WO2016120810A1 - Anti-transthyretin antibodies - Google Patents
Anti-transthyretin antibodies Download PDFInfo
- Publication number
- WO2016120810A1 WO2016120810A1 PCT/IB2016/050415 IB2016050415W WO2016120810A1 WO 2016120810 A1 WO2016120810 A1 WO 2016120810A1 IB 2016050415 W IB2016050415 W IB 2016050415W WO 2016120810 A1 WO2016120810 A1 WO 2016120810A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- ttr
- chain variable
- humanized
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/24—Antidepressants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the antibodies are a humanized or chimeric 9D5 or 14G8 antibody that specifically binds to transthyretin, wherein 9D5 is a mouse antibody characterized by a mature heavy chain variable region of SEQ ID NO: 1 and a mature light chain variable region of SEQ ID NO: 16, and 14G8 is a mouse antibody characterized by a mature heavy chain variable region of SEQ ID NO: 61 and a mature light chain variable region of SEQ ID NO: 70.
- 9D5 is a mouse antibody characterized by a mature heavy chain variable region of SEQ ID NO: 1 and a mature light chain variable region of SEQ ID NO: 16
- 14G8 is a mouse antibody characterized by a mature heavy chain variable region of SEQ ID NO: 61 and a mature light chain variable region of SEQ ID NO: 70.
- positions L8, L9, LI 8, L19, L36, L39, L60, L70, and L74 are occupied by A, P, S, V, F, R, S, A, and R, respectively.
- positions HI and H47 are occupied by E and L, respectively.
- position L36 is occupied by F.
- at least one of the following positions is occupied by the amino acid as specified: position H3 is occupied by K, position H105 is occupied by T, position L8 is occupied by A, position L9 is occupied by P, position L19 is occupied by V, position L26 is occupied by S, position L60 is occupied by S, and position L70 is occupied by A.
- positions H3 and HI 05 are occupied by K and T, respectively.
- positions L8, L9, L19, and L70 are occupied by A, P, V, and A, respectively.
- the invention further provides nucleic acids encoding the heavy chain and/or light chain of any of the above antibodies, such as any one of SEQ ID NOS: 40, 42, 44-56, 87, 89, 91- 96, and 106-108.
- the invention further provides a method of inhibiting or reducing aggregation of transthyretin in a subject having or at risk of developing a transthyretin- mediated amyloidosis, comprising administering to the subject an effective regime of any of the above antibodies, thereby inhibiting or reducing aggregation of transthyretin in the subject.
- the invention further provides a method of inhibiting or reducing transthyretin fibril formation in a subject having or at risk of developing a transthyretin-mediated amyloidosis, comprising administering to the subject an effective regime of any of the above antibodies, thereby inhibiting or reducing transthyretin accumulation in the subject.
- SEQ ID NO: 7 sets forth the amino acid sequence of the heavy chain variable region of the humanized 9D5 antibody version 2b (Hu9D5VHv2b).
- SEQ ID NO: 24 sets forth the amino acid sequence of Kabat CDR-Ll of the mouse 9D5 antibody.
- SEQ ID NO: 44 sets forth the nucleic acid sequence of the heavy chain variable region of the humanized 9D5 antibody version 1 (Hu9D5VHvl).
- SEQ ID NO: 47 sets forth the nucleic acid sequence of the heavy chain variable region of the humanized 9D5 antibody version 3 (Hu9D5VHv3).
- SEQ ID NO: 70 sets forth the amino acid sequence of the light chain variable region of the mouse 14G8 antibody.
- SEQ ID NO: 82 sets forth the amino acid sequence of humanized 14G8 heavy chain version 2.
- SEQ ID NO: 84 sets forth the amino acid sequence of humanized 14G8 light chain version 1.
- SEQ ID NO: 96 sets forth the nucleic acid sequence of the light chain variable region of the humanized 14G8 antibody version 3 (Hul4G8VLv3).
