WO2016161100A1 - Protoxin-ii variants and methods of use - Google Patents
Protoxin-ii variants and methods of use Download PDFInfo
- Publication number
- WO2016161100A1 WO2016161100A1 PCT/US2016/025247 US2016025247W WO2016161100A1 WO 2016161100 A1 WO2016161100 A1 WO 2016161100A1 US 2016025247 W US2016025247 W US 2016025247W WO 2016161100 A1 WO2016161100 A1 WO 2016161100A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- protoxin
- cooh
- variant
- pain
- navl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
- C07K14/43513—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae
- C07K14/43518—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae from spiders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1767—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/643—Albumins, e.g. HSA, BSA, ovalbumin or a Keyhole Limpet Hemocyanin [KHL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/04—Centrally acting analgesics, e.g. opioids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
Definitions
- the present invention relates to Protoxin-II variants, synthetic polynucleotides encoding them, and methods of making and usi g the foregoing.
- VSC Voltage-gated sodi m channels
- Sodium channels are typically a complex of various subunits, the principle one being the pore-forming alpha-subunit, which is alone sufficient for function.
- the Navl . x subfamily can be pharmacologically subdivided into two groups, the tetrodotoxin (TTX) -sensitive and TTX-resistant .
- Navl.7 (a.k.a, PN1 or hNE ) is encoded by the SCN9A gene, is TTX-sensitive and is primarily expressed in peripheral sympathetic and sensory neurons.
- Navl .7 accumulates at nerve fiber endings and amplifies small sub ⁇ threshold depolarizations and acts as a threshold channel that regulates excitability,
- Navl .7 function is implicated in various pain states, including acute, inflammatory and/ or neuropathic pain.
- gain of function mutations of Navl .7 have been linked to primary erythermalgia (PE), a disease characterized by burning pain and inflammation of the extremities (Yang et al., J Med Genet 41:171-4, 2004) , and paroxysmal extreme pain disorder (PEPD) (Fertieman et al., Neuron 52:767-74, 2006) .
- PE primary erythermalgia
- PPD paroxysmal extreme pain disorder
- non-selective sodium channel blockers lidocaine, mexiletine and carbamazepine can provide symptomatic relief in these painful disorders
- CIP congenital indifference to pain
- Single nucleotide polymorphisms in the coding region of SCN9A have been associated with increased nociceptor exci ability and pai sensitivity. For example, a
- polymorphism rs6746030 resulting in P.1150W substitution in human Navl .7 has been associated with osteoarthritis pain, lumbar discectomy pain, phantom pain, and pancreatitis pain
- DRG neurons expressing the R1150W mutant Navl , 7 display inc eased firing freq e cy in response to depolarization
- mice deletion of the SCN9A gene in nociceptive neurons leads to reduction in mechanical and thermal pain thresholds a d reduction or abolition of inflammatory pain responses (Nassar et al. , Proc Natl Acad Sci USA 101: 12706- 11, 2004) .
- Spider venoms are known to contain a large number of sodium channel blocking peptides, including Huwentoxin-IV (HwTx-Iv) (Peng et al., J Biol Chem 277:47564-71, 2002), Protoxin-I, Protoxin-II (Middleton et al., Biochemistry 41:14734-47, 2002) and Phrixotoxin-lll ⁇ Bosmans et al., Mol Pharmacol 69:419-29, 2006) .
- Huwentoxin-IV HwTx-Iv
- Protoxin-I Protoxin-I
- Protoxin-II Protoxin-II
- One embodiment of the invention is an isolated Protoxin- II variant that inhibits human Navl.7 activity, wherein the Protoxin-II variant has at least one amino acid substitution selected from, the group consisting of W7Q and W30L; wherein residue numberi g is according to SEQ ID NO: 1.
- Another embodiment of the invention is an isolated Protoxin-II variant, wherein the Protoxin-II variant inhibits human Navl.7 activity with an IC 50 value of about. Ixl0 ⁇ 7 M or less, about 1x10 ⁇ 8 M or less, about IxlO "9 M or less, about IxlO ""10 M or less, about IxlO ""11 M or less, or about lxl 0 "'12 M or less, wherein the IC 50 value is measured using a FLIPR ⁇ Tetra membrane depolarization assay using fluorescence resonance energy transfer (FRET) in the presence of 25xlCT 6 M 3-veratroyl eracevine in HEK293 cells stably expressing huma n Navl.7, 'herein the Protoxin-II varia t has a W7Q a d/or a W30L substitution, wherein residue numbering is according to SEQ ID NO: 1.
- FRET fluorescence resonance energy transfer
- Another eiribocliment of the invention is an isolated Protoxin-II variant comprising the amino acid sequence that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the amino acid sequence of SEQ ID NO: 422 ⁇ GPYCQKWMQ CDSERKCC ⁇ GMVCRLWCKKKLL-COOH ) ; wherein the amino acid sequence has Q at position 7 and L at position 30, when residue numbering is according to SEQ ID NO: 1.
- Another embodimen of the invention is an isolated fusion protein comprising the Protoxin-II variant of the invention conjugated to a half-life extending moiety.
- Another embodiment of the invention is an isolated polynucleotide encoding the Protoxin-II variant of the i ventio ,
- Another embodiment of the invention is a vector comprising the isolated polynucleotide of the invention.
- Another embodiment of the invention is a host cell comprising the vector of the invention.
- Another embodiment of the invention is a method of producing the isolated Protoxin-II variant of the invention, comprising culturing the host cell of the invention and recovering the Protoxin-II variant produced by the host cell.
- Another embodimen of the invention is a pharmaceutical composition comprising the isolated Protoxin-II variant or fusion protein of the invention and a pharmaceutically acceptable excipient.
- Another embodiment of the invention is a method of treating Navl . ' /-mediated pain in a subject, comprising administering to a subject in need thereof an effective amount of the Protoxin-II variant or the fusion protein of the invention to treat the pain.
- Figure 1 shows the genus amino acid sequence of Protoxin- I I variants that inhibit Navl .7 with an IC 50 value of 30 nM or less in a FLIPR Tetra assay. Residue numbering is according to wild-type Protoxin- I I of SEQ ID NO: 1. Genus SEQ ID NO: 403.
- Figure 2 shows the I C Q values for Navl .7 and Navl , (5
- Figure 3 shows the sequences and the genus sequence of
- Protoxin-II variants that inhibit Navl .7 with an IC 50 value of 30 M or less in a FLIP Tetra assay, and are over 30-fold selective over Navl.6. Selectivity of each variant was calculated by ratio of IC 50 (Navl .6) /IC 50 9avl .7 ) obtained in QPatch assay. Residue numbering is according to wild-type Protoxin- I I of SEQ ID NO: 1.
- Figure 4A shows efficacy of NV1D3034 (NV1D3034-OH) (SEQ ID NO: 78) against CFA-induced thermal hyperalgesia in mice, assessed by measurement of paw withdrawal latency in the Hargreaves test before (pre-CFA) and after CFA injection (0) and 1-day after peptide administration (1) .
- NV1D3034-OH NV1D3034-OH
- SEQ ID NO: 78 SEQ ID NO: 78
- Figure 4B shows efficacy of NV1D3034 (NV1D3034-OH) ( SEQ ID NO: 78) in CFA-induced thermal hyperalgesia in mice, expressed as percent. MPE (maximum possible effect) (MPE%) at each dose on dayl following peptide admi istration. *P ⁇ 0.05 vs PBS, one-way ANOVA followed by Bonferroni' s multiple comparison .
- Figure 5A shows efficacy of NV1D3368 (NV1D3368-OH) (SEQ ID NO: 198) against CFA-induced thermal hyperalgesia in mice, assessed by measurement of paw withdrawal latency in the Hargreaves test before (pre-CFA) and after CFA injection (0) and 1-day after peptide administration (1) . **P ⁇ 0.01 and ****p ⁇ 0.0001 vs. PBS, two-way ANOVA followed by Bonferroni' s mu11 i p1e comparison
- Figure 5B shows efficacy of NV1D3368 (NV1D3368-OH) (SEQ ID NO: 198) in CFA-induced thermal hyperalgesia in mice, expressed as percent MPE (MPE%) at each dose on dayl following peptide administration.
