, and GDF3], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- GDF8 BMPIO BMP6, GDF11, nodal, and GDF3
- a multispecific antibody that binds to BMP 5 does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a BMP5 antibody and one or more additional antibodies that bind to, for example, one or more additional TGF- ⁇ superfamily ligand [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE, and activin BE), GDF8 GDF3, BMP6, BMPIO, nodal, and GDF11], type I receptor, and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or co-receptor.
- a combination of antibodies that comprises a BMP5 antibody does not comprise a BMP9 antibody.
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least BMPIO. Therefore, in some embodiments, an ALK7:ActRIIB antagonist antibody, or combination of antibodies, binds to at least BMPIO.
- a BMPIO antibody or anti-BMPIO antibody generally refers to an antibody that can bind to BMPIO with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting BMPIO.
- the extent of binding of a BMPIO antibody to an unrelated, non-BMP10 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to BMP10 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a BMPIO antibody binds to an epitope of BMP10 that is conserved among BMP10 from different species.
- an anti-BMPIO antibody binds to human BMP10.
- a BMP10 antibody may inhibit BMPIO from binding to a type I and/or type II receptor (e.g., ActRIIB and/or ALK7) and thus inhibit BMP10 -mediated signaling (e.g., Smad signaling).
- a BMP10 antibody may inhibit BMPIO from binding to a co-receptor and thus inhibit BMPlO-mediated signaling (e.g., Smad signaling).
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to BMP10 and further binds to, for example, one or more additional TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF8, GDF11, BMP6, BMP5, nodal, and GDF3], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co-receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- a multispecific antibody that binds to BMP 10 does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a BMP10 antibody and one or more additional antibodies that bind to, for example, one or more additional TGF- ⁇
- a combination of antibodies that comprises a BMP10 antibody does not comprise a BMP9 antibody.
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least nodal. Therefore, in some embodiments, an ALK7:ActRIIB antagonist antibody, or combination of antibodies, binds to at least nodal.
- a nodal antibody or anti-nodal antibody generally refers to an antibody that can bind to nodal with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting nodal.
- the extent of binding of a nodal antibody to an unrelated, non-nodal protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%), 2%), or less than about 1% of the binding of the antibody to nodal as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein interaction or binding affinity assay.
- a nodal antibody binds to an epitope of nodal that is conserved among nodal from different species.
- an anti- nodal antibody binds to human nodal.
- a nodal antibody may inhibit nodal from binding to a type I and/or type II receptor (e.g., ActRIIB and/or ALK7) and thus inhibit nodal-mediated signaling (e.g., Smad signaling).
- a nodal antibody may inhibit nodal from binding to a co-receptor and thus inhibit nodal -mediated signaling (e.g., Smad signaling).
- the disclosure relates to a
- multispecific antibody e.g., bi-specific antibody
- uses thereof that binds to nodal and further binds to, for example, one or more additional TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF8, GDFl 1, BMP6, BMP5, BMP10, and GDF3], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co- receptors.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- type I receptor and/or type II receptors e.g., ActRII
- a multispecific antibody that binds to nodal does not bind or does not substantially bind to BMP9 (e.g., binds to BMP9 with a K D of greater than 1 x 10 " 7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a nodal antibody and one or more additional antibodies that bind to, for example, one or more additional TGF- ⁇ superfamily ligand [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF8 GDF3, BMP6, GDF11, BMP10, and BMP5], one or more type I receptor and/or type II receptors (e.g., ActRIIB and/or ALK7), and/or one or more co- receptors.
- a combination of antibodies that comprises a nodal antibody does not comprise a BMP9 antibody.
- an antibody may be designed as a bispecific antibody comprising a first portion that binds to an epitope of such ligand, such that the first portion of the antibody competes for binding with a type I receptor and comprising a second portion that binds to an epitope of such ligand, such that the second portion of the antibody competes for binding with a type II receptor.
- a bispecific antibody targeting a single ligand can be designed to mimic the dual type I-type II receptor binding blockade that may be conferred by an ALK7: ActRIIB heteromultimer.
- the same effect could be achieved using a combination of two or more antibodies wherein at least a first antibody binds to an epitope of such ligand, such that the first antibody competes for binding with a type I receptor and at least a second antibody binds to an epitope of such ligand, such that the the second antibody competes for binding with a type II receptor.
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least ActRIIB. Therefore, in some embodiments, an ALK7:ActRIIB antagonist antibody, or combination of antibodies, binds to at least ActRIIB.
- an ActRIIB antibody (anti-ActRIIB antibody) generally refers to an antibody that binds to ActRIIB with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting ActRIIB.
- the extent of binding of an anti- ActRIIB antibody to an unrelated, non- ActRIIB protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to ActRIIB as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein- protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-ActRIIB antibody binds to an epitope of ActRIIB that is conserved among ActRIIB from different species.
- an anti-ActRIIB antibody binds to human
- an anti-ActRIIB antibody may inhibit one or more TGF- ⁇ superfamily ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) GDF3, BMP6, BMP10, nodal and BMP9] from binding to ActRIIB and/or ALK7.
- TGF- ⁇ superfamily ligands e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) GDF3, BMP6, BMP10, nodal and BMP9] from binding to ActRIIB and/or ALK7.
- an anti-ActRIIB antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to ActRIIB and one or more TGF- ⁇ superfamily ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, nodal, and BMP9], type I receptor (e.g., ALK7), co-receptor, and/or an additional type II receptor.
- TGF- ⁇ superfamily ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, nodal, and BMP9]
- type I receptor e.g., ALK7
- co-receptor e.g., ALK7
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an anti-ActRIIB antibody and one or more additional antibodies that bind to, for example, one or more TGF- ⁇ superfamily ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) GDF3, BMP6, BMP10, nodal, and BMP9], co- receptors, type I receptors (e.g., ALK7), and/or additional type II receptors.
- TGF- ⁇ superfamily ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) GDF3, BMP6, BMP10, nodal, and BMP9]
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least ALK7. Therefore, in some embodiments, an ALK7:ActRIIB antagonist antibody, or combination of antibodies, binds to at least ALK7.
- an ALK7 antibody (anti-ALK7 antibody) generally refers to an antibody that binds to ALK7 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting ALK7.
- the extent of binding of an anti- ALK7 antibody to an unrelated, non-ALK7 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to ALK7 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-ALK7 antibody binds to an epitope of ALK7 that is conserved among ALK7 from different species.
- an anti-ALK7 antibody binds to human ALK7.
- an anti-ALK7 antibody may inhibit one or more TGF- ⁇ superfamily ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) GDF3, BMP5, BMP6, and BMPIO] from binding to a type I receptor (e.g., ALK7), type II receptor (e.g., ActRIIB), or co-receptor.
- TGF- ⁇ superfamily ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE) GDF3, BMP5, BMP6, and BMPIO] from binding to a type I receptor (e.g., ALK7), type II receptor (e.g., ActRIIB), or co-
- an anti-ALK7 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to ALK7 and one or more TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF11, GDF8, BMPIO, BMP6, BMP 5, nodal, and GDF3, type II receptors (e.g., ActRIIB), co-receptors, and/or an additional type I receptor.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- GDF11, GDF8, BMPIO, BMP6, BMP 5, nodal e.g., ActRIIB
- co-receptors e.g., ActRIIB
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an anti-ALK7 antibody and one or more additional antibodies that bind to, for example, one or more TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF11, GDF8, BMPIO, BMP6, BMP5, nodal, and GDF3] , co-receptors, an additional type I receptor, and/or type II receptors (e.g., ActRIIB).
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- co-receptors e.g., ActRI
- an ALK7:ActRIIB antagonist antibody, or combination of antibodies is an antibody that inhibits at least Cripto or Cryptic. Therefore, in some embodiments, an ALK7:ActRIIB antagonist antibody, or combination of antibodies, binds to at least Cripto or Cryptic.
- an Cripto antibody (anti-Cripto antibody) generally refers to an antibody that binds to Cripto with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting Cripto.
- the extent of binding of an anti-Cripto antibody to an unrelated, non-Cripto protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to Cripto as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-Cripto antibody binds to an epitope of Cripto that is conserved among Cripto from different species.
- an anti-Cripto antibody binds to human Cripto.
- a Cryptic antibody generally refers to an antibody that binds to Cryptic with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting Cryptic.
- the extent of binding of an anti-Cripto antibody to an unrelated, non-Cryptic protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to Cryptic as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- an anti- Cryptic antibody binds to an epitope of Cryptic that is conserved among Cryptic from different species. In certain preferred embodiments, an anti- Cryptic antibody binds to human Cryptic. In some embodiments, an anti-Cripto or Cryptic antibody may inhibit one or more TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDFl 1, GDF8, BMP 10, BMP6, BMP5, nodal, and GDF3] from binding to Cripto or Cryptic, respectively, or to ActRIIB and/or ALK7.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- an anti-Cripto or Cryptic antibody may inhibit nodal from binding to a type I and/or type II receptor.
- an anti- Cripto or Cryptic antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to Cripto or Cryptic and one or more TGF- ⁇ superfamily [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDFl 1, GDF8, BMP10, BMP6, BMP 5, nodal, and GDF3] , type I receptor (e.g., ALK7), additional co-receptor, and/or type II receptor.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- an antibody may bind to both Cripto and Cryptic.
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an anti-Cripto or Cryptic antibody and one or more additional antibodies that bind to, for example, one or more TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDFl 1, GDF8, BMP 10, BMP6, BMP5, nodal, and GDF3], additional co-receptors, type I receptors (e.g., ALK7), and/or type II receptors.
- TGF- ⁇ superfamily ligands e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDFl 1, GDF
- heteromultimeric complexes there are a variety of methods for generating heteromultimeric complexes. Such methods may be used to generate heteromultimer complexes comprising an antibody -binding domain (e.g., a complex of V L and V H chains) and one or more polypeptides selected from an ALK7 polypeptide, an ActRIIB polypeptide, an ALK7:ActRIIB heteromer, or an ALK7:ActRIIB single trap polypeptide. See Figure 10A, 10B and 12D.
- an antibody -binding domain e.g., a complex of V L and V H chains
- polypeptides selected from an ALK7 polypeptide, an ActRIIB polypeptide, an ALK7:ActRIIB heteromer, or an ALK7:ActRIIB single trap polypeptide See Figure 10A, 10B and 12D.
- the disclosure provides protein complexes comprising a ligand- binding domain of an antibody that binds to an ALK7: ActRIIB -binding ligand [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDFl 1, GDF8, BMP10, BMP6, BMP 5, nodal, and GDF3] which is covalently or non-covalently associated with an ALK7 polypeptide.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- GDFl 1 GDF8, BMP10, BMP6, BMP 5, nodal
- GDF3 which is covalently or non-covalently associated with an ALK7 polypeptide.
- the disclosure provides protein complexes comprising a ligand-binding domain of an antibody that binds to an ALK7: ActRIIB -binding ligand [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF11, GDF8, BMP10, BMP6, BMP 5, nodal, and GDF3] which is covalently or non- covalently associated with an ActRIIB polypeptide.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- GDF11, GDF8, BMP10, BMP6, BMP 5, nodal e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- the disclosure provides protein complexes comprising a ligand-binding domain of an antibody that binds to an ALK7:ActRIIB-binding ligand [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF11, GDF8, BMP 10, BMP6, BMP5, nodal, and GDF3] which is covalently or non-covalently associated with an ALK7:ActRIIB single-chain ligand trap.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- GDF11, GDF8, BMP 10, BMP6, BMP5, nodal e.g., BMP6, BMP5, nodal
- the disclosure provides protein complexes comprising a ligand-binding domain of an antibody that binds to an ALK7:ActRIIB-binding ligand [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE), GDF11, GDF8, BMP 10, BMP6, BMP5, nodal, and GDF3] which is covalently or non-covalently associated with ALK7: ActRIIB heteromultimer.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and activin BE
- GDF11, GDF8, BMP 10, BMP6, BMP5, nodal e.g., BMP6, BMP5, nodal
- GDF3 e.g., activin A, activin B, activin C, activin E, activ
- antibody is used herein in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
- An antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
- antibody fragments include, but are not limited to, Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies; linear antibodies; single-chain antibody molecules (e.g., scFv); and multispecific antibodies formed from antibody fragments [see, e.g., Hudson et al. (2003) Nat. Med. 9: 129-134; Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer- Verlag, New York), pp. 269-315 (1994); WO 93/16185; and U.S. Pat. Nos. 5,571,894;
- Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific [see, e.g., EP 404,097; WO 1993/01161; Hudson et al.
- Single-domain antibodies are antibody fragments comprising all or a portion of the heavy-chain variable domain or all or a portion of the light-chain variable domain of an antibody.
- a single-domain antibody is a human single- domain antibody [see, e.g., U.S. Pat. No. 6,248,516].
- Antibodies disclosed herein may be polyclonal antibodies or monoclonal antibodies.
- the antibodies of the present disclosure comprise a label attached thereto and able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme, or enzyme co-factor).
- the antibodies of the present disclosure are isolated antibodies.
- the antibodies of the present disclosure are recombinant antibodies.
- the antibodies herein may be of any class.
- the class of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
- IgA immunoglobulin
- IgD immunoglobulin
- IgE immunoglobulin
- IgG immunoglobulin
- IgM immunoglobulins
- an antibody for use in the methods disclosed herein specifically binds to its target antigen, preferably with high binding affinity.
- Affinity may be expressed as a K D value and reflects the intrinsic binding affinity (e.g., with minimized avidity effects).
- binding affinity is measured in vitro, whether in a cell-free or cell-associated setting. Any of a number of assays known in the art, including those disclosed herein, can be used to obtain binding affinity measurements including, for example, Biacore, radiolabeled antigen-binding assay (RIA), and ELISA.
- antibodies of the present disclosure bind to their target antigens (e.g.
- K D is measured by RIA performed with the Fab version of an antibody of interest and its target antigen as described by the following assay.
- Solution binding affinity of Fabs for the antigen is measured by equilibrating Fab with a minimal concentration of radiolabeled antigen (e.g. , 125 I-labeled) in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate [see, e.g., Chen et al. (1999) J. Mol. Biol. 293 :865-881].
- multi-well plates e.g., MICRO TITER® from Thermo Scientific
- a capturing anti-Fab antibody e.g. , from Cappel Labs
- bovine serum albumin preferably at room temperature (approximately 23°C).
- radiolabeled antigen are mixed with serial dilutions of a Fab of interest [e.g., consistent with assessment of the anti-VEGF antibody, Fab-12, in Presta et al , (1997) Cancer Res. 57:4593-4599].