- SEQ ID NO: 114 sets forth the amino acid sequence of a potential transthyretin immunogen.
- the two different heavy/light chain pairs include a humanized 9D5 heavy chain/light chain pair and a heavy chain/light chain pair specific for a different epitope on transthyretin than that bound by 9D5.
- the two different heavy/light chain pairs include a humanized 14G8 heavy chain/light chain pair and a heavy chain/light chain pair specific for a different epitope on transthyretin than that bound by 14G8.
- [00171 ] Competition between antibodies is determined by an assay in which an antibody under test inhibits specific binding of a reference antibody to a common antigen (see, e.g., Junghans et al., Cancer Res. 50: 1495, 1990).
- a test antibody competes with a reference antibody if an excess of a test antibody (e.g., at least 2x, 5x, lOx, 20x or lOOx) inhibits binding of the reference antibody by at least 50% as measured in a competitive binding assay.
- Some test antibodies inhibit binding of the references antibody by at least 75%, 90% or 99%.
- Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibody and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur.
- pharmaceutically acceptable means that the carrier, diluent, excipient, or auxiliary is compatible with the other ingredients of the formulation and not substantially deleterious to the recipient thereof.
- biological sample refers to a sample of biological material within or obtainable from a biological source, for example a human or mammalian subject. Such samples can be organs, organelles, tissues, sections of tissues, bodily fluids, peripheral blood, blood plasma, blood serum, cells, molecules such as proteins and peptides, and any parts or
- a humanized antibody comprises a humanized heavy chain and a humanized light chain.
- a CDR in a humanized antibody is substantially from a corresponding CDR in a non- human antibody when at least 85%, 90%, 95% or 100% of corresponding residues (as defined by any conventional definition but preferably defined by Kabat) are identical between the respective CDRs.
- the variable region framework sequences of an antibody chain or the constant region of an antibody chain are substantially from a human variable region framework sequence or human constant region respectively when at least 85%, 90%, 95% or 100% of corresponding residues defined by any conventional definition but preferably defined by Kabat are identical.
- the human acceptor antibody sequences can optionally be selected from among the many known human antibody sequences to provide a high degree of sequence identity (e.g., 65- 85% identity) between a human acceptor sequence variable region frameworks and corresponding variable region frameworks of a donor antibody chain.
- positions in which these two acceptors differ include positions H82a (N or S), H83 (R or K), H84 (A or S), and H89 (V or M).
- Humanized versions of the 14G8 heavy chain variable region can include either amino acid at any of these positions.
- framework residues that are candidates for substitution are residues creating a potential glycosylation site. Still other candidates for substitution are acceptor human framework amino acids that are unusual for a human immunoglobulin at that position. These amino acids can be substituted with amino acids from the equivalent position of the mouse donor antibody or from the equivalent positions of more typical human immunoglobulins.
- Exemplified Hu9D5 antibodies include any permutations or combinations of the exemplified mature heavy and light chain variable regions (e.g., VHvl/VLvl or H1L1 ,
- positions H82 and H82b in the Vh region are occupied by S and L, respectively, as in Hu9D5VHv4.
- positions H42, H47, and H82b in the Vh region are occupied by E, L, and L, respectively, as in Hu9D5VHv5.
- at least one of positions L8, L9, LI 8, L19, L36, L39, L60, L70, and L74 in the Vk region is occupied by A, P, S, V, F, R, S, A, and R, respectively.
- position L36 in the Vk region is occupied by F, as in
- Hu9D5VLv3 positions L8, L9, L19, L36, L39, L60, L70, and L74 in the Vk region are occupied by A, P, V, F, R, S, A, and R, respectively, as in Hu9D5VLv4.
- positions L8, L9, L18, L19, L36, L39, L60, L70, and L74 in the Vk region are occupied by A, P, S, V, F, R, S, A, and R, respectively, as in Hu9D5VLv5.