- MPE percent MPE
- Figure 6A shows efficacy of NV1D2775-OH (SEQ ID NO: 56) against CFA-induced thermal hyperalgesia in mice, assessed by measurement of paw withdrawal latency in the Hargreaves test before (pre-CFA) and after CFA injection (0) and 1-day after peptide administration (1) .
- Figure 6B shows efficacy of NV1D2775-OH (SEQ ID NO: 56) in CFA-induced thermal hyperalgesia in mice, expressed as percent MPE (MPE%) at each dose on dayl following peptide administration.
- MPE% percent MPE
- Figure 6C shows efficacy of NV1D2775-OH (SEQ ID NO: 56) against CFA-induced tactile allodynia in mice. Tactile thresholds of hind paw before (pre-CFA) and after CFA (0) and 1-day after peptide administration (1) . ****P ⁇ 0.0001 vs. PBS, two-way ANOVA followed by Bonferroni's multiple comparison.
- Figure 6D shows efficacy of NV1D2775-OH ( SEQ ID NO: 56) against CFA-induced tactile allodynia in mice, expressed as percent MPE (MPE%) on dayl following peptide. ***P ⁇ 0.001 vs PBS, one-wa ANOVA followed by Bonferroni's multiple comparison .
- Figure 7A shows time course of NV1D2775-OH mediated reversal of thermal hyperalgesia in the mouse CFA model as assessed by measurement of paw withdrawal latency in the Hargreaves test before and after CFA and at various time points post-peptide administration. **P ⁇ 0.01 vs. PBS, two-way ANOVA followed by Bonferroni's multiple comparison. Shaded areas indicate compound delivery period (0-24hr) .
- Figure 7B shows time course of NV1D2775-OH mediated reversal of tactile allodynia in the mouse CFA model as assessed by measurement of tactile threshold before and after CFA and at various time points post-peptide administration. **P ⁇ 0.01 vs. PBS, two-way ANOVA followed by Bonferroni's multiple comparison. Shaded areas indicate compound delivery period (0-24hr) .
- Figure 8 shows that NV1D2775-OH produced significant analgesia in the mouse hotplate test. Thermal withdrawal latency was evaluated at 50 and 55 'C pre- and post-pump implantation. Pump implantation had no impact on the latency in the control PBS group . One day after pump, NV1D2775-OH treated-mice exhibited prolonged latency compared to the PBS group. *P ⁇ 0.05 and ****P ⁇ 0.0001 vs. PBS, one-way ANOVA followed by Bonferroni's multiple comparison.
- Figure 9 shows that NV1D2775-OH pretreatment protected animals from carrageenan-induced thermal hyperalgesia in mice. Paw withdrawal latencies were measured pre- and on dayl post -pump before intraplantar ca rageenan inj ection .
- Figure 10 shows the surface representation of the NMR structure of the wild type Protoxin-II.
- a hydrophobic face shown on left includes residues W5, M6, W7, L23 and W24.
- a selectivity face is shown on the right and includes residues Sll, E12, K14, E17, G18, L29 and W30. Residue numbering according to SEQ ID NO: 1.
- Figure 11A shows efficacy of the Protoxin-II variant 63955918 SEQ ID NO: 422) after a single intrathecal (IT)
- Tail withdrawal latency to a thermal stimulus was measured at. the indicated time pos t-peptide aamini stration .
- Figure 11B shows efficacy of the Protoxin-II variant 63955918 SEQ ID NO: 422) in the rat tail flick test expressed as percent area under the curve (AUC ) in the first 120min after a single intrathecal (IT) adminis tration .
- AUC percent area under the curve
- Figure 11C shows efficacy of the Protoxin-II variant 63955918 SEQ ID NO: 422) after a single intrathecal (IT)
- Figure 11D shows efficacy of the Protoxin-II variant 63955918 SEQ ID NO: 422) in the hot plate test expressed as percent area under the curve (AUCs) in the first 120min after a single intrathecal (IT) administration.
- AUCs percent area under the curve
- IT intrathecal
- Figure HE shows efficacy of the Protoxin-II variant 63955918 SEQ ID NO: 422) in the rat formalin test. Injection of formalin into the rat h ndpa induced a bi-phasic flinching behavio . Total numbe of flinches in Phase I (0-lOitiin post, formalin) and Phase II (ll-60min post formalin) was measured by an automated device. No statistics were performed in E) due to small group size.
- Figure 12A shows efficacy of NV1D2775-OH after a single intrathecal (IT) administration in the rat tail flick test. Tail withdrawal latency to a thermal stimulus was measured at the indicated time post-peptide administration.
- Figure 12B shows efficacy of NV1D2775-OH in the rat tail flick, test expressed as percent area under the curve (AUC%) in the first 120min after a single intrathecal (IT)
- Figure 12C shows efficacy of NV1D2775-OH after a single intrathecal (IT) administration in the rat hot plate test (52.5°C) .
- the latency of a nociceptive response on a hot plate was measured at the indicated time post-peptide administration .
- Figure 12D shows efficacy of NV1D2775--OH in the rat hot plate test expressed as pe cent a ea unde the curve (AUC%) i the first 120min after a single intrathecal (IT) administration. **P ⁇ 0.01 and ****P «3.0001 vs PBS, one-way ANOVA followed by Bonferroni's multiple comparison.
- Figure 12E shows efficacy of NV1D2775-OH in the formalin test.
- In ection of fo malin into the rat hindpa induced a bi-phasic fli chi g behavior.
- Total numbe of fli ches in Phase I (0-lOmin post formalin) and Phase II (ll-60min post formalin) was measured by an automated device. **P ⁇ 0.01 vs PBS, phase I, *P ⁇ 0.05 vs PBS, phase II, one-way A OVA followed by Bonferroni's multiple comparison.
- Figure 13A shows efficacy of NV1D3034-OH after a single int athecal (IT) admi istration i the rat tail flick test. Tail withdrawal latency to a thermal stimulus was measured at the indicated time post-peptide administration.
- Figure 13B shows efficacy of NV1D3034-OH in the rat tail flick test, expressed as percent, area under the curve (AUC%) in the first 12 Omin after a si gle intrathecal (IT)
- Figure 13C shows efficacy of NV1D3034-OH after a. single int athecal (IT) admi istration in. the rat hot plate test (52.5°C) - The latency of a nociceptive response on a hot plate was measured at the indicated time post-peptide administration .
- Figure 13D shows efficacy of NV1D3034-OH in the rat hot. plate test expressed as pe cent area under the curve (AUC%) i the first 120min after a single intrathecal (IT) administration, **P ⁇ 0.01 vs PBS, t-test.
- Figure 13E shows efficacy of NV1D3034-OH in the rat formalin test. Injection of formalin into the rat hindpaw induced a bi-phasic fli chi g behavior. Total numbe of flinches in Phase I (0-lOmin post formalin) and Phase II (ll ⁇ 60min post formalin) was measured by an automated device. *P ⁇ 0.05 vs PBS , phase I, **P ⁇ 0.01 vs PBS, phase II, t-test.
- Figure 14 shows the amino acid alignmen of the Family 3 cystei e knot, toxin peptides.
- polypeptide means a. molecule that, comprises at least two amino acid residues linked by a peptide bond to form a polypeptide. Small polypeptides of less than 50 amino acids may be referred to as “peptides”. Polypeptides may also be referred as "proteins”.
- polynucleotide means a molecule comprising a chain of nucleotides covalently linked by a sugar-phosphate backbone or other equivalent covalent chemistry. Double and single-stranded DNAs and RNAs are typical examples of pol n cleotides.
- complementary sequence means a second isolated polynucleotide sequence that is antiparallei to a first isolated polynucleotide sequence and that comprises nucleotides complementary to the nucleotides in the first polynucleotide sequence.