- the Fab of interest is then incubated, preferably overnight but the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation, preferably at room temperature for about one hour. The solution is then removed and the plate is washed times several times, preferably with polysorbate 20 and PBS mixture. When the plates have dried, scintillant (e.g., MICROSCINT ® from Packard) is added, and the plates are counted on a gamma counter (e.g., TOPCOUNT ® from Packard).
- a gamma counter e.g., TOPCOUNT ® from Packard
- K D is measured using surface plasmon resonance assays using, for example a BIACORE ® 2000 or a BIACORE ® 3000 (BIAcore, Inc., Piscataway, N.J.) with immobilized antigen CM5 chips at about 10 response units (RU).
- CM5 carboxy methylated dextran biosensor chips
- EDC N-ethyl-N'-(3-dimethylaminopropyl)-carbodiimide hydrochloride
- NHS N- hydroxysuccinimide
- an antigen can be diluted with 10 mM sodium acetate, pH 4.8, to 5 ⁇ g/ml (about 0.2 ⁇ ) before injection at a flow rate of 5 ⁇ /minute to achieve approximately 10 response units (RU) of coupled protein.
- 1 M ethanolamine is injected to block unreacted groups.
- two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% polysorbate 20 (TWEEN-20 ® ) surfactant (PBST) at at a flow rate of approximately 25 ⁇ /min.
- Association rates (k on ) and dissociation rates (k 0ff ) are calculated using, for example, a simple one-to-one Langmuir binding model (BIACORE ® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams.
- the equilibrium dissociation constant (K D ) is calculated as the ratio k off / k on [see, e.g., Chen et al, (1999) J. Mol. Biol. 293 :865-881].
- Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g., E. coli or phage), as described herein.
- recombinant host cells e.g., E. coli or phage
- the nucleic acid and amino acid sequences of human ActRIIB, activin (activin A, activin B, activin C, and activin E), GDF11, GDF8, BMP10, BMP6, GDF3, nodal, and/or BMP5 are known in the art.
- numerous methods for generating antibodies are well known in the art, some of which are described herein. Therefore antibody antagonists for use in accordance with this disclosure may be routinely made by the skilled person in the art based on the knowledge in the art and teachings provided herein.
- an antibody provided herein is a chimeric antibody.
- a chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species. Certain chimeric antibodies are described, for example, in U.S. Pat. No. 4,816,567; and Morrison et al, (1984) Proc. Natl. Acad. Sci. USA, 81 :6851-6855.
- a chimeric antibody comprises a non-human variable region ⁇ e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non- human primate, such as a monkey) and a human constant region.
- a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody.
- chimeric antibodies include antigen- binding fragments thereof.
- a chimeric antibody provided herein is a humanized antibody.
- a humanized antibody refers to a chimeric antibody comprising amino acid residues from non-human hypervariable regions (HVRs) and amino acid residues from human framework regions (FRs).
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
- a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
- a "humanized form" of an antibody refers to an antibody that has undergone humanization.
- Humanized antibodies and methods of making them are reviewed, for example, in Almagro and Fransson (2008) Front. Biosci. 13 : 1619-1633 and are further described, for example, in Riechmann et al., (1988) Nature 332:323-329; Queen et al. (1989) Proc. Nat'l Acad. Sci. USA 86: 10029-10033; U.S. Pat. Nos.
- Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best-fit” method [see, e.g., Sims et al. (1993) J. Immunol. 151 :2296 ]; framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions [see, e.g., Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89:4285; and Presta et al.
- an antibody provided herein is a human antibody.
- Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel (2008) Curr. Opin. Pharmacol. 5: 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459.
- human antibodies may be prepared by administering an immunogen ⁇ e.g., a GDF11 polypeptide, an activin B polypeptide, an ActRIIA polypeptide, or an ActRIIB polypeptide) to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge.
- Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes.
- the endogenous immunoglobulin loci have generally been inactivated.
- Human variable regions from intact antibodies generated by such animals may be further modified, for example, by combining with a different human constant region.
- Human antibodies provided herein can also be made by hybridoma-based methods.
- Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described [see, e.g., Kozbor J. Immunol., (1984) 133 : 3001; Brodeur et al. (1987) Monoclonal Antibody Production Techniques and Applications, pp. 51- 63, Marcel Dekker, Inc., New York; and Boerner et al. (1991) J. Immunol., 147: 86].
- Human antibodies generated via human B-cell hybridoma technology are also described in Li et al, (2006) Proc. Natl. Acad. Sci. USA, 103 :3557-3562. Additional methods include those described, for example, in U.S. Pat.
- antibodies of the present disclosure may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities.
- a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, for example, in Hoogenboom et al. (2001) in Methods in Molecular Biology 178: 1- 37, O'Brien et al, ed., Human Press, Totowa, N.J. and further described, for example, in the McCafferty et al. (1991) Nature 348:552-554; Clackson et al, (1991) Nature 352: 624-628; Marks et al. (1992) J. Mol. Biol.
- repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al. (1994) Ann. Rev. Immunol., 12: 433-455.
- Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
- Libraries from immunized sources provide high-affinity antibodies to the immunogen ⁇ e.g., ALK7, ActRIIB, activin, GDF11, GDF8, BMP10, BMP6, GDF3, and/or BMP5) without the requirement of constructing hybridomas.
- naive repertoire can be cloned ⁇ e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al. (1993) EMBO J, 12: 725-734.
- naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter (1992) J. Mol. Biol., 227: 381-388.
- Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and U.S. Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598,
- an antibody provided herein is a multispecific antibody, for example, a bispecific antibody.
- Multispecific antibodies typically monoclonal antibodies that have binding specificities for at least two different epitopes ⁇ e.g., two, three, four, five, or six or more) on one or more ⁇ e.g., two, three, four, five, six or more) antigens.
- Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy-chain/light-chain pairs having different specificities [see, e.g., Milstein and Cuello (1983) Nature 305: 537; International patent publication no. WO 93/08829; and Traunecker et al. (1991) EMBO J. 10: 3655, and U.S. Pat. No. 5,731, 168 ("knob-in-hole” engineering)].
- Multispecific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (see, e.g., WO 2009/089004A1); cross-linking two or more antibodies or fragments [see, e.g., U.S. Pat. No. 4,676,980; and Brennan et al. (1985) Science, 229: 81]; using leucine zippers to produce bispecific antibodies [see, e.g., Kostelny et al. (1992) J. Immunol., 148(5): 1547-1553]; using "diabody” technology for making bispecific antibody fragments [see, e.g., Hollinger et al. (1993) Proc. Natl.
- Multispecific antibodies can be prepared as full-length antibodies or antibody fragments.
- an antibody disclosed herein is a monoclonal antibody.
- Monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
- polyclonal antibody preparations which typically include different antibodies directed against different epitopes
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single epitope on an antigen.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present methods may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
- anti-protein/anti-peptide antisera or monoclonal antibodies can be made by standard protocols [see, e.g., Antibodies: A Laboratory Manual ed. by Harlow and Lane (1988) Cold Spring Harbor Press: 1988].
- a mammal such as a mouse, hamster, or rabbit, can be immunized with an immunogenic form of the activin polypeptide, an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein.
- Techniques for conferring immunogenicity on a protein or peptide include conjugation to carriers or other techniques well known in the art.
- An immunogenic portion of a activin polypeptide can be administered in the presence of adjuvant.
- the progress of immunization can be monitored by detection of antibody titers in plasma or serum.
- Standard ELISA or other immunoassays can be used with the immunogen as antigen to assess the levels of antibody production and/or level of binding affinity.
- antisera can be obtained and, if desired, polyclonal antibodies can be isolated from the serum.
- antibody -producing cells lymphocytes
- immortalizing cells such as myeloma cells to yield hybridoma cells.
- Hybridoma cells can be screened immunochemically for production of antibodies specifically reactive with a activin polypeptide, and monoclonal antibodies isolated from a culture comprising such hybridoma cells.
- one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein thereby generating an Fc region variant.
- the Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g., a substitution, deletion, and/or addition) at one or more amino acid positions.
- the present disclosure contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody in vivo is important yet certain effector functions [e.g., complement-dependent cytotoxicity (CDC) and antibody-dependent cellular cytotoxicity (ADCC)] are unnecessary or deleterious.
- CDC complement-dependent cytotoxicity
- ADCC antibody-dependent cellular cytotoxicity
- In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
- Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
- NK cells express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII.
- FcR expression on hematopoietic cells is summarized in, for example, Ravetch and Kinet (1991) Annu. Rev. Immunol. 9:457-492.
- Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest are described in U.S. Pat. No. 5,500,362; Hellstrom, I. et al. (1986) Proc. Natl. Acad. Sci. USA 83 :7059-7063];
- non-radioactive assays methods may be employed (e.g., ACTITM, non-radioactive cytotoxicity assay for flow cytometry; CellTechnology, Inc. Mountain View, Calif ; and CytoTox 96 ® non-radioactive cytotoxicity assay, Promega, Madison, Wis.).
- PBMC peripheral blood mononuclear cells
- NK natural killer cells
- ADCC activity of the molecule of interest may be assessed in vivo, for example, in an animal model such as that disclosed in Clynes et al. (1998) Proc. Natl. Acad. Sci. USA 95:652-656.
- Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity [see, e.g., Clq and C3c binding ELISA in WO 2006/029879 and WO 2005/100402].
- a CDC assay may be performed [see, e.g, Gazzano-Santoro et al. (1996) J. Immunol. Methods 202: 163; Cragg, M. S. et al. (2003) Blood 101 : 1045-1052; and Cragg, M. S, and M. J. Glennie (2004) Blood 103 :2738-2743].
- FcRn binding and in vivo clearance/half-life determinations can also be performed using methods known in the art [see, e.g., Petkova, S. B. et al. (2006) Intl. Immunol. 18(12): 1759-1769].
- Antibodies of the present disclosure with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056).
- Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
- cysteine engineered antibodies e.g., "thioMAbs”
- one or more residues of an antibody are substituted with cysteine residues.
- the substituted residues occur at accessible sites of the antibody.
- reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
- any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region.
- Cysteine engineered antibodies may be generated as described, for example, in U.S. Pat. No. 7,521,541.
- the techniques used to screen antibodies in order to identify a desirable antibody may influence the properties of the antibody obtained. For example, if an antibody is to be used for binding an antigen in solution, it may be desirable to test solution binding.
- a variety of different techniques are available for testing interactions between antibodies and antigens to identify particularly desirable antibodies. Such techniques include ELISAs, surface plasmon resonance binding assays ⁇ e.g., the Biacore binding assay, Biacore AB, Uppsala, Sweden), sandwich assays ⁇ e.g., the paramagnetic bead system of IGEN
- amino acid sequence variants of the antibodies and/or the binding polypeptides provided herein are contemplated.
- Amino acid sequence variants of an antibody and/or binding polypeptides may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody and/or binding polypeptide, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody and/or binding polypeptide. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., target-binding (e.g., and activin such as activin E and/or activin C binding).
- target-binding e.g., and activin such as activin E and/or activin C binding
- Alterations may be made in HVRs, for example, to improve antibody affinity.
- Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process [see, e.g., Chowdhury (2008) Methods Mol. Biol. 207: 179-196 (2008)], and/or SDRs (a-CDRs), with the resulting variant VH or VL being tested for binding affinity.
- Affinity maturation by constructing and reselecting from secondary libraries has been described in the art [see, e.g., Hoogenboom et al, in Methods in Molecular Biology 178: 1-37, O'Brien et al., ed., Human Press, Totowa, N.J., (2001).
- affinity maturation diversity is introduced into the variable genes chosen for maturation by any of a variety of methods ⁇ e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis).
- a secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity.
- HVR-directed approaches in which several HVR residues ⁇ e.g., 4-6 residues at a time) are randomized.
- HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling.
- CDR-H3 and CDR-L3 in particular are often targeted.
- substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind to the antigen.
- conservative alterations ⁇ e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs.
- Such alterations may be outside of HVR "hotspots" or SDRs.
- each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
- a useful method for identification of residues or regions of the antibody and/or the binding polypeptide that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells (1989) Science, 244: 1081-1085.
- a residue or group of target residues e.g., charged residues such as Arg, Asp, His, Lys, and Glu
- a neutral or negatively charged amino acid e.g., alanine or polyalanine
- a crystal structure of an antigen-antibody complex is determined to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue.
- Other insertional variants of the antibody molecule include the fusion of the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
- an antibody and/or binding polypeptide provided herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
- the moieties suitable for derivatization of the antibody and/or binding polypeptide include but are not limited to water soluble polymers.
- Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG),
- dextran polyvinyl alcohol
- polyvinyl pyrrolidone poly-l,3-dioxolane
- poly-l,3,6-trioxane ethylene/maleic anhydride copolymer
- Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- the number of polymers attached to the antibody and/or binding polypeptide may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody and/or binding polypeptide to be improved, whether the antibody derivative and/or binding polypeptide derivative will be used in a therapy under defined conditions.
- an ALK7:ActRIIB antagonist is a small molecule (ALK7:ActRIIB small molecule antagonist), or combination of small molecule antagonists.
- ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists may inhibit, for example, one or more ALK7: ActRIIB-binding ligands, a type I receptor (e.g., ALK7), a type II receptor (e.g., ActRIIB), and/or co-receptor (e.g., Cripto or Cryptic).
- ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists inhibits signaling mediated by one or more ALK7:ActRIIB-binding ligands, for example, as determined in a cell-based assay such as those described herein.
- ALK7:ActRIIB small molecule antagonists may be used, alone or in combination with one or more supportive therapies or active agents, to treat a patient in need thereof (e.g., patients having kidney disease and/or a metabolic disorder).
- an ALK7:ActRIIB small molecule antagonist or combination of small molecule antagonists, inhibits at least GDF11.
- an ALK7:ActRIIB small molecule antagonist or combination of small molecule antagonists, inhibits at least GDF11.
- an ALK7:ActRIIB small molecule antagonist or combination of small molecule antagonists, inhibits at least GDF11.
- ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists inhibits at least GDF8.
- an ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists inhibits at least activin (activin A, activin B, activin C, activin E, activin AB, activin AC, activin BC, activin AE and/or activin BE).
- an ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists inhibits at least GDF11, GDF8, and activin.
- an ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists inhibits at least ALK7.
- an ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists inhibits at least ActRIIB.
- an ALK7:ActRIIB small molecule antagonist or combination of small molecule antagonists, inhibits at least Cripto or Cryptic.
- an ALK7:ActRIIB small molecule antagonist or combination of small molecule antagonists, inhibits at least Cripto or Cryptic.
- ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists inhibits at least BMP6.
- an ALK7: ActRIIB small molecule antagonist, or combination of small molecule antagonists inhibits at least GDF3.
- an ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists inhibits at least BMP5.
- an ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists inhibits at least BMP10.