- vector means a non-natural polynucleotide capable of being duplicated within a biological system or that can be moved between such systems.
- polynucleotides typically contain a cDNA encoding a protein of interest and additional elements, such as origins of replication, polyadenylation signal or selection markers, that function to facilitate the duplication or maintenance of these polynucleotides in a biological system.
- additional elements such as origins of replication, polyadenylation signal or selection markers, that function to facilitate the duplication or maintenance of these polynucleotides in a biological system.
- biological systems may include a cell, virus, animal, plant, and reconstituted biological systems utilizing biological components capable of duplicating a vector.
- the polynucleotide comprising a vector may be DNA or RNA molecules or a hybrid of these.
- expression vector means a vector that can be utilized in a biological system or a reconstituted biological system to direct the translation of a polypeptide encoded by a polynucleotide sequence present in the expression vector.
- variable refers to a
- residues that are substituted in the Protoxin-II variants are numbered corresponding to their position in the wild-type Protoxin-II of SEQ ID NO: 1.
- "Y1A" in the specification refers to the substitution of tyrosine at residue position that corresponds to the position 1 in the wild type Protoxin- II of SEQ ID NO:l with alanine.
- Codons encoding the initiator methionine may or may not be present in cDNA.
- cDNA may be s nthesized for example by reverse tra sc iption or synthetic gene assembly.
- Synthetic or “non-natural” as used herein refers to a polynucleotide or a polypeptide molecule not present in nature ,
- hNE also referred to as hNE or PN1
- hNavl.7 refers to the well-known human sodium channel protein type 9 subunit alpha having a sequence shown in GenBank accession number NP_002968.1 and in SEQ ID NO: 79.
- wild type Protoxin-II or wild type ProTx-II as used herein refers to the tarantula Thrixopelma pruriens (Peruvian green velvet tarantula) toxin peptide having the amino acid sequence YCQKWMWTCDSEP.KCCEGMVCRLWCKKKLW-C00H (SEQ ID NO: 1 ⁇ as described in Middleton et al . , Biochemistry 41 (50) : 14734-47, 2002.
- recombinant Protoxin-II or recombinant ProTx- II as used herein refers to the recombinant Protoxin-II obtained from expression and subsequent cleavage of a
- Protoxin-II fusion protein having the sequence of
- Recombinant Protoxin-II incorporates a two amino acid N- terminal extension (residues G and P) when compared to the wild type Protoxin-II.
- Blocks human Navl .7 activity or “inhibits human Navl .7 acti ity” as sed he ein refers to the ability of the Protoxin-II variant of the invention to reduce membrane depolarization induced by veratridine ( 3-veratroylveracevine) with an IC 50 value of about IxlCT 7 M or less in a FLIPR® Tetra membrane depolarization assay using fluorescence resonance energy transfer (FRET), where veratridine-induced
- depolarization is measured as a reduction in FRET signal using DISBAC2 (3) ( [bis- (1,3-diethylthiobarbituric acid) trimethine oxonol] ) as an acceptor and PTS18 (trisodium 8- octadecyloxypyrene- 1 , 3, 6-trisulfonate) as a donor by exciting the donor at 390-420 nm and measuring FRET at. 515-575 nm i a cell line stably expressing human Navl .7.
- Protoxin-II variants of the invention may also be measured using QPatch electrophysiology at single or several Protoxin-II variant concentrations according to protocol described in Example 3.
- the Protoxin- II variant of the invention blocks human Navl .7 activity when it inhibits Navl .7 currents measured using QPatch by at least about 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% when using the assay protocol described in Example 3.
- FLIPR® Tetra membrane depolarization assay refers to the assay described in Example 3.
- QPatch assay or "QPatch electrophysiology assay” as used herein refers to the assay described in Example 3.
- substantially identical means that the two Protoxi -II variant amino acid sequences being compared are identical or have "insubstantial differences". Insubstantial differences are substitutions of 1, 2, 3, 4, 5, 6, or 7 amino acids in the Protoxin-II variant amino acid sequence that do not adversely affect peptide properties. Am no acid sequences substantially identical to the Protoxin- II variants disclosed he ein are withi the scope of the application. In some embodiments, the sequence identity can be about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher.
- Percent identity can be determined for example by pairwise alignment using the default settings of the AlignX module of Vector NTI v.9.0.0 (Invitrogen, Carslbad, CA) .
- the protein sequences of the present invention may be used as a query sequence to perform a search against public or patent databases, for example, to identify related sequences.
- Exemplary programs used to perform such searches are the XBLAST or BLAS P programs (http //www ncbi nlm/nih gov), or the GenomeQuestTM (GenomeQuest, Westborough, MA) suite using the default settings.
- the present invention provides isolated Protoxin-ll (ProTx-II) variant polypeptides that inhibit human Navl .7 activity, polynucleotides encoding them, vectors, host cells, and methods of using the polynucleotides and polypeptides of the invention,
- the polypeptides of the invention inhibit depolarization/currents resulting from Navl .7 activation, and therefore may be useful in the t eatme of various
- the variants of the invention are potent inhibitors of Navl .7.
- the current invention is based, at least in part, on the findi g tha certai residue substitutions in Protoxin-I I enhance selectivity, synthetic yield a d/or homogeneity without adversely affecting the potency of the generated Protoxin-II variants, specifically W7 and M19, and
- substitutions at positions W7 and W30 enhance the Protoxin-II variant folding and improve yield.
- substitutions at positions Sll, E12, K14, E17, G18, L29 and W30 improve selectivity of the resulting Protoxin-II variants to Navl.7.
- One embodiment of the invention disclosed herein, including in the numbered embodiments listed below is an isolated Protoxin-II variant, wherein the Protoxin-II variant inhibits human Navl .7 activity with an IC 50 value of about IxlCT 7 M or less, about IxlCT 8 M or less, about lxlCT 9 M or less, about IxlCT 1 " M or less, about; IxlCT” M or less, or about 1x10 "12 M or less, wherein the IC 50 val e is measu ed using a FLIPR® Tetra membrane depolarization assay using fluorescence resonance energy transfer (FRET) in the presence of 25x10 " " M 3-veratroylveracevine in HEK293 cells stably expressing human Navl .7.
- FRET fluorescence resonance energy transfer
- Another embodiment of the invention disclosed herein, including in the numbered embodiments listed below is an isolated Protoxin-II variant, wherein the Protoxin-II variant inhibits human Navl .7 activity with an IC 50 value of about IxlCT 7 M or less, about lxlO "8 M or less, about IxlCT 9 M or less, about lxlO ⁇ 1J K or less, about lxlQ ⁇ JJ - M or less, or about 1x10" 2 M or less, wherein the IC 50 value is measured using a FLIPR® Tetra membrane depolarization assay using fluorescence resonance energy transfer (FRET) in the presence of 25xlCT 6 M 3-ve ratroylveracevi tie in HEK293 cells stably expressing human Navl.7, wherein the Protoxin-II variant has at least one amino acid substitution selected from the group consisting of W7Q and W30L; wherein residue numbering is according to SEQ ID NO: 1.
- Another embodiment of the invention of the invention disclosed herein, including in the numbered embodiments listed below is an isolated Protoxin-II variant that inhibits human Navl.7 activity, wherein the Protoxin-II variant has at least one amino acid substitution selected from the group consisting of W7Q and W30L; wherein residue numbering is according to SEQ ID NO: 1.
- the Protoxin-II variant has a W7Q substitution.
- the Protoxin-II variant has a w30L substitution .
- the Protoxin-II variant has a W7Q and a W30L substitution.
- the Protoxin-II variant inhibits Navl.7 activity by at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% when the Navl .7 activity is measured using QPatch assay according to protocol
- the Protoxin-II variant has a substitution at one or more residue positions Yl, W7, Sll, E12, K14, E17, G18, R22, L29 and W30, when residue numbering is according to SEQ ID NO: 1.
- Another embodiment of the invention disclosed herein, including in the numbered embodiments listed below is an isolated Protoxin-II variant comprising the sequence
- YCQKWMQTCDSERKCCEGMVCRLWCKKKLL-COOH SEQ ID NO: 422; wherein residue Yl , Sll, E12, K14, E17, G18, M19, L29 and/or W30 is substituted with any other amino acid shown in Table 1 or a non-natural amino acid, optionally having an N-terminal extension or a C-terminal extension.
- the Protoxin-II variant of the invention described herein, including in the numbered embodiments listed below, contains at least one a non-natural amino acid.
- Non-natural amino acids include amino ⁇ -alanine ( ⁇ -Ala) and other omega-am no acids such as 3-aminopropionic acid
- -aminoisobutyric acid (Aib) ; ⁇ -aminohexanoic acid (Aha) ; ⁇ -aminovaleric acid (Ava) ; N-methylglycine or sarcosine (MeGly) ; ornithine (Om) ; citrulline (Cit) ; t- butylalanine ( t-BuA) ; t-butylglycine (t-BuG) ; N- methylisol eucine (Melle) ; phenylglycine (Phg) ;
- Xi is G, P, A or deleted
- X 2 is P, A or deleted
- X 3 is 3, Q, A, R or Y;
- X 4 is Q, R, K, A, S or Y;
- X 5 is K, S, 0 or R;
- X 6 is M or F
- -7 is T, S, R, K or 0;
- X e is D, T, or asparagyl-4-aminobutane
- X 9 is 3, A, R, I or V;
- Xio is E, R, N, K, T, Q, Y or glutamyl -4 -ami nobutane ;
- Xii is R or K
- Xi 2 is K, 0, S, A or F;
- X;L3 is E, Q, D, L, N, or glutamyl-4-aminobutane
- X 1 is G, Q o P;
- Xi5 is K or F
- X 16 is V or S
- X]7 is R, T or N-omega methyl-L-arginine; and X le is K o R; a d
- Xi9 is W o L
- Another embodiment of the invention disclosed herein, including in the numbered embodiments listed below is an isolated P otoxin-II variant comprisi g the sequence
- ⁇ : ⁇ is G, P, A or deleted
- X 2 is P, A or deleted
- X 3 is S, Q, A, R or Y;
- X 4 is S, A, R, I or V;
- X 5 is E, R, N, K, T, Q, Y or glutamyl -4-arninobutane
- X 6 is K, Q, S , A or F
- X 7 is E, Q, D, L, N or glutamyl-4-aminobutane ;
- Xe is G, Q or P
- X 9 is M or F
- Xio is L, V;
- X u is W or L.
- the Protoxin-II variant inhibits human Navl .7 activity with an IC 50 value of about IxlCT 7 M or less, wherein the IC 50 value is measured using a FLIPR® Tetra membrane depolarization assay using fluorescence resonance energy transfer (FRET) in the presence of 25xlCT 6 M 3-veratroylveracevine in HEK293 cells stably expressing human Navl .7.
- FRET fluorescence resonance energy transfer
- the Protoxin-II variant inhibits Navl .7 activity by at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% when the Navl .7 activity is measured using QPatch assay accordi g to protocol described in Example 3.
- the N-terminal exte sion comprises the amino acid sequences of SEQ ID NOs : 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384 or 385.
- the C-terminal extension comprises the amino acid sequence of SEQ ID NOs: 374, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396 or 397.
- the N-terminal and/or the C-terminal extension is conjugated to the Protoxin-II variant via a linker.
- the linker comprises the amino acid sequence of SEQ ID NOs: 383, 392, 398, 399, 400, 401 or 402.
- the N-terminal extension consists of the amino acid sequences of SEQ ID NOs: 372, 373, 374 , 375 , 376 , 377 , 378 , 379 , 380 , 381 , 382 , 383 , 384 or 385 .
- the C-terminal extension consists of the amino acid sequence of SEQ ID NOs : 374, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396 or 397,
- the linker consists of the amino acid sequence of SEQ ID NOs: 383, 392, 398, 399, 400, 401 or 402.
- Another embodiment of the invention disclosed herein, including in the nurabered embodiments listed below is an isolated Protoxin-II variant comprising the sequence
- ] is G, P, A or deleted
- X 2 is P, A or deleted
- X 3 is 3, Q, A, R or Y;
- X 5 is K, S, Q or R;
- X 6 is M or F
- x 7 is T, S, R, K or Q
- Xio is E, R, N , , T or Q;
- X]] is R or K
- x ]2 is K, Q, S or A;
- Xl3 is E, Q or D
- Xl4 is G or Q
- Xl5 is V or S
- Xl6 is R or T
- Xl7 is K or R
- polypeptide inhibits human Navl , 7 activity with an IC 50 value of about 1x10 "7 M or 1 wherein the IC 50 value is measured using a FLIPR® Tetra membrane depolarization assay using
- FRET fluorescence resonance energy transfer
- Protoxin-II variants of the invention disclosed herein, including in the numbered embodiments listed below are potent Navl.7 inhibitors.
- Protoxin-II (SEQ ID NO: 2) has an IC 5B value of about x10- * M for human Navl.7 in a veratridine-induced depolarization inhibition assay measuring decline in FRET (fluorescence resonance energy transfer) in cells stably expressing Navl.7 using FLIPR® Tetra instrument; (Molecular Devices) using experimental details described in Example 3.
- a Protoxin-II variant is "a potent" Navl.7 i hibitor when the IC 50 value in the assay described above and in Experiment 3 is about 30xl0 "9 M or less i.e. within 10 fold of recombinant Protoxin-II.
- an IC 50 of 30xl0 ⁇ 9 M is identical to IC 50 of 3.0xl0 ⁇ s M.
- Protoxin-II variant polypeptides of the invention disclosed herein may be produced by chemical synthesis, such as solid phase peptide synthesis, on an automated peptide synthesizer.
- the polypeptides of the invention may be obtained from polynucleotides encoding the polypeptides by the use of cell-free expression systems such as reticulocyte lysate based expression systems, or by recombinant expression systems.
- cell-free expression systems such as reticulocyte lysate based expression systems, or by recombinant expression systems.
- the Protoxin-II variants of the invention are generated by expressing them as human serum albumin (HSA) fusion proteins utilizing a glycine-rich linker such as ( GGGGS ) 4 (SEQ ID NO: 80) or (GGGGS) 6 ⁇ SEQ ID NO: 81 ⁇ coupled to a protease cleavable linker such as a recognition sequence for HRV3C protease (Recombinant type 14 3C protease from human rhinovirus) LEVLFQGP (HRV3C linker) (SEQ ID NO: 82), and cleaving the expressed fusion proteins with the HRV3C protease to release the recombinant Protoxin-II variant peptides.
- HSA human serum albumin
- a glycine-rich linker such as ( GGGGS ) 4 (SEQ ID NO: 80) or (GGGGS) 6 ⁇ SEQ ID NO: 81 ⁇ coupled to a protease cleav
- Protoxin-II variants of the invention disclosed herein may be purified using methods described herein.
- Protoxin-II variants of the invention expressed as HSA fusion proteins and cleaved with HRV3C protease may be purified using sold phase extraction (SPE) as described herein .
- SPE sold phase extraction
- Protoxin-II variants disclosed herein including in the numbered embodiments listed below optionally having N-terminal and/or C-tenainal extensions, and Protoxin- II variant fusion proteins is typically achieved at the nucleic acid level.
- the polynucleotides may be synthesized using chemical gene synthesis according to methods described in U.S. Pat. No. 6,521,427 and 6,670,127, utilizing
- oligonucleotides to generate the desired variants, or by standard PGR cloning and mutagenesis.
- Libraries of variants may be generated by standard cloning techniques to clone the polynucleotides encoding the Protoxin-II variants into the vecto for expression.