- an ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists inhibits at least nodal. In some embodiments, an ALK7:ActRIIB small molecule antagonist, or combination of small molecule antagonists, as disclosed herein does not inhibit or does not substantially inhibit BMP9.
- ALK7:ActRIIB small molecule antagonists can be direct or indirect inhibitors.
- an indirect small molecule antagonist, or combination of small molecule antagonists may inhibit the expression (e.g., transcription, translation, cellular secretion, or combinations thereof) of at least one or more TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin B, activin BC, activin AE, or Activin BE), GDFl 1, BMP10, BMP9, BMP6, BMP5, GDF3, activin C, activin E, Activin AC, GDF8, BMP10, BMP6, BMP5, nodal, and GDF3, type I receptor (e.g., ALK7), type II receptors (e.g., ActRIIB), co-receptor (e.g., Cripto or Cryptic), and/or one or more TGF- ⁇ superfamily ligand
- a direct small molecule antagonist, or combination of small molecule antagonists may directly bind to and inhibit, for example, one or more TGF- ⁇ superfamily ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC, activin B, activin BC, activin AE, or Activin BE), GDFl 1, BMP10, BMP9, BMP6, BMP 5, GDF3, activin C, activin E, activin AC, GDF8, BMP10, BMP6, BMP5, nodal, and GDF3, type I receptors (e.g., ALK7), type II receptors (e.g., ActRIIB), co-receptors (e.g., Cripto or Cryptic), and/or downstream signaling components (e.g., Smads).
- TGF- ⁇ superfamily ligands e.g., activin (e.g., activin A, activin B, activ
- Binding small-molecule antagonists of the present disclosure may be identified and chemically synthesized using known methodology (see, e.g., PCT Publication Nos. WO 00/00823 and WO 00/39585).
- small molecule antagonists of the disclosure are usually less than about 2000 daltons in size, alternatively less than about 1500, 750, 500, 250 or 200 daltons in size, wherein such organic small molecules that are capable of binding, preferably specifically, to a polypeptide as described herein. These small molecule antagonists may be identified without undue experimentation using well-known techniques.
- Binding organic small molecules of the present disclosure may be, for example, aldehydes, ketones, oximes, hydrazones, semicarbazones, carbazides, primary amines, secondary amines, tertiary amines, N-substituted hydrazines, hydrazides, alcohols, ethers, thiols, thioethers, disulfides, carboxylic acids, esters, amides, ureas, carbamates, carbonates, ketals, thioketals, acetals, thioacetals, aryl halides, aryl sulfonates, alkyl halides, alkyl sulfonates, aromatic compounds, heterocyclic compounds, anilines, alkenes, alkynes, diols, amino alcohols, oxazolidines, oxazolines, thiazolidines, thiazolines, enamines, sulfonamide
- an ALK7:ActRIIB antagonist is a polynucleotide (ALK7:ActRIIB polynucleotide antagonist), or combination of polynucleotides.
- An ALK7:ActRIIB polynucleotide antagonist, or combination of polynucleotide antagonists may inhibit, for example, one or more ALK7:ActRIIB-binding ligands, type I receptors (e.g., ALK7), type II receptors (e.g., ActRIIB), co-receptor (e.g., Cripto or Cryptic), and/or downstream signaling component (e.g., Smads).
- ALK7:ActRIIB polynucleotide antagonist, or combination of polynucleotide antagonists inhibits signaling mediated by one or more ALK7:ActRIIB-binding ligands, for example, as determined in a cell-based assay such as those described herein.
- ALK7:ActRIIB polynucleotide antagonists may be used, alone or in combination with one or more supportive therapies or active agents, to treat a patient in need thereof (e.g., patients having kidney disease and/or a metabolic disorder).
- an ALK7:ActRIIB polynucleotide antagonists, or combination of polynucleotide antagonists inhibits at least GDF11.
- an ALK7:ActRIIB polynucleotide antagonists, or combination of polynucleotide antagonists inhibits at least GDF11.
- an ALK7:ActRIIB polynucleotide antagonists, or combination of polynucleotide antagonists inhibits at
- ALK7:ActRIIB polynucleotide antagonist, or combination of polynucleotide antagonists inhibits at least GDF8.
- an ALK7:ActRIIB polynucleotide antagonist, or combination of polynucleotide antagonists inhibits at least activin (activin A, activin B, activin C, activin E, activin AB, activin AC, activin AE, activin BC and/or activin BE).
- an ALK7:ActRIIB polynucleotide antagonist, or combination of polynucleotide antagonists inhibits at least GDF11, GDF8, and activin.
- an ALK7:ActRIIB polynucleotide antagonist, or combination of polynucleotide antagonists inhibits at least ALK7. In some embodiments, an ALK7:ActRIIB polynucleotide antagonist, or combination of polynucleotide antagonists, inhibits at least ActRIIB. In some embodiments, an ALK7:ActRIIB polynucleotide antagonist, or
- polynucleotide antagonists inhibits at least Crypto or Cryptic.
- polynucleotide antagonists inhibits at least ActRIIB.
- an ActRIIB In some embodiments, an
- ALK7:ActIIB polynucleotide antagonist, or combination of polynucleotide antagonists inhibits at least BMP6.
- an ALK7: ActRIIB polynucleotide antagonist, or combination of polynucleotide antagonists inhibits at least GDF3.
- an ALK7:ActRIIB polynucleotide antagonist, or combination of polynucleotide antagonists inhibits at least BMP10.
- polynucleotide antagonist inhibits at least nodal.
- an ALK7:ActRIIB polynucleotide antagonist, or combination of polynucleotide antagonists, as disclosed herein does not inhibit or does not substantially inhibit BMP9.
- the polynucleotide antagonists of the disclosure may be an antisense nucleic acid, an RNAi molecule [e.g., small interfering RNA (siRNA), small- hairpin RNA (shRNA), microRNA (miRNA)], an aptamer and/or a ribozyme.
- RNAi molecule e.g., small interfering RNA (siRNA), small- hairpin RNA (shRNA), microRNA (miRNA)
- siRNA small interfering RNA
- shRNA small- hairpin RNA
- miRNA microRNA
- BMP 10 are known in the art. In addition, many different methods of generating
- polynucleotide antagonists are well known in the art. Therefore polynucleotide antagonists for use in accordance with this disclosure may be routinely made by the skilled person in the art based on the knowledge in the art and teachings provided herein.
- Antisense technology can be used to control gene expression through antisense DNA or RNA, or through triple-helix formation.
- Antisense techniques are discussed, for example, in Okano (1991) J. Neurochem. 56:560; Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression, CRC Press, Boca Raton, Fla. (1988).
- Triple-helix formation is discussed in, for instance, Cooney et al. (1988) Science 241 :456; and Dervan et al., (1991) Science
- the methods are based on binding of a polynucleotide to a complementary DNA or RNA.
- the antisense nucleic acids comprise a single-stranded RNA or DNA sequence that is complementary to at least a portion of an RNA transcript of a gene disclosed herein.
- absolute complementarity although preferred, is not required.
- a sequence "complementary to at least a portion of an RNA,” referred to herein, means a sequence having sufficient complementarity to be able to hybridize with the RNA, forming a stable duplex; in the case of double-stranded antisense nucleic acids of a gene disclosed herein, a single strand of the duplex DNA may thus be tested, or triplex formation may be assayed.
- the ability to hybridize will depend on both the degree of complementarity and the length of the antisense nucleic acid. Generally, the larger the hybridizing nucleic acid, the more base mismatches with an RNA it may contain and still form a stable duplex (or triplex as the case may be).
- One skilled in the art can ascertain a tolerable degree of mismatch by use of standard procedures to determine the melting point of the hybridized complex.
- Polynucleotides that are complementary to the 5' end of the message should work most efficiently at inhibiting translation.
- sequences complementary to the 3'- untranslated sequences of mRNAs have been shown to be effective at inhibiting translation of mRNAs as well [see, e.g., Wagner, R., (1994) Nature 372:333-335].
- oligonucleotides complementary to either the 5'- or 3 '-non-translated, non-coding regions of a gene of the disclosure could be used in an antisense approach to inhibit translation of an endogenous mRNA.
- Antisense polynucleotides complementary to the 5'-untranslated region of the mRNA should include the complement of the AUG start codon.
- Antisense polynucleotides complementary to mRNA coding regions are less efficient inhibitors of translation but could be used in accordance with the methods of the present disclosure.
- antisense nucleic acids should be at least six nucleotides in length, and are preferably oligonucleotides ranging from 6 to about 50 nucleotides in length. In specific aspects the oligonucleotide is at least 10 nucleotides, at least 17 nucleotides, at least 25 nucleotides or at least 50 nucleotides.
- the antisense nucleic acid of the present disclosure is produced intracellularly by transcription from an exogenous sequence.
- a vector or a portion thereof is transcribed, producing an antisense nucleic acid (RNA) of a gene of the disclosure.
- RNA antisense nucleic acid
- Such a vector would contain a sequence encoding the desired antisense nucleic acid.
- Such a vector can remain episomal or become chromosomally integrated, as long as it can be transcribed to produce the desired antisense RNA.
- Such vectors can be constructed by recombinant DNA technology methods standard in the art. Vectors can be plasmid, viral, or others known in the art, used for replication and expression in vertebrate cells.
- Expression of the sequence encoding desired genes of the instant disclosure, or fragments thereof, can be by any promoter known in the art to act in vertebrate, preferably human cells.
- Such promoters can be inducible or constitutive.
- Such promoters include, but are not limited to, the SV40 early promoter region [see , e.g., Benoist and Chambon (1981) Nature 290:304-310], the promoter contained in the 3' long-terminal repeat of Rous sarcoma virus [see, e.g., Yamamoto et al. (1980) Cell 22:787-797], the herpes thymidine promoter [see, e.g., Wagner et al. (1981) Proc. Natl. Acad. Sci. U.S.A. 78: 1441-1445], and the regulatory sequences of the SV40 early promoter region [see , e.g., Benoist and Chambon (1981) Nature 290:304-310], the promoter contained
- the polynucleotide antagonists are interfering RNA (RNAi) molecules that target the expression of one or more of: GDF11, GDF8, activin (activin A, activin B, activin C, and activin E), BMP6, GDF3, BMP5, ALK7, ActRIIB, Cripto, Cryptic, nodal, and BMP 10.
- RNAi refers to the expression of an RNA which interferes with the expression of the targeted mRNA.
- RNAi silences a targeted gene via interacting with the specific mRNA through a siRNA (small interfering RNA).
- siRNA small interfering RNA
- the ds RNA complex is then targeted for degradation by the cell.
- An siRNA molecule is a double-stranded RNA duplex of 10 to 50 nucleotides in length, which interferes with the expression of a target gene which is sufficiently complementary ⁇ e.g. at least 80% identity to the gene).
- the siRNA molecule comprises a nucleotide sequence that is at least 85, 90, 95, 96, 97, 98, 99, or 100% identical to the nucleotide sequence of the target gene.
- RNAi molecules include short-hairpin RNA (shRNA); also short- interfering hairpin and microRNA (miRNA).
- shRNA short-hairpin RNA
- miRNA microRNA
- the shRNA molecule contains sense and antisense sequences from a target gene connected by a loop. The shRNA is transported from the nucleus into the cytoplasm, and it is degraded along with the mRNA.
- Pol III or U6 promoters can be used to express RNAs for RNAi.
- Paddison et al. [Genes & Dev. (2002) 16:948-958, 2002] have used small RNA molecules folded into hairpins as a means to affect RNAi. Accordingly, such short-hairpin RNA (shRNA) molecules are also advantageously used in the methods described herein.
- stem lengths can range anywhere from about 25 to about 30 nt, and loop size can range between 4 to about 25 nt without affecting silencing activity. While not wishing to be bound by any particular theory, it is believed that these shRNAs resemble the double- stranded RNA (dsRNA) products of the DICER RNase and, in any event, have the same capacity for inhibiting expression of a specific gene.
- the shRNA can be expressed from a lentiviral vector.
- An miRNA is a single-stranded RNA of about 10 to 70 nucleotides in length that are initially transcribed as pre-miRNA characterized by a "stem-loop" structure, which are subsequently processed into mature miRNA after further processing through the RISC.
- RNAi molecules that mediate RNAi, including without limitation siRNA
- chemical synthesis Hohjoh, FEBS Lett 521 : 195-199, 2002
- hydrolysis of dsRNA Yang et al, Proc Natl Acad Sci USA 99:9942-9947, 2002
- T7 RNA polymerase Trigger RNA polymerase
- hydrolysis of double-stranded RNA using a nuclease such as E. coli RNase III
- the disclosure provides polynucleotide antagonists including but not limited to, a decoy DNA, a double-stranded DNA, a single-stranded DNA, a complexed DNA, an encapsulated DNA, a viral DNA, a plasmid DNA, a naked RNA, an encapsulated RNA, a viral RNA, a double-stranded RNA, a molecule capable of generating RNA interference, or combinations thereof.
- a decoy DNA including but not limited to, a decoy DNA, a double-stranded DNA, a single-stranded DNA, a complexed DNA, an encapsulated DNA, a viral DNA, a plasmid DNA, a naked RNA, an encapsulated RNA, a viral RNA, a double-stranded RNA, a molecule capable of generating RNA interference, or combinations thereof.
- the polynucleotide antagonists of the disclosure are aptamers.
- Aptamers are nucleic acid molecules, including double-stranded DNA and single-stranded RNA molecules, which bind to and form tertiary structures that specifically bind to a target molecule.
- the generation and therapeutic use of aptamers are well established in the art (see, e.g., U.S. Pat. No. 5,475,096). Additional information on aptamers can be found in U.S.
- Nucleic acid aptamers are selected using methods known in the art, for example via the Systematic Evolution of Ligands by
- SELEX Exponential Enrichment
- Another screening method to identify aptamers is described in U.S. Pat. No. 5,270,163.
- the SELEX process is based on the capacity of nucleic acids for forming a variety of two- and three-dimensional structures, as well as the chemical versatility available within the nucleotide monomers to act as ligands (form specific binding pairs) with virtually any chemical compound, whether monomeric or polymeric, including other nucleic acid molecules and polypeptides. Molecules of any size or composition can serve as targets.
- the SELEX method involves selection from a mixture of candidate oligonucleotides and stepwise iterations of binding, partitioning and amplification, using the same general selection scheme, to achieve desired binding affinity and selectivity.
- the SELEX method includes steps of contacting the mixture with the target under conditions favorable for binding; partitioning unbound nucleic acids from those nucleic acids which have bound specifically to target molecules; dissociating the nucleic acid-target complexes; amplifying the nucleic acids dissociated from the nucleic acid-target complexes to yield a ligand enriched mixture of nucleic acids.
- the steps of binding, partitioning, dissociating and amplifying are repeated through as many cycles as desired to yield nucleic acid ligands which bind with high affinity and specificity to the target molecule.
- binding molecules are separately administered to the animal [see, e.g.,
- binding molecules can also be expressed in vivo from polynucleotides taken up by a host cell and expressed in vivo [see, e.g.,
- an ALK7: ActRIIB antagonist is a follistatin or FLRG polypeptide, which may be used alone or in combination with one or more additional supportive therapies and/or active agents as disclosed herein to achieve a desired effect (e.g., treat patients having kidney disease and/or a metabolic disorder).
- follistatin polypeptide includes polypeptides comprising any naturally occurring polypeptide of follistatin as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, and further includes any functional monomer or multimer of follistatin.
- follistatin polypeptide includes polypeptides comprising any naturally occurring polypeptide of follistatin as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, and further includes any functional monomer or multimer of follistatin.
- follistatin polypeptides of the disclosure bind to and/or inhibit activin and/or GDF8 activity.
- Variants of follistatin polypeptides that retain activin binding properties can be identified based on previous studies involving follistatin and activin interactions.
- WO2008/030367 discloses specific follistatin domains ("FSDs") that are shown to be important for activin binding.
- FSDs specific follistatin domains
- SEQ ID NOs: 90-94 the follistatin N- terminal domain
- FSD2 SEQ ID NO: 94
- FSDl SEQ ID NO: 93
- Follistatin polypeptides include polypeptides derived from the sequence of any known follistatin having a sequence at least about 80% identical to the sequence of a follistatin polypeptide, and optionally at least 85%, 90%, 95%, 96%), 97%), 98%), 99%) or greater identity.
- follistatin polypeptides include the mature follistatin polypeptide or shorter isoforms or other variants of the human follistatin precursor polypeptide (SEQ ID NO: 90) as described, for example, in WO2005/025601.
- the human follistatin precursor polypeptide isoform FST344 is as follows:
- the signal peptide is underlined; also underlined above are the last 27 residues which represent the C-terminal extension distinguishing this follistatin isoform from the shorter follistatin isoform FST317 shown below.
- the human follistatin precursor polypeptide isoform FST317 is as follows:
- the FSD1 and FSD2 sequences are as follows:
- ETCENVDCGPGKKCRMNKKNKPRCV (SEQ ID NO: 93; FSD1)
- KTCRDVFCPGSSTCVVDQTNNAYCVT (SEQ ID NO: 94; FSD2)
- an ALK7:ActRIIB antagonist is a folli statin-like related gene
- FLRG also known as follistatin-related protein 3 (FSTL3).
- FLRG polypeptide includes polypeptides comprising any naturally occurring polypeptide of FLRG as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity.
- FLRG polypeptides of the disclosure bind to and/or inhibit activin activity, particularly activin A.
- Variants of FLRG polypeptides that retain activin binding properties can be identified using routine methods to assay FLRG and activin interactions (see, e.g., US 6,537,966).
- FLRG polypeptides include polypeptides derived from the sequence of any known FLRG having a sequence at least about 80% identical to the sequence of an FLRG polypeptide, and optionally at least 85%, 90%, 95%, 97%, 99% or greater identity.
- the human FLRG precursor (follistatin-related protein 3 precursor) polypeptide is as follows:
- the signal peptide is underlined.
- follistatin polypeptides and FLRG polypeptides include fusion proteins having at least a portion of the follistatin polypeptide or FLRG polypeptide and one or more fusion domains, such as, for example, domains that facilitate isolation, detection, stabilization or multimerization of the polypeptide. Suitable fusion domains are discussed in detail above with reference to the ActRII polypeptides.
- an antagonist agent of the disclosure is a fusion protein comprising an activin-binding portion of a follistatin polypeptide fused to an Fc domain.
- an antagonist agent of the disclosure is a fusion protein comprising an activin binding portion of an FLRG polypeptide fused to an Fc domain.
- an ALK7:ActRIIB antagonist is a Lefty A or Lefty B polypeptide, which may be used alone or in combination with one or more additional supportive therapies and/or active agents as disclosed herein to achieve a desired effect (e.g., treat kidney disease and/or a metabolic condition or disorder).
- Lefty A polypeptide includes polypeptides comprising any naturally occurring polypeptide of Lefty A as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, and further includes any functional monomer or multimer of Lefty A.
- Lefty A polypeptides of the disclosure binds to and/or inhibit nodal activity.
- methods for making and testing libraries of polypeptides are described above in the context of ActRII and ALK7 polypeptides, and such methods also pertain to making and testing variants of Lefty A.
- Lefty A polypeptides include polypeptides derived from the sequence of any known Lefty A having a sequence at least about 80% identical to the sequence of a Lefty A polypeptide, and optionally at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or greater identity.
- Examples of Lefty A polypeptides include the mature Lefty A polypeptide or shorter isoforms or other variants of the human Lefty A precursor polypeptide (SEQ ID NO: 96).
- the human Lefty A precursor polypeptide is as follows:
- the signal peptide is underlined.
- the term "Lefty B polypeptide” includes polypeptides comprising any naturally occurring polypeptide of Lefty B as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, and further includes any functional monomer or multimer of Lefty B. In certain preferred embodiments, Lefty B polypeptides of the disclosure inhibit nodal activity.
- methods for making and testing libraries of polypeptides are described above in the context of ActRII and ALK7 polypeptides, and such methods also pertain to making and testing variants of Lefty B.
- Lefty B polypeptides include polypeptides derived from the sequence of any known Lefty B having a sequence at least about 80% identical to the sequence of a Lefty B polypeptide, and optionally at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or greater identity.
- Examples of Lefty B polypeptides include the mature Lefty B polypeptide or shorter isoforms or other variants of the human Lefty B precursor polypeptide (SEQ ID NO: 97).
- the human Lefty B precursor polypeptide is as follows:
- the signal peptide is underlined.
- functional variants or modified forms of the Lefty A polypeptides and Lefty B polypeptides include fusion proteins having at least a portion of the Lefty A polypeptide or Lefty polypeptide and one or more fusion domains, such as, for example, domains that facilitate isolation, detection, stabilization or multimerization of the polypeptide. Suitable fusion domains are discussed in detail above with reference to the ActRII and ALK7 polypeptides.
- an antagonist agent of the disclosure is a fusion protein comprising a nodal-binding portion of a Lefty A and/or Lefty B
- an ALK7:ActRIIB antagonist is a DAN-related protein (e.g., Cerberus and Coco), which may be used alone or in combination with one or more additional supportive therapies and/or active agents as disclosed herein to achieve a desired effect (e.g., treat patients having kidney disease and/or a metabolic disorder).
- a DAN-related protein e.g., Cerberus and Coco
- Cerberus polypeptide includes polypeptides comprising any naturally occurring polypeptide of Cerberus as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, and further includes any functional monomer or multimer of Cerberus.
- Cerberus polypeptides of the disclosure bind to and/or inhibit nodal activity.
- methods for making and testing libraries of polypeptides are described above in the context of ActRII and ALK7 polypeptides, and such methods also pertain to making and testing variants of Cerberus.
- Cerberus polypeptides include polypeptides derived from the sequence of any known Cerberus having a sequence at least about 80% identical to the sequence of a Cerberus polypeptide, and optionally at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or greater identity.
- Examples of Cerberus polypeptides include the mature Cerberus polypeptide or shorter isoforms or other variants of the human Cerberus precursor polypeptide (SEQ ID NO: 98).
- the human Cerberus precursor polypeptide is as follows:
- the signal peptide is underlined.
- Coco polypeptide includes polypeptides comprising any naturally occurring polypeptide of Coco as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, and further includes any functional monomer or multimer of Coco.
- Cocoa is a polypeptide that is substantially identical to Coco.
- Coco polypeptides of the disclosure bind to and/or inhibit nodal activity.
- methods for making and testing libraries of polypeptides are described above in the context of ActRII and ALK7 polypeptides, and such methods also pertain to making and testing variants of Coco.
- Coco polypeptides include polypeptides derived from the sequence of any known Coco having a sequence at least about 80% identical to the sequence of a Coco polypeptide, and optionally at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or greater identity.
- Examples of Coco polypeptides include the mature Coco polypeptide or shorter isoforms or other variants of the human Coco precursor polypeptide (SEQ ID NO: 99).
- the human Coco precursor polypeptide is as follows:
- the signal peptide is underlined.
- functional variants or modified forms of the Cerberus polypeptides and Coco polypeptides include fusion proteins having at least a portion of the Cerberus polypeptide and/or Coco polypeptide and one or more fusion domains, such as, for example, domains that facilitate isolation, detection, stabilization or multimerization of the polypeptide. Suitable fusion domains are discussed in detail above with reference to the ActRII and ALK7 polypeptides.
- an antagonist agent of the disclosure is a fusion protein comprising a nodal-binding portion of a Cerberus and/or Coco polypeptide fused to an Fc domain.
- ALK7:ActRIIB receptor heteromultimers e.g.,
- ALK7:ActRIIB heterodimers may be used to generate and/or screen for ALK7:ActRIIB inhibitors, particularly inhibitors that interfere with ALK7-ligand and/or ALK7-Type II receptor (e.g., ActRIIB) interaction (e.g., anti-ALK7 antibodies).
- ALK7:ActRIIB inhibitors particularly inhibitors that interfere with ALK7-ligand and/or ALK7-Type II receptor (e.g., ActRIIB) interaction (e.g., anti-ALK7 antibodies).
- TGF-beta superfamily ligand signals are mediated by complexes of Type I and Type II kinase receptors, which phosphorylate and activate downstream Smad proteins upon ligand stimulation [see, e.g., Massague (2000) Nat. Rev. Mol. Cell. Biol. 1 : 169-178].
- Type I receptors While essential for signaling, Type I receptors generally have very weak affinity for TGF-beta superfamily ligands. Instead, Type II receptors generally bind to ligands with high affinity. This ligand binding promotes stable complex formation between Type I and II receptors, resulting in phosphorylation of type I receptors by Type II receptors and thus activation of Smad proteins.
- ALK7:ActRIIB heteromultimers are a useful tool for identifying ALK7 inhibitors using various screening assays such as described herein as well as those known in the art. Therefore, in some embodiments, the present disclosure relate to the use of ALK7:Type II receptor
- heteromultimers e.g., ALK7:ActRIIB heteromultimers
- identify (screen for) ALK7 inhibitors e.g., ALK7:ActRIIB heteromultimers
- ALK7:Type II receptor heteromultimers may be particular useful for generating/identifying antibodies that bind to ALK7, particularly antibodies that bind to and inhibit ALK7.
- ALK7 polypeptides including ALK7 homodimers as described herein, may be used to generate/identify antibodies that bind to ALK7, simple binding is not sufficient to demonstrate that a given ALK7 antibody can inhibit an ALK7 activity (e.g., interfere with ALK7-ligand or ALK7- Type II receptor interactions).
- ALK7 polypeptides do not display ligand-binding activity in the absence of a Type II receptor, making it difficult to identify antibodies that can inhibit ALK7.
- ALK7:Type II receptor heteromultimers e.g.,
- ALK7:ActRIIB heteromultimers solve this problem by providing a functional read out for ALK7 activity.
- association with a Type II receptor e.g., ActRIIB
- association with a Type II receptor may help to stabilize ALK7 in such a way as to optimize the processing and presentation of important ALK7 epitopes that mediate ligand-binding activities and thus improve the development of ALK7 inhibitory antibodies. Therefore, in some embodiments, the present disclosure relates to the use of ALK7:Type II heteromultimers (e.g.,
- ALK7: ActRIIB heteromultimers to generate antibodies that bind to and inhibit ALK7.
- Methods for generating and screening for antibodies are well known in the art and described herein, and ALK7-Type II heteromultimers (e.g., ALK7:ActRIIB heteromultimers) may be used in accordance with one or more of these methods to generate/identify antibodies that bind to and inhibit ALK7 activity.
- ALK7:Type II receptor heterodimers e.g., ALK7:ActRIIB heteromultimers such as heterodimers
- ALK7:ActRIIB heteromultimers such as heterodimers
- the data presented herein demonstrates that ALK7:ActRIIB
- heterodimers bind to activin C. Insight into this novel interaction provides an opportunity to develop/identify activin C inhibitors. In addition, given the structural similarity between activin C and activin E, it is expected that activin E also binds to ALK7:ActRIIB, and thus this novel interaction may be used to identify activin E antagonists as well. Heterodimeric ligands, such as activin AC, AE, BC and BE are also included in the reference to activin C or E, respectively in this section of the disclosure. Agents that affect both activin C and E are also contemplated.
- activin C or E antagonists are expected to be useful in accordance with the methods described herein including, for example, small molecules, antibodies, and inhibitor nucleic acids, particularly those that disrupt activin C (or E)- ALK7:ActRIIB interaction.
- An agent e.g., an antibody or small molecule
- An agent that is specifically reactive with activin C or E and which either binds to activin C or E so as to compete with its binding to ALK7 and/or ActRIIB or otherwise inhibits activin C or E- mediated signaling may be used as an antagonist of activin C or E.
- an agent that is specifically reactive with ALK7 and/or ActRIIB and which disrupts activin C or E binding may be used as an antagonist.
- immunogens can be derived from an activin C or E polypeptide, ALK7 polypeptide, or ActRIIB polypeptide and used to generate antibodies using standard methods known in the art. See, e.g., Antibodies: A Laboratory Maneal ed. by Harlow and Lane, Cold Spring Harbor Press, 1988. Using various screening assays known in the art such as those described herein, ALK7:Type II receptor heterodimers (e.g., ALK7:ActRIIB heteromultimers such as heterodimers) may be used to identify activin C or E inhibitors.
- ALK7:Type II receptor heterodimers e.g., ALK7:ActRIIB heteromultimers such as heterodimers
- the present disclosure relates to the use of ALK7:ActRIIB heteromultimer complexes to identify compounds (agents) which are agonists or antagonists of TGFp superfamily receptors.
- Compounds identified through this screening can be tested to assess their ability to modulate tissue growth, such as bone, cartilage, muscle, fat, and/or neurons, growth in vivo or in vitro. These compounds can be tested, for example, in animal models.
- tissue growth such as bone, cartilage, muscle, fat, and/or neurons
- TGFP superfamily ligand signaling e.g., SMAD signaling
- high-throughput screening of compounds can be carried out to identify agents that perturb TGFp superfamily receptor-mediated effects on a selected cell line.
- the assay is carried out to screen and identify compounds that specifically inhibit or reduce binding of an ALK7: ActRIIB heteromultimer to a binding partner (e.g., activin, GDF11, GDF8, BMP6, GDF3, BMP5, nodal, and BMP10).
- a binding partner e.g., activin, GDF11, GDF8, BMP6, GDF3, BMP5, nodal, and BMP10.