- Protoxin-II variants of the invention disclosed herein may incorporate additional N- and/or C-terminal amino acids when compared to the wild type Protoxin-II of SEQ ID NO: 1, for example resulting from cloning and/or expression
- cleavage from HSA after expression of the variant as HSA-linker- HRV3C cleavable peptide-Protoxin- II variant fusion protein may result in the incorporation of additional two residues to the N-terminus of each Protoxin- II variant, such as G a d P.
- Protoxin-II variants of the invention disclosed herein including in the numbered embodiments listed below are tested for their ability to inhibit human Navl .7 using methods described herein.
- An exemplary assay is a
- veratridine-induced depolarizatio inhibition assay measuring decline in FRET (fluorescence resonance energy transfer) in cells stably expressing Navl .7.
- Another exemplary assay employs electrophysiological recordings to measure changes in Navl .7-mediated currents using well known patch clamp techniques and as described herein.
- Another embodimen of the invention is an isolated Protoxin-II variant disclosed herein, including in the numbered embodiments listed below comprising the amino acid sequence of SEC ID NOs : 3, 4, , 6, 7, 8, 9, 10, 11, 12, 13
- Protoxin-Il variants of the invention disclosed herein may inhibit human Navl.7 with an 1C 50 value of about 1 ⁇ 10 ⁇ ' M or less, about 1x10 " ° M about 1x10 " “ or less, about lxl0 “lu M or less, about lxlO '11 M or less, or about 1x10 " 12 M or less.
- variants demonstrating the range of 1C 50 values are variants having amino acid sequences shown in SSQ ID NOs : 30, 40, 44, 52, 56, 56, 59, 65, 78, 109, 110, 111, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144,
- the Protoxin-Il variant inhibits Navl .7 activity by at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% when the Navl .7 activity is measured using QPatch assay accordi g to protocol described in Example 3.
- Exemplary variants inhibiting Navl .7 activity by at least 25% in a QPatch assay are variants having amino acid sequences shown in SEQ ID NOs : 109, 133,
- Table 2 shows the sequences of select Protoxin-II variants .
- NV1D751 4 GPQCQKWMWTCDSERKCCEGMVCRLWCKKKLW-COOH
- NV1D791 1 GPYCQKWMWTCDSKRKCCEGMVCRLWCKKKLW-COOH
- NV1D2512 13 GPYCQKWMWTCDSERKCCEGFVCRLWCKKKLW-COOH
- NV1D1336 14 GPYCQKW WTCDSERKCCEGLVCRLWCKKKLW-COOH
- NV1G979 NV1D2731 34 G PACQK W M QTC D AE R KCC E G M VC R L WC K K K LW-COO H
- NV1G 1105 NV1D2729 39 G PRCQKWMQTCDAERKCCEG MVCRLWCKKKLW-COOH
- NV1G987 NV1D2667 48 GPYCQKWMWTCDAERKCCEG FVCRLWCKKKLW-COOH NV1D2867 49 GPACQKWFQTCDAERKCCEGMVC LWCKKKLW-COOH
- NV1D2870 55 GPQCQKWFQTCDSE RKCCEG LVCRLWCKKKLW-COOH
- NV1G1061 NV1D2896 60 G PRCQKWMQTCDAE RKCCEG LVCRLWCKKKLW-COOH
- NV1G1001 NV1D2773 65 G
- PSCQK WMQTCDAERKCCEG FVCRLWCKKKLW-COOH
- NV1D2890 66 GPSCQKWFWTCDAERKCCEG LVCRLWCKKKLW-COOH
- NV1D29G9 72 GPQCQKWFQTCDAERKCCEG FVCRLWCKKKLW-COOH
- NV1D2914 75 GPRCQKWFQTCDAE RKCCEG LVCRLWCKKKLW-COOH
- NV1D2917 76 GPSCQKWFQTCDAERKCCEG FVCRLWCKKKLW-COOH
- NV1G 1187 NV1D3015 138 GPQCQKWMQTCDRERKCCEG FVCR
- NV1G1777 NV1D3342 175 GPQCAKWMQTCDRERKCCEGFVCT
- NV1G1803 NV1D3403 230 GPQCQKWMQTCDRERKCCEGFVCT
- NV1G1870 NV1D3583 321 GPACQKWMQTCDARRKCCEGFSCR
- NV1G1877 NV1D3775 329 GPSHSNTQTLAKAPEHTGAPAPAPA
- GGSAPAPAPAPAPAPAPAPAPGG GGSGSQCQKW QTCDRERKCCEG F VCTLWCRKKLW-COOH
- the isolated Protoxin-II variant inhibits human Navl .7 activity with an IC 50 value of about 3xl0 ⁇ 8 M or less.
- the isolated Protoxin-II variant inhibits human Navl , 7 activity with an IC 50 value of between about. 3x10 "8 M to about 1x10 " 9 M .
- Another embodimen of the invention disclosed herein, including in the numbered embodiments listed below is an isolated Protoxin-II variant comprising the amino acid sequence (SEQ ID NO: 433), wherein
- Xi is Q, R, K, A or S
- X 2 is K, S, Q or P.
- ⁇ 5 is D or T
- Xe is s, A or R
- Xe is R or K
- X 9 is , Q, S 0r A;
- Xio is E, , Q or D
- ii is G or Q
- Xl4 is R or T
- Xl5 is K or R.
- Exemplary Protoxin-II variants that inhibit human Navl .7 activity with an IC 50 value of about 30x10 " ' M or less are variants comprising the amino acid sequences of SEQ ID NOs : 56, 78, 111, 114, 117, 118, 119, 122, 123, 129, 130, 131, 132, 133, 134, 135 ,136 ,138 ,139, 140 ,141 ,142 ,145 ,146, 147, 149 ,150, 151, 152, 153, 154, 156, 158, 159, 165, 172, 173, 175, 177, 178, 183, 184, 185, 186, 189, 190, 193, 197, 199, 207, 210, 211, 216, 217, 224, 266, 273, 282, 335, 408, 409, 410, 422, 424, 425, 426, 427 and 428.
- the isolated Protoxin-II variant selectively inhibits human Navl .7
- the Protoxin-II variants of the invention may be more selective towards Navl .7 when compared to the recombinant Protoxin-II (SEQ ID NO: 2) .
- recombinant Protoxin-II has an IC 50 of about 2.2xl0 "9 M for Navl .7 and an IC 50 of about 62xl0 "9 M for Navl.6, and therefore the ratio of IC 50 for Navl.6 to IC 5Q for Navl.7 about 28 fold.
- IC 50 for Navl.6 may be assayed in a QPatch elec rophysiology assay using cell lines stabl expressing Navl .6 using similar methods to those described for Navl .7.
- Residue positions in Protoxin-II that can be mutagenized to improve selectivity include residues 7, 11, 12, 14, 17, 18 and 19, and optionally residues 1, 20, 22 and 26 (residue numbering acco di g to SSQ ID NO: 1) .
- Protoxin- II variants with improved selectivity are variants of SEQ ID NOs: 56, 59, 65, 78, 111, 114, 117, 118, 119, 121, 122, 123, 129, 130, 133, 150, 190, 217, 281, 324, 325 or 326.
- Another embodiment of the invention disclosed herein, including in the numbered embodiments listed below is an isolated Protoxin-II variant comprising the sequence
- Xl is Q, A, S
- x 5 is T or S
- x 4 is E, T or N;
- X.5 is E or Q
- Xg is V or S
- X 7 is R or T
- B is K or R
- Protoxin-II variant inhibits human Navl .7 activity with an IC 50 value of about. 3xl0 "8 M or less, and selectively inhibits human. Navl , 7.
- the isolated Protoxin-II variant comprises the sequence
- Xi is T or S
- X 2 is S, R or A
- X 3 is E, T or N ;
- X 6 is R or T
- X 7 is K or P..