- the assay can be used to identify compounds that enhance binding of an ALK7: ActRIIB heteromultimer to a ligand.
- the compounds can be identified by their ability to interact with an ALK7: ActRIIB heteromultimer.
- the present disclosure relates to the use of an ALK7:ActRIIB heteromultimer and activin C or E polypeptides to identify compounds which are agonists or antagonists of the activin C (or E)-ALK7: ActRIIB signaling pathway.
- Compounds identified through this screening assay can be tested to assess their ability to modulate activin C or E signaling activity in vitro.
- these compounds can further be tested in animal models to assess their ability to modulate tissue growth in vivo.
- high-throughput screening of compounds can be carried out to identify agents that perturb activin C or E or ALK7:ActRIIB-mediated cell signaling.
- the assay is carried out to screen and identify compounds that specifically inhibit or reduce binding of an
- ALK7: ActRIIB heteromultimer to activin C or E can be used to identify compounds that enhance binding of an ALK7:ActRIIB heteromultimer to activin C or E.
- the compounds can be identified by their ability to interact with activin C or E or an ALK7: ActRIIB heteromultimer.
- test compounds (agents) of the invention may be created by any combinatorial chemical method.
- the subject compounds may be naturally occurring biomolecules synthesized in vivo or in vitro.
- Compounds (agents) to be tested for their ability to act as modulators of tissue growth can be produced, for example, by bacteria, yeast, plants or other organisms (e.g., natural products), produced chemically (e.g., small molecules, including peptidomimetics), or produced recombinantly.
- Test compounds contemplated by the present invention include non-peptidyl organic molecules, peptides, polypeptides, peptidomimetics, sugars, hormones, and nucleic acid molecules.
- the test agent is a small organic molecule having a molecular weight of less than about 2,000 Daltons.
- the test compounds of the disclosure can be provided as single, discrete entities, or provided in libraries of greater complexity, such as made by combinatorial chemistry. These libraries can comprise, for example, alcohols, alkyl halides, amines, amides, esters, aldehydes, ethers and other classes of organic compounds. Presentation of test compounds to the test system can be in either an isolated form or as mixtures of compounds, especially in initial screening steps.
- the compounds may be optionally derivatized with other compounds and have derivatizing groups that facilitate isolation of the compounds.
- derivatizing groups include biotin, fluorescein, digoxygenin, green fluorescent protein, isotopes, polyhistidine, magnetic beads, glutathione S-transferase (GST), photoactivatible crosslinkers or any combinations thereof.
- GST glutathione S-transferase
- Assays which are performed in cell-free systems such as may be derived with purified or semi-purified proteins, are often preferred as "primary" screens in that they can be generated to permit rapid development and relatively easy detection of an alteration in a molecular target which is mediated by a test compound.
- test compound can be generally ignored in the in vitro system, the assay instead being focused primarily on the effect of the drug on the molecular target as may be manifest in an alteration of binding affinity between an ALK7: ActRIIB heteromultimer complex and a binding partner ⁇ e.g., activin C or E).
- the compound of interest is contacted with an isolated and purified ALK7: ActRIIB
- ALK7: ActRIIB heteromultimer-activin C or E complexes provides a means for determining the compound's efficacy at inhibiting (or potentiating) complex formation between the ALK7: ActRIIB heteromultimer and activin C or E.
- the efficacy of the compound can be assessed by generating dose-response curves from data obtained using various concentrations of the test compound.
- a control assay can also be performed to provide a baseline for comparison. For example, in a control assay, isolated and purified activin C or E is added to a composition containing the ALK7: ActRIIB
- ALK7 ActRIIB heteromultimer complex to another protein (e.g., activin
- C or E may be detected by a variety of techniques. For instance, modulation of the formation of complexes can be quantitated using, for example, detectably labeled proteins
- radiolabeled e.g., P, S, C or H
- fluorescently labeled e.g., FITC
- enzymatically labeled ALK7:ActRIIB heteromeric complex and/or a binding partner e.g., activin C or E
- a binding partner e.g., activin C or E
- the present disclosure contemplates the use of fluorescence polarization assays and fluorescence resonance energy transfer (FRET) assays in measuring, either directly or indirectly, the degree of interaction between an ALK7: ActRIIB
- heteromultimer and a binding protein e.g., activin C or E
- a binding protein e.g., activin C or E
- other modes of detection such as those based on optical waveguides (PCT Publication WO 96/26432 and U.S. Pat. No. 5,677,196), surface plasmon resonance (SPR), surface charge sensors, and surface force sensors, are compatible with many embodiments of the disclosure.
- an interaction trap assay also known as the "two-hybrid assay” for identifying agents that disrupt or potentiate interaction between an ALK7:ActRIIB heteromultimer and a binding partner (e.g., activin C or E).
- a binding partner e.g., activin C or E.
- the present disclosure contemplates the use of reverse two-hybrid systems to identify compounds (e.g., small molecules or peptides) that dissociate interactions between an ALK7:ActRIIB heteromultimer and a binding protein (e.g., activin C or E) [Vidal and Legrain, (1999) Nucleic Acids Res 27:919-29; Vidal and Legrain, (1999) Trends Biotechnol 17:374-81; and U.S. Pat. Nos. 5,525,490; 5,955,280; and 5,965,368].
- a binding protein e.g., activin C or E
- the subject compounds are identified by their ability to interact with an ALK7: ActRIIB heteromultimer or activin C or E of the disclosure.
- the interaction between the compound and an ALK7: ActRIIB heteromultimer or activin C or E may be covalent or non-covalent.
- such interaction can be identified at the protein level using in vitro biochemical methods, including photo-crosslinking, radiolabeled ligand binding, and affinity chromatography [Jakoby WB et al. (1974) Methods in
- the compounds may be screened in a mechanism-based assay, such as an assay to detect compounds which bind to an ALK7:ActRIIB heteromultimer or activin C or E. This may include a solid-phase or fluid-phase binding event.
- the gene encoding an ALK7: ActRIIB heteromultimer or activin C or E can be transfected with a reporter system (e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein) into a cell and screened against the library preferably by high-throughput screening or with individual members of the library.
- a reporter system e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein
- Other mechanism -based binding assays may be used; for example, binding assays which detect changes in free energy. Binding assays can be performed with the target fixed to a well, bead or chip or captured by an immobilized antibody or resolved by capillary electrophoresis. The bound compounds may be detected usually using colorimetric endpoints or fluorescence or surface plasmon resonance.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Diabetes (AREA)
- Wood Science & Technology (AREA)
- Hematology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Engineering & Computer Science (AREA)
- Physical Education & Sports Medicine (AREA)
- Obesity (AREA)
- Cell Biology (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Biomedical Technology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Urology & Nephrology (AREA)
- Rheumatology (AREA)
- Heart & Thoracic Surgery (AREA)
- Cardiology (AREA)
- Epidemiology (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP20206064.6A EP3828199B1 (en) | 2015-04-06 | 2016-04-06 | Alk7: actriib heteromultimers and uses thereof |
| DK16777229.2T DK3280728T3 (da) | 2015-04-06 | 2016-04-06 | Alk7:actriib-heteromultimerer og anvendelser deraf |
| AU2016246708A AU2016246708B2 (en) | 2015-04-06 | 2016-04-06 | ALK7:actRIIB heteromultimers and uses thereof |
| CA2981833A CA2981833A1 (en) | 2015-04-06 | 2016-04-06 | Alk7:actriib heteromultimers and uses thereof |
| EP16777229.2A EP3280728B1 (en) | 2015-04-06 | 2016-04-06 | Alk7:actriib heteromultimers and uses thereof |
| CN202210568634.1A CN115073610A (zh) | 2015-04-06 | 2016-04-06 | Alk7:actriib异多聚体和其用途 |
| HK18108639.0A HK1248735B (en) | 2015-04-06 | 2016-04-06 | Alk7:actriib heteromultimers and uses thereof |
| ES16777229T ES2863564T3 (es) | 2015-04-06 | 2016-04-06 | Heteromultímeros ALK7:ActRIIB y usos de los mismos |
| HK18109788.7A HK1250373A1 (zh) | 2015-04-06 | 2016-04-06 | Alk7:actriib异多聚体和其用途 |
| KR1020177031991A KR20180002661A (ko) | 2015-04-06 | 2016-04-06 | ALK7:ActRIIB 이형다합체와 이의 용도 |
| CN201680033093.5A CN107709358A (zh) | 2015-04-06 | 2016-04-06 | Alk7:actriib异多聚体和其用途 |
| JP2017552155A JP7055636B2 (ja) | 2015-04-06 | 2016-04-06 | ALK7:ActRIIBヘテロ多量体およびその使用 |
| AU2020281136A AU2020281136A1 (en) | 2015-04-06 | 2020-12-04 | ALK7:ActRIIB heteromultimers and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562143579P | 2015-04-06 | 2015-04-06 | |
| US62/143,579 | 2015-04-06 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016164503A1 true WO2016164503A1 (en) | 2016-10-13 |
Family
ID=57072866
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/026277 Ceased WO2016164503A1 (en) | 2015-04-06 | 2016-04-06 | Alk7:actriib heteromultimers and uses thereof |
| PCT/US2016/000033 Ceased WO2016164089A2 (en) | 2015-04-06 | 2016-04-06 | Tgf-beta superfamily type i and type ii receptor heteromultimers and uses thereof |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/000033 Ceased WO2016164089A2 (en) | 2015-04-06 | 2016-04-06 | Tgf-beta superfamily type i and type ii receptor heteromultimers and uses thereof |
Country Status (15)
| Country | Link |
|---|---|
| US (7) | US10227392B2 (cg-RX-API-DMAC7.html) |
| EP (5) | EP3889171B1 (cg-RX-API-DMAC7.html) |
| JP (3) | JP7055636B2 (cg-RX-API-DMAC7.html) |
| KR (2) | KR20180002661A (cg-RX-API-DMAC7.html) |
| CN (4) | CN107847561B (cg-RX-API-DMAC7.html) |
| AU (4) | AU2016246708B2 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112017021510A2 (cg-RX-API-DMAC7.html) |
| CA (2) | CA2981833A1 (cg-RX-API-DMAC7.html) |
| DK (1) | DK3280728T3 (cg-RX-API-DMAC7.html) |
| EA (2) | EA202190016A1 (cg-RX-API-DMAC7.html) |
| ES (2) | ES2863564T3 (cg-RX-API-DMAC7.html) |
| HK (2) | HK1252957A1 (cg-RX-API-DMAC7.html) |
| MA (4) | MA41920B1 (cg-RX-API-DMAC7.html) |
| MX (1) | MX391964B (cg-RX-API-DMAC7.html) |
| WO (2) | WO2016164503A1 (cg-RX-API-DMAC7.html) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017177013A1 (en) * | 2016-04-06 | 2017-10-12 | Acceleron Pharma Inc. | Alk7 antagonists and uses thereof |
| US10588980B2 (en) | 2014-06-23 | 2020-03-17 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
| WO2021183819A1 (en) * | 2020-03-13 | 2021-09-16 | Acceleron Pharma Inc. | Single-arm actriia and actriib heteromultimers and methods for treating renal diseases or conditions |
| JP2022084709A (ja) * | 2016-10-05 | 2022-06-07 | アクセレロン ファーマ インコーポレーテッド | 腎臓疾患を治療するための組成物および方法 |
Families Citing this family (41)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| HK1225740A1 (zh) | 2013-08-22 | 2017-09-15 | Acceleron Pharma Inc. | TGF-β受体II型变体及其用途 |
| MA41919A (fr) | 2015-04-06 | 2018-02-13 | Acceleron Pharma Inc | Hétéromultimères alk4:actriib et leurs utilisations |
| MA41920B1 (fr) | 2015-04-06 | 2021-05-31 | Acceleron Pharma Inc | Protéines de fusion de récepteur type i et type ii à bras unique et leurs utilisations |
| US10358476B2 (en) | 2015-04-06 | 2019-07-23 | Acceleron Pharma Inc. | Single arm type I and type II receptor fusion proteins and uses thereof |
| CA2983440C (en) | 2015-04-22 | 2024-03-12 | Alivegen Usa Inc. | Novel hybrid actriib ligand trap proteins for treating muscle wasting diseases |
| CN108348578B (zh) | 2015-08-04 | 2022-08-09 | 阿塞勒隆制药公司 | 用于治疗骨髓增生性病症的方法 |
| CN105254764A (zh) * | 2015-08-27 | 2016-01-20 | 上海康岱生物医药技术有限公司 | ACVR1-Fc融合蛋白及其制法和用途 |
| DK3496739T3 (da) | 2016-07-15 | 2021-05-10 | Acceleron Pharma Inc | Sammensætninger omfattende actriia-polypeptider til brug i behandlingen af pulmonal hypertension |
| AU2017338915B2 (en) * | 2016-10-05 | 2024-11-21 | Acceleron Pharma Inc. | TGF-beta superfamily type I and type II receptor heteromultimers and uses thereof |
| CA3039573A1 (en) | 2016-10-05 | 2018-04-12 | Acceleron Pharma Inc. | Alk4:actriib heteromultimers and uses thereof |
| CN110036025B (zh) | 2016-10-05 | 2024-03-22 | 阿塞勒隆制药公司 | 变体ActRIIB蛋白及其用途 |
| JOP20190085A1 (ar) | 2016-10-20 | 2019-04-17 | Biogen Ma Inc | طرق علاج الضمور العضلي ومرض العظام باستخدام بروتينات احتجاز مركب ترابطي actriib هجين حديثة |
| NZ754161A (en) | 2016-11-10 | 2025-11-28 | Keros Therapeutics Inc | Activin receptor type iia variants and methods of use thereof |
| MA46862A (fr) | 2016-11-17 | 2019-09-25 | Bluebird Bio Inc | Convertisseur de signaux tgf béta |
| EP3576773B1 (en) * | 2017-02-01 | 2023-10-18 | Acceleron Pharma Inc. | Tgf beta and actrii antagonists for use in treating leukemia |
| ES2948647T3 (es) | 2017-05-04 | 2023-09-15 | Acceleron Pharma Inc | Proteínas de fusión del receptor TGF-beta tipo II y usos de las mismas |
| EP3424957A1 (en) * | 2017-07-03 | 2019-01-09 | advanceCOR GmbH | Fusion protein |
| AU2018358804A1 (en) * | 2017-11-02 | 2020-04-09 | Bayer Aktiengesellschaft | Bispecific antibodies binding ALK-1 and BMPR-2 |
| IL320014A (en) | 2018-01-12 | 2025-06-01 | Keros Therapeutics Inc | Activin receptor type iib variants and methods of use thereof |
| JP7654402B2 (ja) * | 2018-02-09 | 2025-04-01 | アクセルロン ファーマ インコーポレイテッド | 異所性骨化を処置するための方法 |
| MX2020009272A (es) * | 2018-03-06 | 2021-01-08 | Univ Pennsylvania | Receptores de antígeno quimérico del antígeno de membrana específico de próstata y métodos de uso de los mismos. |
| US12168683B2 (en) | 2018-05-03 | 2024-12-17 | Acceleron Pharma Inc. | Binders of TGFβ-superfamily ligands and uses thereof |
| US12103959B2 (en) | 2018-05-03 | 2024-10-01 | Acceleron Pharma Inc. | Multispecific binders of TGFBeta-superfamily ligands and uses thereof |
| KR20250133994A (ko) * | 2018-05-09 | 2025-09-09 | 케로스 테라퓨틱스, 인크. | 액티빈 수용체 유형 iia 변이체 및 그의 사용 방법 |
| WO2019226658A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Multispecific antigen-binding compositions and methods of use |
| CA3099308A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Compositions and methods for enhancing the killing of target cells by nk cells |
| CA3103427A1 (en) * | 2018-06-15 | 2019-12-19 | Acceleron Pharma Inc. | Bi-and tri-functional fusion proteins and uses thereof |
| CA3139011A1 (en) | 2019-05-08 | 2020-11-12 | Medigene Immunotherapies Gmbh | Engineered t cells |
| US20220362333A1 (en) * | 2019-07-26 | 2022-11-17 | Board Of Trustees Of Michigan State University | Methods Of Preventing Or Treating Fatty Degeneration Of Skeletal Muscle |
| CN112625137B (zh) * | 2019-10-08 | 2021-10-08 | 北京东方百泰生物科技股份有限公司 | 一种人白细胞介素10-Fc融合蛋白及其医药用途 |
| MX2022009553A (es) * | 2020-02-03 | 2022-11-07 | Acceleron Pharma Inc | Proteínas actriib variantes y sus usos. |
| WO2021189010A1 (en) | 2020-03-20 | 2021-09-23 | Keros Therapeutics, Inc. | Methods of using activin receptor type iib variants |
| WO2021189019A1 (en) * | 2020-03-20 | 2021-09-23 | Keros Therapeutics, Inc. | Activin receptor type ii chimeras and methods of use thereof |
| US20230174620A1 (en) | 2020-04-28 | 2023-06-08 | Acceleron Pharma Inc. | Actrii proteins and use in treating post-capillary pulmonary hypertension |
| KR102587871B1 (ko) * | 2020-06-19 | 2023-10-12 | 숙명여자대학교산학협력단 | Bmpr2 유전자 기능획득 돌연변이체를 포함하는 돌연변이 복합체 및 이의 용도 |
| CA3196443A1 (en) * | 2020-11-04 | 2022-05-12 | Hq Han | Novel bifunctional multispecific antagonists capable of inhibiting multiple ligands of tgf-beta family and uses thereof |
| WO2022192411A1 (en) * | 2021-03-10 | 2022-09-15 | Acceleron Pharma Inc. | Actrii-alk4 antagonists and methods of treating heart failure |
| JP2024511315A (ja) * | 2021-03-10 | 2024-03-13 | アクセルロン ファーマ インコーポレイテッド | Actrii-alk4アンタゴニスト及び心不全の治療方法 |
| EP4673472A1 (en) * | 2023-03-01 | 2026-01-07 | The Regents of University of California | Use of bmp receptor alk1 inhibitors in osteoarthritis therapies |
| WO2025034616A1 (en) * | 2023-08-04 | 2025-02-13 | Lask Pharma, Inc. | Soluble bone morphogenetic protein (bmp) receptor type-1b proteins and uses thereof |
| WO2025137384A1 (en) * | 2023-12-20 | 2025-06-26 | Arrowhead Pharmaceuticals, Inc. | Methods and reagents for improved oligonucleotide synthesis |
Citations (75)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1984001106A1 (en) | 1982-09-24 | 1984-03-29 | Us Health | Repair of tissue in animals |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| US5096815A (en) | 1989-01-06 | 1992-03-17 | Protein Engineering Corporation | Generation and selection of novel dna-binding proteins and polypeptides |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| WO1993011162A1 (en) | 1991-11-29 | 1993-06-10 | Protein Design Labs, Inc. | Bispecific antibody heterodimers |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5270163A (en) | 1990-06-11 | 1993-12-14 | University Research Corporation | Methods for identifying nucleic acid ligands |
| US5283317A (en) | 1987-08-03 | 1994-02-01 | Ddi Pharmaceuticals, Inc. | Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols |
| US5475096A (en) | 1990-06-11 | 1995-12-12 | University Research Corporation | Nucleic acid ligands |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5525490A (en) | 1994-03-29 | 1996-06-11 | Onyx Pharmaceuticals, Inc. | Reverse two-hybrid method |
| WO1996026432A1 (en) | 1995-02-23 | 1996-08-29 | University Of Utah Research Foundation | Composite waveguide for solid phase binding assays |
| US5567588A (en) | 1990-06-11 | 1996-10-22 | University Research Corporation | Systematic evolution of ligands by exponential enrichment: Solution SELEX |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5580737A (en) | 1990-06-11 | 1996-12-03 | Nexstar Pharmaceuticals, Inc. | High-affinity nucleic acid ligands that discriminate between theophylline and caffeine |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| US5677196A (en) | 1993-05-18 | 1997-10-14 | University Of Utah Research Foundation | Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays |
| US5707796A (en) | 1990-06-11 | 1998-01-13 | Nexstar Pharmaceuticals, Inc. | Method for selecting nucleic acids on the basis of structure |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5763177A (en) | 1990-06-11 | 1998-06-09 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: photoselection of nucleic acid ligands and solution selex |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5955280A (en) | 1995-04-11 | 1999-09-21 | The General Hospital Corporation | Reverse two-hybrid system |
| US6011577A (en) | 1997-06-30 | 2000-01-04 | Polaroid Corporation | Modular optical print head assembly |
| WO2000000823A1 (en) | 1998-06-26 | 2000-01-06 | Sunesis Pharmaceuticals, Inc. | Methods for rapidly identifying small organic ligands |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO2000039585A1 (en) | 1998-12-28 | 2000-07-06 | Sunesis Pharmaceuticals, Inc. | Identifying small organic molecule ligands for binding |
| WO2000043781A2 (en) | 1999-01-21 | 2000-07-27 | Metamorphix, Inc. | Growth differentiation factor inhibitors and uses therefor |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| US6537966B1 (en) | 1997-08-29 | 2003-03-25 | Human Genome Sciences, Inc. | Follistatin-3 |
| US6699843B2 (en) | 1995-06-07 | 2004-03-02 | Gilead Sciences, Inc. | Method for treatment of tumors using nucleic acid ligands to PDGF |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2005025601A1 (en) | 2003-09-15 | 2005-03-24 | Monash University | Follistatin isoforms and uses thereof |
| US20050079574A1 (en) | 2003-01-16 | 2005-04-14 | Genentech, Inc. | Synthetic antibody phage libraries |
| US20050119455A1 (en) | 2002-06-03 | 2005-06-02 | Genentech, Inc. | Synthetic antibody phage libraries |
| US20050186593A1 (en) * | 1991-05-10 | 2005-08-25 | The Salk Institute For Biological Studies | Cloning and recombinant production of CRF receptor(s) |
| WO2005084699A1 (en) * | 2004-03-02 | 2005-09-15 | Acceleron Pharma Inc. | Alk7 and myostatin inhibitors and uses thereof |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| US20050266000A1 (en) | 2004-04-09 | 2005-12-01 | Genentech, Inc. | Variable domain library and uses |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| WO2006012627A2 (en) | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| US20060025576A1 (en) | 2000-04-11 | 2006-02-02 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US7041870B2 (en) | 2000-11-30 | 2006-05-09 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| US20060148748A1 (en) | 1999-07-29 | 2006-07-06 | Gilead Sciences, Inc. | Nucleic acid ligands which bind to hepatocyte growth factor/scatter factor (HGF/SF) or its receptor c-met |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| US7183076B2 (en) | 1997-05-02 | 2007-02-27 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| US7189826B2 (en) | 1997-11-24 | 2007-03-13 | Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
| US20070061900A1 (en) | 2000-10-31 | 2007-03-15 | Murphy Andrew J | Methods of modifying eukaryotic cells |
| US20070117126A1 (en) | 1999-12-15 | 2007-05-24 | Genentech, Inc. | Shotgun scanning |
| US20070160598A1 (en) | 2005-11-07 | 2007-07-12 | Dennis Mark S | Binding polypeptides with diversified and consensus vh/vl hypervariable sequences |
| US20070237764A1 (en) | 2005-12-02 | 2007-10-11 | Genentech, Inc. | Binding polypeptides with restricted diversity sequences |
| US20070292936A1 (en) | 2006-05-09 | 2007-12-20 | Genentech, Inc. | Binding polypeptides with optimized scaffolds |
| WO2007147901A1 (en) | 2006-06-22 | 2007-12-27 | Novo Nordisk A/S | Production of bispecific antibodies |
| WO2008030367A2 (en) | 2006-09-01 | 2008-03-13 | The General Hospital Corporation | Selective myostatin inhibitors |
| WO2008097541A2 (en) | 2007-02-02 | 2008-08-14 | Acceleron Pharma Inc. | Variants derived from actriib and uses therefor |
| US20090002360A1 (en) | 2007-05-25 | 2009-01-01 | Innolux Display Corp. | Liquid crystal display device and method for driving same |
| US20090010879A1 (en) | 1998-09-25 | 2009-01-08 | Neil Stahl | Receptor Based Antagonists and Methods of Making and Using |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| US7612041B2 (en) | 2005-11-23 | 2009-11-03 | Acceleron Pharma Inc. | Isolated activin-binding ActRIIa polypeptide comprising the SEQ ID NO: 7 and uses for promoting bone growth |
| WO2010151426A1 (en) | 2009-06-12 | 2010-12-29 | Acceleron Pharma Inc. | Truncated actriib-fc fusion proteins |
| WO2011034605A2 (en) | 2009-09-16 | 2011-03-24 | Genentech, Inc. | Coiled coil and/or tether containing protein complexes and uses thereof |
| US20110236309A1 (en) | 2008-03-19 | 2011-09-29 | National Research Council Of Canada | Antagonists of ligands and uses thereof |
| WO2012027065A2 (en) * | 2010-08-27 | 2012-03-01 | Celgene Corporation | Combination therapy for treatment of disease |
| WO2013063536A1 (en) * | 2011-10-27 | 2013-05-02 | Acceleron Pharma, Inc. | Actriib binding agents and uses thereof |
Family Cites Families (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5955A (en) | 1848-12-05 | Plate for boiler-holes in cooking-stoves | ||
| CA2149441C (en) | 1992-11-17 | 2004-03-02 | Kohei Miyazono | Activin receptor-like kinases, proteins having serine threonine kinase domains and their use |
| US7592428B1 (en) | 1992-11-17 | 2009-09-22 | Ludwig Institute For Cancer Research | Antibodies which bind specifically to activin receptor like kinases |
| US5614609A (en) | 1994-10-20 | 1997-03-25 | Carlos F. Ibanez | Serine threonine kinase receptor |
| JPH10303327A (ja) | 1997-04-23 | 1998-11-13 | Yamaichi Electron Co Ltd | 半導体チップの接点変換構造と該接点変換構造を有する半導体チップの製造法 |
| US20040223966A1 (en) | 2002-10-25 | 2004-11-11 | Wolfman Neil M. | ActRIIB fusion polypeptides and uses therefor |
| DK1670511T3 (da) | 2003-09-15 | 2009-11-23 | Res Dev Foundation | Cripto-antagonisme af activin- og TGF-B-signalering |
| SI1973559T1 (sl) * | 2005-11-23 | 2013-05-31 | Acceleron Pharma, Inc. | Aktivin-aktriia antagonisti in uporaba za pospeĺ evanje kostne rasti |
| EP2024386A2 (en) * | 2006-06-02 | 2009-02-18 | Wyeth | Use of proteins and peptides of the tgf-beta superfamily for purification and therapeutic methods |
| CN111518218A (zh) * | 2006-11-02 | 2020-08-11 | 阿塞勒隆制药公司 | Alk1受体和配体拮抗剂及其用途 |
| CA2671983A1 (en) | 2006-12-08 | 2009-06-19 | Acceleron Pharma Inc. | Uses of cerberus, coco and derivatives thereof |
| CN104524548A (zh) * | 2006-12-18 | 2015-04-22 | 阿塞勒隆制药公司 | 活化素-actrii拮抗剂及在提高红细胞水平中的用途 |
| US7947646B2 (en) | 2007-03-06 | 2011-05-24 | Amgen Inc. | Variant activin receptor polypeptides |
| ES2449753T3 (es) | 2007-03-19 | 2014-03-21 | National Research Council Of Canada | Proteínas de fusión que comprenden dos dominios de unión tgf-beta |