- Another embodiment of the invention disclosed herein, including in the numbered embodiments listed below is an isolated P rotoxin--11 varia t comprising the ami o acid sequence that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the amino acid sequence of SEQ ID NO: 422 ( G PYCQKWMQTCDSERKCCEGMVCRLWCKKKLL-COOH ) ; wherein
- amino acid sequence has Q at position 7 and L at position 30, when residue numbering is according to SEQ ID NO: 1;
- polypeptide inhibits human Navl.7 activity.
- Protoxin-II variants having substitutions 7Q and W30L have improved folding, yield and selectivity when compared to the wild type Protoxin-II.
- Protoxi -II variant comprisi g the amino acid sequence that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the amino acid sequence of SEQ ID NO: 78 ( GPQCQKWMQTCDRERKCCEGFVCTLWCRKKLW- COOH ) ; wherein
- amino acid sequence has Q at position 1, Q at position
- the polypeptide inhibits human Navl.7 activity with an IC 50 value of about 30xl0 "9 M or less, wherein the IC 50 value is measured using a FLIPR ⁇ Tetra membrane depolarization assay using fluorescence resonance energy transfer (FRET) in the presence of 25xl0 "6 M 3-verat.royiveracevine in HEK293 cells stably expressing human Navl.7; and
- FRET fluorescence resonance energy transfer
- polypeptide selectively inhibits Navl.7.
- the isolated Protoxin-II variant has a carboxylic acid, amide, methylamide or butylamlde group at the C-terminus .
- C-terminal modifications may be generated via routine synthetic methods .
- Another embodiment of the invention disclosed herein, including in the numbered embodiments listed below is an isolated fusion protein comprising the Protoxin-II variant of SEQ ID NOs : 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118,
- Such second polypeptides may be well known leader or secretory signal sequences, or synthetic sequences resulting for example from cloning steps, or tags such as hexahistidine tag ( SEQ ID NO: 108) .
- Such second polypeptide may be a half -life extending moiety.
- the isolated fusion protein comprises the Protoxin-II variant of the invention conjugated to a half-life extending moiety.
- Exemplary half-life extending moieties that may be used include well known human serum albumin, transthyretin (TTR) , a thyroxine-binding globulin (TGB), albumin-binding domains, or an Fc or fragments thereof.
- TTR transthyretin
- TGB thyroxine-binding globulin
- Fc or fragments thereof include well known human serum albumin, transthyretin (TTR) , a thyroxine-binding globulin (TGB), albumin-binding domains, or an Fc or fragments thereof.
- Biologically suitable polymers or copolymers may also be used, for example ethylene glycol or polyethylene glycol (PEG) molecules, such as PEG5000 or PEG20000, dextran, polylysine, fatty acids and fatty acid esters of different chain lengths, for example laurate, myristate, stearate, arachidate, behenate, oleate, arachidonate, octanedioic acid, tetradecanedioic acid, octadecanedioic acid, docosanedioic acid, and the like, octane, or carbohydrates (dextran, cellulose, oligo- or polysaccharides) .
- PEG polyethylene glycol
- moieties that can improve biodistribution include polyamination (putrescine, spermine, or spermidine etc, ⁇ , halogenation (chlorine, bromine, fl orine, iodine), and glycosylation . These moieties may be direct fusions with the Protoxin-II variant polypeptides and may be generated by standard cloning and expression
- moieties can be incorporated as non-coded amino acids during solid phase peptide synthesis.
- the half- life extending moiety of the fusion protein of the invention is human serum, albumin, variants of human serum albumin, albumin binding domain (ABD) , or polyethylene glycol (PEG) .
- the half-life extending moiety of is conjugated to the Protoxin-II variant via a linker.
- Suitable linkers are well known and include linkers having the sequence shown in SEQ ID NOs : 80 or 81.
- Exemplary fusion protei s inco porating Proto i -II variants of the invention are those having the polypeptide sequence of SEQ ID NOs: 83, 85, 87, 89, 91, 93, 95, 97, 99, 101 or 103.
- incorporating additional moieties may be compared for functionality by several well-known assays.
- pharmacokinetic properties of Protoxin-II variants coupled to PEG may be evaluated in well known in vivo models .
- Protoxin-II variants and Protoxin-II variant fusion proteins are within the scope of the invention.
- Addi ional substit tions to the Protoxin-II variants of the invention can be made as long as the resulting variant or the fusion protein retains similar characteristics when compared to the parent peptide.
- Exemplary modifications are for example conservative substitutions that will result in
- Protoxin-II va iants with similar characteristics to those of the parent molecules.
- Conservative replacements are those that take place within a family of amino acids that are related in their side chains. Genetically encoded amino acids can be divided into four families: (1) acidic
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Organic Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Insects & Arthropods (AREA)
- Molecular Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Neurology (AREA)
- Immunology (AREA)
- Toxicology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Tropical Medicine & Parasitology (AREA)
- Biomedical Technology (AREA)
- Physical Education & Sports Medicine (AREA)
- Pain & Pain Management (AREA)
- Neurosurgery (AREA)
- Rheumatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020177031290A KR20170134542A (ko) | 2015-04-02 | 2016-03-31 | 프로톡신-ii 변이체 및 사용 방법 |
| BR112017020896A BR112017020896A2 (pt) | 2015-04-02 | 2016-03-31 | variantes de protoxina-ii e métodos de uso |
| ES16774187T ES2888799T3 (es) | 2015-04-02 | 2016-03-31 | Variantes de Protoxina-II y métodos de uso |
| MX2017012654A MX2017012654A (es) | 2015-04-02 | 2016-03-31 | Variantes de protoxina-ii y metodos de uso. |
| EP16774187.5A EP3277304B1 (en) | 2015-04-02 | 2016-03-31 | Protoxin-ii variants and methods of use |
| HK18109880.4A HK1250476B (en) | 2015-04-02 | 2016-03-31 | Protoxin-ii variants and methods of use |
| CA2981336A CA2981336A1 (en) | 2015-04-02 | 2016-03-31 | Protoxin-ii variants and methods of use |
| EP21189427.4A EP3960757A1 (en) | 2015-04-02 | 2016-03-31 | Protoxin-ii variants and methods of use |
| AU2016242905A AU2016242905B2 (en) | 2015-04-02 | 2016-03-31 | Protoxin-II variants and methods of use |
| CN201680020883.XA CN107921089A (zh) | 2015-04-02 | 2016-03-31 | 原毒素‑ii变体及使用方法 |
| JP2017551164A JP6985151B2 (ja) | 2015-04-02 | 2016-03-31 | プロトキシン−ii変異体及びその使用方法 |
| IL254599A IL254599B (en) | 2015-04-02 | 2017-09-19 | Variants of protoxin-ii and methods of use |
| IL282508A IL282508A (en) | 2015-04-02 | 2021-04-21 | Variants of protoxin-II and methods of use |
| JP2021153626A JP2022008474A (ja) | 2015-04-02 | 2021-09-21 | プロトキシン-ii変異体及びその使用方法 |
| AU2021266345A AU2021266345A1 (en) | 2015-04-02 | 2021-11-12 | Protoxin-II variants and methods of use |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562142069P | 2015-04-02 | 2015-04-02 | |
| US62/142,069 | 2015-04-02 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016161100A1 true WO2016161100A1 (en) | 2016-10-06 |
Family
ID=57006450
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/025247 Ceased WO2016161100A1 (en) | 2015-04-02 | 2016-03-31 | Protoxin-ii variants and methods of use |
Country Status (16)
| Country | Link |
|---|---|
| US (3) | US10463714B2 (enExample) |
| EP (2) | EP3960757A1 (enExample) |
| JP (2) | JP6985151B2 (enExample) |
| KR (1) | KR20170134542A (enExample) |
| CN (1) | CN107921089A (enExample) |
| AR (1) | AR104173A1 (enExample) |
| AU (2) | AU2016242905B2 (enExample) |
| BR (1) | BR112017020896A2 (enExample) |
| CA (1) | CA2981336A1 (enExample) |
| ES (1) | ES2888799T3 (enExample) |
| IL (2) | IL254599B (enExample) |
| MA (1) | MA41864A (enExample) |
| MX (1) | MX2017012654A (enExample) |
| TW (1) | TW201708249A (enExample) |
| UY (1) | UY36602A (enExample) |
| WO (1) | WO2016161100A1 (enExample) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9624280B2 (en) | 2013-10-03 | 2017-04-18 | Janssen Biotech, Inc. | Protoxin-II variants and methods of use |
| US10414808B2 (en) | 2012-05-18 | 2019-09-17 | Janssen Biotech, Inc. | Huwentoxin-IV variants and methods of use |
| US10463714B2 (en) | 2015-04-02 | 2019-11-05 | Janssen Biotech, Inc. | Protoxin-II variants and methods of use |
| US10995125B2 (en) | 2015-03-03 | 2021-05-04 | Janssen Biotech, Inc. | Protoxin-II variants and methods of use |
| US11104711B2 (en) | 2018-04-06 | 2021-08-31 | Eli Lilly And Company | Growth differentiation factor 15 agonist compounds and methods of using the same |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109369784B (zh) * | 2018-11-14 | 2019-08-30 | 青海芬陀利华生物科技有限公司 | PaTx-1毒素及其应用 |
| WO2021252448A1 (en) * | 2020-06-10 | 2021-12-16 | Memorial Sloan Kettering Cancer Center | Imaging compounds selective for nav1.7 |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4309989A (en) | 1976-02-09 | 1982-01-12 | The Curators Of The University Of Missouri | Topical application of medication by ultrasound with coupling agent |
| US4767402A (en) | 1986-07-08 | 1988-08-30 | Massachusetts Institute Of Technology | Ultrasound enhancement of transdermal drug delivery |
| WO1998053847A1 (en) | 1997-05-29 | 1998-12-03 | Ben Gurion University Of The Negev Research And Development Authority | Transdermal delivery system |
| US6521427B1 (en) | 1997-09-16 | 2003-02-18 | Egea Biosciences, Inc. | Method for the complete chemical synthesis and assembly of genes and genomes |
| US6670127B2 (en) | 1997-09-16 | 2003-12-30 | Egea Biosciences, Inc. | Method for assembly of a polynucleotide encoding a target polypeptide |
| US20110124711A1 (en) | 2005-11-04 | 2011-05-26 | Alnylam Pharmaceuticals, Inc. | COMPOSITIONS AND METHODS FOR INHIBITING EXPRESSION OF Nav1.8 GENE |
| US7998980B2 (en) | 2006-09-15 | 2011-08-16 | Hydra Biosciences, Inc. | Compounds for modulating TRPV3 function |
| US20130296247A1 (en) | 2010-07-07 | 2013-11-07 | Purdue Pharma L.P. | Analogs of Sodium Channel Peptide Toxin |
| US20150099705A1 (en) * | 2013-10-03 | 2015-04-09 | Janssen Biotech, Inc. | Protoxin -ii variants and methods of use |
Family Cites Families (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| HUP0001272A3 (en) | 1997-04-16 | 2012-12-28 | Unigene Lab Inc | Direct expression of peptides into culture media |
| US20030148273A1 (en) * | 2000-08-26 | 2003-08-07 | Shoulian Dong | Target enrichment and amplification |
| EP1348466A3 (en) | 2002-02-01 | 2003-10-29 | Inspire Pharmaceuticals, Inc. | Method for treating pain with adenosine-tetraphosphates |
| US7659082B2 (en) | 2002-02-19 | 2010-02-09 | Xenon Pharmaceuticals Inc. | Methods for identifying analgesic agents |
| US7833979B2 (en) | 2005-04-22 | 2010-11-16 | Amgen Inc. | Toxin peptide therapeutic agents |
| WO2007109324A2 (en) | 2006-03-21 | 2007-09-27 | Xenon Pharmaceuticals, Inc. | Potent and selective nav 1.7 sodium channel blockers |
| MX2009002504A (es) | 2006-09-08 | 2009-05-22 | Mayo Foundation | Polipeptidos acuareticos y natriureticos que carecen de actividad vasodilatadora. |
| AR063384A1 (es) | 2006-10-25 | 2009-01-28 | Amgen Inc | Agentes terapeuticos a base de peptidos derivados de toxinas |
| CN102202677A (zh) | 2008-09-03 | 2011-09-28 | 阿尔伯维塔公司 | 治疗疼痛的活性剂和方法 |
| WO2010104115A1 (ja) | 2009-03-10 | 2010-09-16 | 独立行政法人産業技術総合研究所 | 膜タンパク質を特異的に認識するポリペプチドの調製方法 |
| SG179101A1 (en) | 2009-09-15 | 2012-05-30 | Alomone Preclinical Ltd | Novel peptides isolated from spider venom, and uses thereof |
| JP5795341B2 (ja) * | 2010-03-08 | 2015-10-14 | デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド | 参照ブロック配列によるfullCOLD−PCR濃縮 |
| CN101979411A (zh) | 2010-10-21 | 2011-02-23 | 湖南师范大学 | 虎纹捕鸟蛛蛋白酶抑制剂 |
| JP2014507136A (ja) | 2011-01-18 | 2014-03-27 | アムジエン・インコーポレーテツド | NaV1.7ノックアウトマウスとそれらの使用 |
| EP2705162B1 (en) * | 2011-05-04 | 2018-07-11 | Biocept, Inc. | Methods for detecting nucleic acid sequence variants |
| US9102751B2 (en) | 2012-05-18 | 2015-08-11 | Janssen Biotech, Inc. | Huwentoxin-IV variants and methods of use |
| EP3973981A1 (en) | 2012-05-18 | 2022-03-30 | Janssen Biotech, Inc. | Huwentoxin-iv variants and methods of use |
| US10414808B2 (en) | 2012-05-18 | 2019-09-17 | Janssen Biotech, Inc. | Huwentoxin-IV variants and methods of use |
| US9718865B2 (en) | 2012-07-27 | 2017-08-01 | Purdue Pharma L.P. | Sodium channel blocking peptides and the use thereof |
| WO2014165277A2 (en) | 2013-03-12 | 2014-10-09 | Amgen Inc. | POTENT AND SELECTIVE INHIBITORS OF Nav1.7 |
| CN104065367B (zh) | 2013-03-20 | 2017-11-07 | 江苏多维科技有限公司 | 一种低功耗磁电阻开关传感器 |
| MA41642A (fr) * | 2015-03-03 | 2018-01-09 | Janssen Biotech Inc | Variants de protoxine ii et méthodes d'utilisation |
| TW201708249A (zh) | 2015-04-02 | 2017-03-01 | 健生生物科技公司 | 原毒素-ii變體及使用方法 |
-
2016
- 2016-03-31 TW TW105110361A patent/TW201708249A/zh unknown
- 2016-03-31 WO PCT/US2016/025247 patent/WO2016161100A1/en not_active Ceased
- 2016-03-31 MX MX2017012654A patent/MX2017012654A/es unknown
- 2016-03-31 ES ES16774187T patent/ES2888799T3/es active Active
- 2016-03-31 MA MA041864A patent/MA41864A/fr unknown
- 2016-03-31 JP JP2017551164A patent/JP6985151B2/ja not_active Expired - Fee Related
- 2016-03-31 EP EP21189427.4A patent/EP3960757A1/en not_active Withdrawn
- 2016-03-31 AU AU2016242905A patent/AU2016242905B2/en not_active Ceased
- 2016-03-31 CA CA2981336A patent/CA2981336A1/en not_active Abandoned
- 2016-03-31 EP EP16774187.5A patent/EP3277304B1/en active Active