| JP5719766B2 (ja) * | 2008-05-02 | 2015-05-20 | アクセルロン ファーマ, インコーポレイテッド | 血管新生および周皮細胞組成物を調節するための方法および組成物 |
| TW201803586A (zh) | 2008-08-14 | 2018-02-01 | 艾瑟勒朗法瑪公司 | 使用gdf阱以增加紅血球水平 |
| JP5611222B2 (ja) | 2008-11-26 | 2014-10-22 | アムジエン・インコーポレーテツド | アクチビンiib受容体ポリペプチドの変異体及びその使用 |
| AU2010204985A1 (en) | 2009-01-13 | 2011-08-04 | Acceleron Pharma Inc. | Methods for increasing adiponectin |
| JP5755635B2 (ja) | 2009-03-30 | 2015-07-29 | アクセルロン ファーマ, インコーポレイテッド | Bmp−alk3アンタゴニストおよび骨成長促進のためのその使用 |
| FR2951408B1 (fr) | 2009-10-15 | 2012-01-13 | Renault Sa | Cadre moteur pour moteur electrique de vehicule automobile |
| AR080794A1 (es) | 2010-03-26 | 2012-05-09 | Hoffmann La Roche | Anticuerpos bivalentes biespecificos anti- vegf/ anti-ang-2 |
| CN102850458B (zh) | 2011-06-28 | 2014-10-01 | 华博生物医药技术(上海)有限公司 | 新型重组双功能融合蛋白及其制法和用途 |
| WO2013149094A1 (en) | 2012-03-28 | 2013-10-03 | The Board Of Regents Of The University Of Texas System | TGFβ TYPE II-TYPE III RECEPTOR FUSIONS |
| HK1225740A1 (zh) | 2013-08-22 | 2017-09-15 | Acceleron Pharma Inc. | TGF-β受体II型变体及其用途 |
| WO2016090035A2 (en) | 2014-12-02 | 2016-06-09 | La Jolla Institute For Allergy And Immunology | Modulators of activin and methods for modulating immune responses and t follicular helper cells |
| MA41919A (fr) | 2015-04-06 | 2018-02-13 | Acceleron Pharma Inc | Hétéromultimères alk4:actriib et leurs utilisations |
| US10358476B2 (en) | 2015-04-06 | 2019-07-23 | Acceleron Pharma Inc. | Single arm type I and type II receptor fusion proteins and uses thereof |
| MA41920B1 (fr) | 2015-04-06 | 2021-05-31 | Acceleron Pharma Inc | Protéines de fusion de récepteur type i et type ii à bras unique et leurs utilisations |
| CA2983440C (en) | 2015-04-22 | 2024-03-12 | Alivegen Usa Inc. | Novel hybrid actriib ligand trap proteins for treating muscle wasting diseases |
| WO2016205370A1 (en) | 2015-06-15 | 2016-12-22 | Santa Maria Biotherapeutics, Inc. | Methods of using activin receptor iib-based proteins |
| US20200231652A1 (en) | 2015-08-31 | 2020-07-23 | National Research Council Of Canada | Tgf-b-receptor ectodomain fusion molecules and uses thereof |
| WO2017177013A1 (en) | 2016-04-06 | 2017-10-12 | Acceleron Pharma Inc. | Alk7 antagonists and uses thereof |
| CA3029890A1 (en) | 2016-07-07 | 2018-01-11 | Acceleron Pharma Inc. | Tgf-beta superfamily heteromultimers and uses thereof |
| WO2018009732A1 (en) | 2016-07-08 | 2018-01-11 | Regeneron Pharmaceuticals, Inc. | Anti-activin a antibodies and methods of use thereof for treating pulmonary arterial hypertension |
| CA3039573A1 (en) | 2016-10-05 | 2018-04-12 | Acceleron Pharma Inc. | Alk4:actriib heteromultimers and uses thereof |
| JOP20190085A1 (ar) | 2016-10-20 | 2019-04-17 | Biogen Ma Inc | طرق علاج الضمور العضلي ومرض العظام باستخدام بروتينات احتجاز مركب ترابطي actriib هجين حديثة |
-
2016
- 2016-04-06 MA MA41920A patent/MA41920B1/fr unknown
- 2016-04-06 JP JP2017552155A patent/JP7055636B2/ja not_active Expired - Fee Related
- 2016-04-06 MA MA054328A patent/MA54328A/fr unknown
- 2016-04-06 KR KR1020177031991A patent/KR20180002661A/ko not_active Ceased
- 2016-04-06 CA CA2981833A patent/CA2981833A1/en active Pending
- 2016-04-06 EA EA202190016A patent/EA202190016A1/ru unknown
- 2016-04-06 EP EP21161146.2A patent/EP3889171B1/en active Active
- 2016-04-06 EA EA201792222A patent/EA037293B1/ru not_active IP Right Cessation
- 2016-04-06 MA MA053400A patent/MA53400A/fr unknown
- 2016-04-06 HK HK18112314.4A patent/HK1252957A1/zh unknown
- 2016-04-06 KR KR1020177031989A patent/KR20180002659A/ko not_active Ceased
- 2016-04-06 JP JP2017552491A patent/JP7037363B2/ja not_active Expired - Fee Related
- 2016-04-06 EP EP16777003.1A patent/EP3280435B1/en active Active
- 2016-04-06 US US15/092,577 patent/US10227392B2/en active Active
- 2016-04-06 MX MX2017012846A patent/MX391964B/es unknown
- 2016-04-06 ES ES16777229T patent/ES2863564T3/es active Active
- 2016-04-06 CN CN201680032890.1A patent/CN107847561B/zh not_active Expired - Fee Related
- 2016-04-06 BR BR112017021510A patent/BR112017021510A2/pt not_active IP Right Cessation
- 2016-04-06 WO PCT/US2016/026277 patent/WO2016164503A1/en not_active Ceased
- 2016-04-06 AU AU2016246708A patent/AU2016246708B2/en not_active Expired - Fee Related
- 2016-04-06 CN CN202210568634.1A patent/CN115073610A/zh active Pending
- 2016-04-06 US US15/092,609 patent/US10227393B2/en active Active
- 2016-04-06 DK DK16777229.2T patent/DK3280728T3/da active
- 2016-04-06 EP EP20206064.6A patent/EP3828199B1/en active Active
- 2016-04-06 CN CN202210222650.5A patent/CN114736307A/zh active Pending
- 2016-04-06 CN CN201680033093.5A patent/CN107709358A/zh active Pending
- 2016-04-06 EP EP25162196.7A patent/EP4599888A3/en active Pending
- 2016-04-06 AU AU2016244750A patent/AU2016244750B2/en not_active Ceased
- 2016-04-06 WO PCT/US2016/000033 patent/WO2016164089A2/en not_active Ceased
- 2016-04-06 CA CA2981737A patent/CA2981737A1/en active Pending
- 2016-04-06 EP EP16777229.2A patent/EP3280728B1/en active Active
- 2016-04-06 ES ES20206064T patent/ES3057446T3/es active Active
- 2016-04-06 MA MA041916A patent/MA41916A/fr unknown
- 2016-04-06 HK HK18109788.7A patent/HK1250373A1/zh unknown
-
2019
- 2019-01-18 US US16/251,935 patent/US11028145B2/en active Active
- 2019-01-18 US US16/251,325 patent/US10906958B2/en active Active
-
2020
- 2020-11-18 US US16/951,192 patent/US20220396607A1/en not_active Abandoned
- 2020-12-04 AU AU2020281136A patent/AU2020281136A1/en not_active Abandoned
-
2021
- 2021-01-27 AU AU2021200492A patent/AU2021200492A1/en not_active Abandoned
- 2021-04-15 JP JP2021069060A patent/JP7246618B2/ja active Active
- 2021-04-30 US US17/245,123 patent/US11827689B2/en active Active
-
2023
- 2023-08-21 US US18/236,082 patent/US20240158468A1/en active Pending
Patent Citations (82)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1984001106A1 (en) | 1982-09-24 | 1984-03-29 | Us Health | Repair of tissue in animals |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5283317A (en) | 1987-08-03 | 1994-02-01 | Ddi Pharmaceuticals, Inc. | Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| US5096815A (en) | 1989-01-06 | 1992-03-17 | Protein Engineering Corporation | Generation and selection of novel dna-binding proteins and polypeptides |
| US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5270163A (en) | 1990-06-11 | 1993-12-14 | University Research Corporation | Methods for identifying nucleic acid ligands |
| US5475096A (en) | 1990-06-11 | 1995-12-12 | University Research Corporation | Nucleic acid ligands |
| US5707796A (en) | 1990-06-11 | 1998-01-13 | Nexstar Pharmaceuticals, Inc. | Method for selecting nucleic acids on the basis of structure |
| US5763177A (en) | 1990-06-11 | 1998-06-09 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: photoselection of nucleic acid ligands and solution selex |
| US5567588A (en) | 1990-06-11 | 1996-10-22 | University Research Corporation | Systematic evolution of ligands by exponential enrichment: Solution SELEX |
| US5580737A (en) | 1990-06-11 | 1996-12-03 | Nexstar Pharmaceuticals, Inc. | High-affinity nucleic acid ligands that discriminate between theophylline and caffeine |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US20050186593A1 (en) * | 1991-05-10 | 2005-08-25 | The Salk Institute For Biological Studies | Cloning and recombinant production of CRF receptor(s) |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
| WO1993011162A1 (en) | 1991-11-29 | 1993-06-10 | Protein Design Labs, Inc. | Bispecific antibody heterodimers |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5677196A (en) | 1993-05-18 | 1997-10-14 | University Of Utah Research Foundation | Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays |
| US5525490A (en) | 1994-03-29 | 1996-06-11 | Onyx Pharmaceuticals, Inc. | Reverse two-hybrid method |
| WO1996026432A1 (en) | 1995-02-23 | 1996-08-29 | University Of Utah Research Foundation | Composite waveguide for solid phase binding assays |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5955280A (en) | 1995-04-11 | 1999-09-21 | The General Hospital Corporation | Reverse two-hybrid system |
| US5965368A (en) | 1995-04-11 | 1999-10-12 | The General Hospital Corporation | Reverse two-hybrid systems |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6699843B2 (en) | 1995-06-07 | 2004-03-02 | Gilead Sciences, Inc. | Method for treatment of tumors using nucleic acid ligands to PDGF |
| US7183076B2 (en) | 1997-05-02 | 2007-02-27 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| US6011577A (en) | 1997-06-30 | 2000-01-04 | Polaroid Corporation | Modular optical print head assembly |
| US6537966B1 (en) | 1997-08-29 | 2003-03-25 | Human Genome Sciences, Inc. | Follistatin-3 |
| US7189826B2 (en) | 1997-11-24 | 2007-03-13 | Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| WO2000000823A1 (en) | 1998-06-26 | 2000-01-06 | Sunesis Pharmaceuticals, Inc. | Methods for rapidly identifying small organic ligands |
| US20090010879A1 (en) | 1998-09-25 | 2009-01-08 | Neil Stahl | Receptor Based Antagonists and Methods of Making and Using |
| WO2000039585A1 (en) | 1998-12-28 | 2000-07-06 | Sunesis Pharmaceuticals, Inc. | Identifying small organic molecule ligands for binding |
| US7332581B2 (en) | 1999-01-15 | 2008-02-19 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2000043781A2 (en) | 1999-01-21 | 2000-07-27 | Metamorphix, Inc. | Growth differentiation factor inhibitors and uses therefor |
| US20060148748A1 (en) | 1999-07-29 | 2006-07-06 | Gilead Sciences, Inc. | Nucleic acid ligands which bind to hepatocyte growth factor/scatter factor (HGF/SF) or its receptor c-met |
| US20070117126A1 (en) | 1999-12-15 | 2007-05-24 | Genentech, Inc. | Shotgun scanning |
| US20060025576A1 (en) | 2000-04-11 | 2006-02-02 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| US20070061900A1 (en) | 2000-10-31 | 2007-03-15 | Murphy Andrew J | Methods of modifying eukaryotic cells |
| US7041870B2 (en) | 2000-11-30 | 2006-05-09 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| US20050119455A1 (en) | 2002-06-03 | 2005-06-02 | Genentech, Inc. | Synthetic antibody phage libraries |
| US20050079574A1 (en) | 2003-01-16 | 2005-04-14 | Genentech, Inc. | Synthetic antibody phage libraries |
| WO2005025601A1 (en) | 2003-09-15 | 2005-03-24 | Monash University | Follistatin isoforms and uses thereof |
| WO2005084699A1 (en) * | 2004-03-02 | 2005-09-15 | Acceleron Pharma Inc. | Alk7 and myostatin inhibitors and uses thereof |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| US20050266000A1 (en) | 2004-04-09 | 2005-12-01 | Genentech, Inc. | Variable domain library and uses |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| WO2006012627A2 (en) | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| US7709605B2 (en) | 2004-07-23 | 2010-05-04 | Acceleron Pharma Inc. | ActRII receptor polypeptides, methods and compositions |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| US20070160598A1 (en) | 2005-11-07 | 2007-07-12 | Dennis Mark S | Binding polypeptides with diversified and consensus vh/vl hypervariable sequences |
| US7612041B2 (en) | 2005-11-23 | 2009-11-03 | Acceleron Pharma Inc. | Isolated activin-binding ActRIIa polypeptide comprising the SEQ ID NO: 7 and uses for promoting bone growth |
| US20070237764A1 (en) | 2005-12-02 | 2007-10-11 | Genentech, Inc. | Binding polypeptides with restricted diversity sequences |
| US20070292936A1 (en) | 2006-05-09 | 2007-12-20 | Genentech, Inc. | Binding polypeptides with optimized scaffolds |
| WO2007147901A1 (en) | 2006-06-22 | 2007-12-27 | Novo Nordisk A/S | Production of bispecific antibodies |
| WO2008030367A2 (en) | 2006-09-01 | 2008-03-13 | The General Hospital Corporation | Selective myostatin inhibitors |
| US7842663B2 (en) | 2007-02-02 | 2010-11-30 | Acceleron Pharma Inc. | Variants derived from ActRIIB and uses therefor |
| WO2008097541A2 (en) | 2007-02-02 | 2008-08-14 | Acceleron Pharma Inc. | Variants derived from actriib and uses therefor |
| US20090002360A1 (en) | 2007-05-25 | 2009-01-01 | Innolux Display Corp. | Liquid crystal display device and method for driving same |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| US8592562B2 (en) | 2008-01-07 | 2013-11-26 | Amgen Inc. | Method for making antibody Fc-heterodimeric molecules using electrostatic steering effects |
| US20110236309A1 (en) | 2008-03-19 | 2011-09-29 | National Research Council Of Canada | Antagonists of ligands and uses thereof |
| WO2010151426A1 (en) | 2009-06-12 | 2010-12-29 | Acceleron Pharma Inc. | Truncated actriib-fc fusion proteins |