- 2016-03-31 BR BR112017020896A patent/BR112017020896A2/pt not_active Application Discontinuation
- 2016-03-31 KR KR1020177031290A patent/KR20170134542A/ko not_active Withdrawn
- 2016-03-31 CN CN201680020883.XA patent/CN107921089A/zh active Pending
- 2016-04-01 AR ARP160100893A patent/AR104173A1/es not_active Application Discontinuation
- 2016-04-04 UY UY0001036602A patent/UY36602A/es unknown
- 2016-04-04 US US15/090,328 patent/US10463714B2/en not_active Expired - Fee Related
-
2017
- 2017-09-19 IL IL254599A patent/IL254599B/en active IP Right Grant
-
2019
- 2019-11-04 US US16/673,750 patent/US11083776B2/en not_active Expired - Fee Related
-
2021
- 2021-04-21 IL IL282508A patent/IL282508A/en unknown
- 2021-08-09 US US17/397,586 patent/US20220054590A1/en not_active Abandoned
- 2021-09-21 JP JP2021153626A patent/JP2022008474A/ja not_active Withdrawn
- 2021-11-12 AU AU2021266345A patent/AU2021266345A1/en not_active Abandoned
Patent Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4309989A (en) | 1976-02-09 | 1982-01-12 | The Curators Of The University Of Missouri | Topical application of medication by ultrasound with coupling agent |
| US4767402A (en) | 1986-07-08 | 1988-08-30 | Massachusetts Institute Of Technology | Ultrasound enhancement of transdermal drug delivery |
| WO1998053847A1 (en) | 1997-05-29 | 1998-12-03 | Ben Gurion University Of The Negev Research And Development Authority | Transdermal delivery system |
| US6521427B1 (en) | 1997-09-16 | 2003-02-18 | Egea Biosciences, Inc. | Method for the complete chemical synthesis and assembly of genes and genomes |
| US6670127B2 (en) | 1997-09-16 | 2003-12-30 | Egea Biosciences, Inc. | Method for assembly of a polynucleotide encoding a target polypeptide |
| US20110124711A1 (en) | 2005-11-04 | 2011-05-26 | Alnylam Pharmaceuticals, Inc. | COMPOSITIONS AND METHODS FOR INHIBITING EXPRESSION OF Nav1.8 GENE |
| US7998980B2 (en) | 2006-09-15 | 2011-08-16 | Hydra Biosciences, Inc. | Compounds for modulating TRPV3 function |
| US20130296247A1 (en) | 2010-07-07 | 2013-11-07 | Purdue Pharma L.P. | Analogs of Sodium Channel Peptide Toxin |
| US20150099705A1 (en) * | 2013-10-03 | 2015-04-09 | Janssen Biotech, Inc. | Protoxin -ii variants and methods of use |
Non-Patent Citations (17)
| Title |
|---|
| "Biochemistry", 1981, WH FREEMAN AND CO. |
| "Remington: The Science and Practice of Pharmacy", 2005, LIPPINCOTT WILLIAMS & WILKINS |
| "Remington's Pharmaceutical Science", MACK PUBLISHING COMPANY |
| BOSMANS ET AL., MOL PHARMACOL, vol. 69, 2006, pages 419 - 29 |
| CANNONBEAN, J CLIN INVEST, vol. 120, 2010, pages 80 - 3 |
| CREGG ET AL., J PHYSIOL, vol. 588, 2010, pages 1897 - 904 |
| HUBNERJENTSCH, HUM MOL GENET, vol. 11, 2002, pages 2435 - 45 |
| MIDDLETON ET AL., BIOCHEMISTRY, vol. 41, 2002, pages 14734 - 47 |
| MINETT ET AL., NAT COMMUN, vol. 3, 2012, pages 791 |
| MUROI ET AL., AM J PHYSIOL REGUL INTEGR COMP PHYSIOL., 10 April 2013 (2013-04-10) |
| MUROI ET AL., J PHYSIOL., vol. 589, no. 23, 1 December 2011 (2011-12-01), pages 5663 - 76 |
| NASSAR ET AL., PROC NATL ACAD SCI USA, vol. 101, 2004, pages 12706 - 11 |
| PENG ET AL., J BIOL CHEM, vol. 277, 2002, pages 47564 - 71 |
| SCHMALHOFER ET AL.: "ProTx-II, a selective inhibitor of NaV1.7 sodium channels, blocks action potential propagation in nociceptors.", MOL PHARACOL, vol. 74, no. 5, November 2008 (2008-11-01), pages 1476 - 1484, XP009120036 * |
| TFELT-HANSEN ET AL., J CARDIOVASC ELECTROPHYSIOL, vol. 21, 2010, pages 107 - 15 |
| VARGAS-ALARCON ET AL., BMC MUSCULOSKELET DISORD, vol. 13, 2012, pages 23 |
| YOGEESWARI ET AL., CURR DRUG TARGETS, vol. 5, 2004, pages 589 - 602 |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10414808B2 (en) | 2012-05-18 | 2019-09-17 | Janssen Biotech, Inc. | Huwentoxin-IV variants and methods of use |
| US9624280B2 (en) | 2013-10-03 | 2017-04-18 | Janssen Biotech, Inc. | Protoxin-II variants and methods of use |
| US10975129B2 (en) | 2013-10-03 | 2021-04-13 | Janssen Biotech, Inc. | Protoxin-II variants and methods of use |
| US10995125B2 (en) | 2015-03-03 | 2021-05-04 | Janssen Biotech, Inc. | Protoxin-II variants and methods of use |
| US10463714B2 (en) | 2015-04-02 | 2019-11-05 | Janssen Biotech, Inc. | Protoxin-II variants and methods of use |
| US11083776B2 (en) | 2015-04-02 | 2021-08-10 | Janssen Biotech, Inc. | Protoxin-II variants and methods of use |
| US11104711B2 (en) | 2018-04-06 | 2021-08-31 | Eli Lilly And Company | Growth differentiation factor 15 agonist compounds and methods of using the same |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2016242905A1 (en) | 2017-10-12 |
| JP2018511326A (ja) | 2018-04-26 |
| AU2016242905B2 (en) | 2021-08-12 |
| TW201708249A (zh) | 2017-03-01 |
| KR20170134542A (ko) | 2017-12-06 |
| US20220054590A1 (en) | 2022-02-24 |
| CN107921089A (zh) | 2018-04-17 |
| AU2021266345A1 (en) | 2021-12-09 |
| AR104173A1 (es) | 2017-07-05 |
| EP3960757A1 (en) | 2022-03-02 |
| MA41864A (fr) | 2021-03-24 |
| IL254599B (en) | 2021-05-31 |
| EP3277304A1 (en) | 2018-02-07 |
| EP3277304A4 (en) | 2018-12-19 |
| US10463714B2 (en) | 2019-11-05 |
| HK1250476A1 (en) | 2018-12-21 |
| UY36602A (es) | 2016-09-30 |
| JP2022008474A (ja) | 2022-01-13 |
| JP6985151B2 (ja) | 2021-12-22 |
| BR112017020896A2 (pt) | 2018-07-10 |
| IL254599A0 (en) | 2017-11-30 |
| MX2017012654A (es) | 2018-01-09 |
| CA2981336A1 (en) | 2016-10-06 |
| US20200054712A1 (en) | 2020-02-20 |
| EP3277304B1 (en) | 2021-08-04 |
| IL282508A (en) | 2021-06-30 |
| ES2888799T3 (es) | 2022-01-07 |
| US20160287666A1 (en) | 2016-10-06 |
| US11083776B2 (en) | 2021-08-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10975129B2 (en) | Protoxin-II variants and methods of use | |
| US11083776B2 (en) | Protoxin-II variants and methods of use | |
| US20210363204A1 (en) | Protoxin-ii variants and methods of use | |
| HK1250476B (en) | Protoxin-ii variants and methods of use | |
| HK1226746A1 (en) | Protoxin-ii variants and methods of use | |
| HK1226746B (en) | Protoxin-ii variants and methods of use | |
| HK1224307B (zh) | 原毒素-ii变体及其使用方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16774187 Country of ref document: EP Kind code of ref document: A1 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 254599 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2981336 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2017551164 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/012654 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017020896 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2016242905 Country of ref document: AU Date of ref document: 20160331 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20177031290 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112017020896 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170928 |