| WO2011034605A2 (en) | 2009-09-16 | 2011-03-24 | Genentech, Inc. | Coiled coil and/or tether containing protein complexes and uses thereof |
| US20120302737A1 (en) | 2009-09-16 | 2012-11-29 | Genentech, Inc. | Coiled coil and/or tether containing protein complexes and uses thereof |
| WO2012027065A2 (en) * | 2010-08-27 | 2012-03-01 | Celgene Corporation | Combination therapy for treatment of disease |
| WO2013063536A1 (en) * | 2011-10-27 | 2013-05-02 | Acceleron Pharma, Inc. | Actriib binding agents and uses thereof |
Non-Patent Citations (157)
| Title |
|---|
| "Uniprot", Database accession no. P01859 |
| ALLENDORPH ET AL., PNAS, vol. 103, no. 20, 2006, pages 7643 - 7648 |
| ALMAGROFRANSSON, FRONT. BIOSCI., vol. 13, 2008, pages 1619 - 1633 |
| ASHMORE ET AL., GROWTH, vol. 38, 1974, pages 501 - 507 |
| ATTISANO ET AL., CELL, vol. 68, no. 1, 1992, pages 97 - 108 |
| BACA ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684 |
| BALINT ET AL., GENE, vol. 137, 1993, pages 109 - 118 |
| BARTEL ET AL., BIOTECHNIQUES, vol. 14, 1993, pages 920 - 924 |
| BENOISTCHAMBON, NATURE, vol. 290, 1981, pages 304 - 310 |
| BOEMER ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 |
| BOGDANOVICH ET AL., NATURE, vol. 420, 2002, pages 418 - 421 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 |
| BRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42 |
| BROWN ET AL., GROWTH FACTORS, vol. 3, 1990, pages 35 - 43 |
| BROWN ET AL., MOL. CELL BIOL., vol. 12, 1992, pages 2644 - 2652 |
| BRUGGEMANN, M., J. EXP. MED., vol. 166, 1987, pages 1351 - 1361 |
| CANTINI ET AL., J SEX MED, vol. 5, 2008, pages 1607 - 1622 |
| CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285 |
| CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881 |
| CHOWDHURY, METHODS MOL. BIOL., vol. 207, 2008, pages 179 - 196 |
| CLOUTHIER ET AL., J CLIN. INVEST., vol. 100, no. 11, 1997, pages 2697 - 2713 |
| CLYNES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656 |
| COONEY ET AL., SCIENCE, vol. 241, 1988, pages 456 |
| CRAGG, M. S. ET AL., BLOOD, vol. 101, 2003, pages 1045 - 1052 |
| CRAGG, M. SM. J. GLENNIE, BLOOD, vol. 103, 2004, pages 2738 - 2743 |
| CUNNINGHAM ET AL., SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| CWIRLA ET AL., PNAS USA, vol. 87, 1990, pages 6378 - 6382 |
| DALL'ACQUA ET AL., METHODS, vol. 36, 2005, pages 61 - 68 |
| DAS ET AL., ANNU. REV. BIOCHEM., vol. 77, 2008, pages 363 - 382 |
| DAVIS ET AL., PROTEIN ENG DES SEL, vol. 23, 2010, pages 195 - 202 |
| DAVIS ET AL., PROTEIN ENG DESIGN SEL, vol. 23, 2010, pages 195 - 202 |
| DEPAOLO ET AL., PROC SOC EP BIOL MED., vol. 198, 1991, pages 500 - 512 |
| DERVAN ET AL., SCIENCE, vol. 251, 1991, pages 1300 |
| DEVLIN ET AL., SCIENCE, vol. 249, 1990, pages 404 - 406 |
| DONZEET ET AL., NUCLEIC ACIDS RES, vol. 30, 2002, pages e46 |
| DYSON ET AL., CURRBIOL., vol. 7, 1997, pages 81 - 84 |
| FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472 |
| FENN ET AL., PLOS ONE, vol. 8, 2013, pages e61953 |
| FLATMAN ET AL., J. CHROMATOGR. B, vol. 848, 2007, pages 79 - 87 |
| FRALEY ET AL., TRENDS BIOCHEM. SCI., vol. 6, 1981, pages 77 |
| GAMER ET AL., DEV BIOL., vol. 208, 1999, pages 222 - 32 |
| GAMER ET AL., DEV BIOL., vol. 229, 2001, pages 407 - 20 |
| GAMER ET AL., DEV. BIOL., vol. 208, 1999, pages 222 - 232 |
| GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163 |
| GOEDDEL: "Gene Expression Technology: Methods in Enzymology", 1990, ACADEMIC PRESS |
| GOLD ET AL., AM J PATHOL, vol. 174, no. 1, 2009, pages 184 - 195 |
| GONZALEZ-CADAVID ET AL., PNAS, vol. 95, 1998, pages 14938 - 43 |
| GOUMANS ET AL., MOL CELL, vol. 12, no. 4, 2003, pages 817 - 828 |
| GREENER ET AL., STRATEGIES IN MOL BIOL, vol. 7, 1994, pages 32 - 34 |
| GREENWALD ET AL., NAT STRUCT BIOL, vol. 6, 1999, pages 18 - 22 |
| GREENWALD ET AL., NATURE STRUCTURAL BIOLOGY, vol. 6, no. 1, 1999, pages 18 - 22 |
| GRIFFITHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734 |
| GROBET ET AL., NAT GENET, vol. 17, no. 1, 1997, pages 71 - 4 |
| GRODBERG ET AL., EUR. J. BIOCHEM., vol. 218, 1993, pages 597 - 601 |
| GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368 |
| GUSTIN ET AL., VIROLOGY, vol. 193, 1993, pages 653 - 660 |
| HEDGER ET AL., CYTOKINE AND GROWTH FACTOR REVIEWS, vol. 24, 2013, pages 285 - 295 |
| HELLSTROM, I ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502 |
| HELLSTROM, I. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063 |
| HILDEN ET AL., BLOOD, vol. 83, no. 8, 1994, pages 2163 - 2170 |
| HINCK ET AL., FEBS LETTERS, vol. 586, 2012, pages 1860 - 1870 |
| HINCK, FEBS LETT, vol. 586, 2012, pages 1860 - 1870 |
| HOCHULI ET AL., J CHROMATOGRAPHY, vol. 411, 1987, pages 177 |
| HOHJOH, FEBS LETT, vol. 521, 2002, pages 195 - 199 |
| HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOMWINTER, J. MOL. BIOL., vol. 227, 1992, pages 381 - 388 |
| HRUSKA ET AL., CHRONIC KIDNEY DISEASE MINERAL BONE DISORDER (CKD-MBD, 2008, pages 277 - 289 |
| HUDSON ET AL., NAT. MED., vol. 9, 2003, pages 129 - 134 |
| IKE ET AL., NUCLEIC ACID RES., vol. 11, 1983, pages 477 |
| ITAKURA ET AL., ANNU. REV. BIOCHEM., vol. 53, 1984, pages 323 |
| ITAKURA ET AL., SCIENCE, vol. 198, 1984, pages 1056 |
| IWABUCHI ET AL., ONCOGENE, vol. 8, 1993, pages 1693 - 1696 |
| JAKOBY WB ET AL., METHODS IN ENZYMOLOGY, vol. 46, 1974, pages 1 |
| JANKNECHT ET AL., PNAS USA, vol. 88, 1991, pages 8972 |
| KAMBADUR ET AL., GENOME RES., vol. 7, 1997, pages 910 - 915 |
| KLAHRMORRISSEY, AM J PHYSIOL RENAL PHYSIOL, vol. 283, 2002, pages F861 - F875 |
| KLEIN ET AL., MABS, vol. 4, 2012, pages 653 - 663 |
| KLIMKA ET AL., BR. J. CANCER, vol. 83, 2000, pages 252 - 260 |
| KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553 |
| KOZBAR ET AL., IMMUNOLOGY TODAY, vol. 4, 1983, pages 72 |
| KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001 |
| KUBICZKOVA ET AL., JOURNAL OF TRANSLATIONAL MEDICINE, vol. 10, 2012, pages 183 |
| LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132 |
| LEUNG ET AL., METHOD CELL MOL BIOL, vol. 1, 1989, pages 11 - 19 |
| LEWIS, NAT. BIOTECLMOL., vol. 32, 2014, pages 191 - 198 |
| LI ET AL., IMMUNITY, vol. 25, no. 3, 2006, pages 455 - 471 |
| LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 3557 - 3562 |
| LIN ET AL., REPRODUCTION, vol. 132, 2006, pages 179 - 190 |
| LONBERG, CURR. OPIN. IMMUNOL., vol. 20, pages 450 - 459 |
| LONBERG, NAT. BIOTECH., vol. 23, 2005, pages 1117 - 1125 |
| LOWMAN ET AL., BIOCHEMISTRY, vol. 30, 1991, pages 10832 - 10838 |
| MACIAS-SILVA ET AL., J BIOL CHEM., vol. 273, 1998, pages 25628 - 36 |
| MADURA ET AL., J BIOL CHEM, vol. 268, 1993, pages 12046 - 12054 |
| MANNINO ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 682 |
| MASSAGUE, NAT. REV. MOL. CELL BIOL., vol. 1, 2000, pages 169 - 178 |
| MASSAGUE, NAT. REV. MOL. CELL. BIOL., vol. 1, 2000, pages 169 - 178 |
| MCCAFFERTY ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| MCKNIGHT ET AL., SCIENCE, vol. 232, 1982, pages 316 |
| MCPHERRON ET AL., NAT. GENET., vol. 22, 1999, pages 260 - 264 |
| MCPHERRON ET AL., NATURE, vol. 387, 1997, pages 83 - 90 |
| MCPHERRONLEE, PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 12457 - 12461 |
| MERCHANT ET AL., NAT BIOTECH, vol. 16, 1998, pages 677 - 681 |
| MERCHANT ET AL., NAT. BIOTECHNOL., vol. 16, 1998, pages 677 - 681 |
| MEYERS ET AL., SCIENCE, vol. 232, 1986, pages 613 |
| MILSTEINCUELLO, NATURE, vol. 305, 1983, pages 537 |
| MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855 |
| NAGASHIMA ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 2888 - 2892 |
| NAKASHIMA ET AL., MECH. DEV., vol. 80, 1999, pages 185 - 189 |
| NARANG, SA, TETRAHEDRON, vol. 39, 1983, pages 3 |
| NI, XIANDAI MIANYIXUE, vol. 26, no. 4, 2006, pages 265 - 268 |
| O'CONNOR, J. NEUROCHEM., vol. 56, 1991, pages 560 |
| PACK ET AL., BIO/TECHNOLOGY, vol. 11, 1993, pages 1271 - 1277 |
| PACKPLUECKTHUN, BIOCHEMISTRY, vol. 31, 1992, pages 1579 - 1584 |
| PADDISON ET AL., GENES & DEV., vol. 16, 2002, pages 948 - 958 |
| PADLAN, MOL. IMMUNOL., vol. 28, 1991, pages 489 - 498 |
| PETKOVA, S. B. ET AL., INTL. IMMUNOL., vol. 18, no. 12, 2006, pages 1759 - 1769 |
| PISTILLI ET AL., AM J PATHOL, vol. 178, 2011, pages 1287 - 1297 |
| PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599 |
| PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623 |
| QUEEN ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 86, 1989, pages 10029 - 10033 |
| RAVETCHKINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492 |
| RIDER ET AL., BIOCHEM J., vol. 429, no. 1, 2010, pages 1 - 12 |
| RIDGWAY ET AL., PROTEIN ENG, vol. 9, 1996, pages 617 - 621 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329 |
| ROBERTS ET AL., BIOL REPROD, vol. 68, 2003, pages 1719 - 1726 |
| ROBERTS ET AL., PNAS USA, vol. 89, 1992, pages 2429 - 2433 |
| ROMANO ET AL., JOURNAL OF MOLECULAR MODELING, vol. 18, no. 8, 2012, pages 3617 - 3625 |
| ROSOK ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 22611 - 22618 |
| RUF ET AL., BIOCHEMISTRY, vol. 33, 1994, pages 1565 - 1572 |
| SAKUMA ET AL., GENES CELLS, vol. 7, 2002, pages 401 - 12 |
| SCHAEFER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 108, 2011, pages 11187 - 11192 |
| SCHUELKE ET AL., N ENGL J MED, vol. 350, 2004, pages 2682 - 8 |
| SIDHU ET AL., J. MOL. BIOL., vol. 340, no. 5, 2004, pages 1073 - 1093 |
| SPIESS ET AL., MOLECULAR IMMUNOLOGY, vol. 67, no. 2A, 2015, pages 95 - 106 |
| SWATLANDKIEFFER, J. ANIM. SCI., vol. 38, 1994, pages 752 - 757 |
| THOMPSON ET AL., THE EMBO JOURNAL, vol. 22, no. 7, 2003, pages 1555 - 1566 |
| THOTAKURA ET AL., METH. ENZYMOL., vol. 138, 1987, pages 350 |
| TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 |
| VAN DIJKVAN DE WINKEL, CURR. OPIN. PHARMACOL., vol. 5, 2001, pages 368 - 74 |
| VIDALLEGRAIN, NUCLEIC ACIDS RES, vol. 27, 1999, pages 919 - 29 |
| VIDALLEGRAIN, TRENDS BIOTECHNOL, vol. 17, 1999, pages 374 - 81 |
| VOLLMERSBRANDLEIN, HISTOL. HISTOPATHOL., vol. 20, no. 3, 2005, pages 927 - 937 |
| VOLLMERSBRANDLEIN, METHODS FIND EXP. CLIN. PHARMACOL., vol. 27, no. 3, 2005, pages 185 - 91 |
| WAGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 1441 - 1445 |
| WAGNER, R., NATURE, vol. 372, 1994, pages 333 - 335 |
| WAKEFIELD ET AL., J. BIOL. CHEM., vol. 263, 1988, pages 7646 - 7654 |
| WANG ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 3095 - 3099 |
| WEISS ET AL., DEVELOPMENTAL BIOLOGY, vol. 2, no. 1, 2013, pages 47 - 63 |
| WINTER ET AL., ANN. REV. IMMUNOL., vol. 113, 1994, pages 433 - 455 |
| WOODRUFF, BIOCHEM PHANNACOL., vol. 55, 1998, pages 953 - 963 |
| WRANIK ET AL., J BIOL CHEM, vol. 287, 2012, pages 43331 - 43339 |
| WRANIK ET AL., J. BIOL. CHEM., vol. 287, 2012, pages 43331 - 43339 |
| WU ET AL., NEURON., vol. 37, 2003, pages 197 - 207 |
| YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 797 |
| YANG ET AL., PROC NATL ACAD SCI USA, vol. 99, 2002, pages 6047 - 6052 |
| ZERVOS ET AL., CELL, vol. 72, 1993, pages 223 - 232 |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10588980B2 (en) | 2014-06-23 | 2020-03-17 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
| US10786576B2 (en) | 2014-06-23 | 2020-09-29 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
| US11752211B2 (en) | 2014-06-23 | 2023-09-12 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
| WO2017177013A1 (en) * | 2016-04-06 | 2017-10-12 | Acceleron Pharma Inc. | Alk7 antagonists and uses thereof |
| US12024563B2 (en) | 2016-04-06 | 2024-07-02 | Acceleron Pharma Inc. | ALK7 antagonists and uses thereof |
| JP2022084709A (ja) * | 2016-10-05 | 2022-06-07 | アクセレロン ファーマ インコーポレーテッド | 腎臓疾患を治療するための組成物および方法 |
| WO2021183819A1 (en) * | 2020-03-13 | 2021-09-16 | Acceleron Pharma Inc. | Single-arm actriia and actriib heteromultimers and methods for treating renal diseases or conditions |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11827689B2 (en) | ALK7:ActRIIB heteromultimers and uses thereof | |
| US12258380B2 (en) | ALK4:actriib heteromultimers and uses thereof | |
| US12024563B2 (en) | ALK7 antagonists and uses thereof | |
| EA040176B1 (ru) | Гетеромультимеры alk4:actriib и их использование | |
| HK1248734B (en) | Alk4:actriib heteromultimers and uses thereof | |
| HK1248735B (en) | Alk7:actriib heteromultimers and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16777229 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2981833 Country of ref document: CA Ref document number: 2017552155 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2016246708 Country of ref document: AU Date of ref document: 20160406 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20177031991 Country of ref document: KR Kind code of ref document: A |