- the CDR regions of such humanized antibodies can be identical or substantially identical to the CDR regions of the 9D5 mouse donor antibody or any of the above exemplified humanized 9D5 antibodies.
- the CDR regions can be defined by any conventional definition (e.g., Chothia, or composite of Chothia and Kabat) but are preferably as defined by Kabat.
- Variable regions framework positions are in accordance with Kabat numbering unless otherwise stated. Other such variants typically differ from the sequences of the exemplified Hu9D5 heavy and light chains by a small number (e.g., typically no more than 1 , 2, 3, 5, 10, or 15) of replacements, deletions or insertions. Such differences are usually in the framework but can also occur in the CDRs.
- Coding sequences of nucleic acids can be operably linked with regulatory sequences to ensure expression of the coding sequences, such as a promoter, enhancer, ribosome binding site, transcription termination signal, and the like.
- the nucleic acids encoding heavy and light chains can occur in isolated form or can be cloned into one or more vectors.
- the nucleic acids can be synthesized by, for example, solid state synthesis or PCR of overlapping oligonucleotides.
- immunomodulator can be any agent that stimulates or inhibits the development or maintenance of an immunologic response. If such therapeutic moieties are coupled to an antibody specific for monomeric, misfolded, aggregated, or fibril forms of TTR, such as the antibodies described herein, the coupled therapeutic moieties will have a specific affinity for non-native, pathogenic forms of TTR over native tetrameric forms of TTR. Consequently, administration of the conjugated antibodies directly targets tissues comprising pathogenic forms of TTR with minimal damage to surrounding normal, healthy tissue. This can be particularly useful for therapeutic moieties that are too toxic to be administered on their own. In addition, smaller quantities of the therapeutic moieties can be used.
- the antibodies disclosed herein can also be coupled or conjugated to one or more other antibodies (e.g., to form antibody heteroconjugates). Such other antibodies can bind to different epitopes within TTR or a portion thereof or can bind to a different target antigen.
- Linkage of radioisotopes to antibodies may be performed with conventional bifunction chelates.
- sulfur-based linkers may be used for radiosilver- 111 and radiosilver-199 linkage. See Hazra et al., Cell Biophys. 24-25: 1-7 (1994).
- Linkage of silver radioisotopes may involve reducing the immunoglobulin with ascorbic acid.
- Therapeutic moieties, other proteins, other antibodies, and/or detectable labels may be coupled or conjugated, directly or indirectly through an intermediate (e.g., a linker), to an antibody of the invention.
- an intermediate e.g., a linker
- Therapeutic moieties, other proteins, other antibodies, and/or detectable labels may be coupled or conjugated, directly or indirectly through an intermediate (e.g., a linker), to an antibody of the invention.
- the frequency of administration depends on the half- life of the antibody in the circulation, the condition of the patient and the route of administration among other factors.
- the frequency can be daily, weekly, monthly, quarterly, or at irregular intervals in response to changes in the patient's condition or progression of the disorder being treated.
- An exemplary frequency for intravenous administration is between weekly and quarterly over a continuous cause of treatment, although more or less frequent dosing is also possible.
- an exemplary dosing frequency is daily to monthly, although more or less frequent dosing is also possible.
- the identification of the subject can occur in a clinical setting, or elsewhere, such as in the subject's home, for example, through the subject's own use of a self-testing kit.
- the subject can be identified based on various symptoms such as peripheral neuropathy (sensory and motor), autonomic neuropathy, gastrointestinal impairment, cardiomyopathy, nephropathy, or ocular deposition. See Ando et al., Orphanet Journal of Rare Diseases 8:31 (2013).
- the subject can also be identified by increased levels of non-native forms of TTR in plasma samples from the subject compared to control samples, as disclosed in the examples.
- TTR fibril formation in a subject having or at risk of a condition associated with TTR accumulation; reducing or clearing TTR deposits or aggregated TTR in a subject having or at risk of a condition associated with TTR accumulation; stabilizing non-toxic conformations of TTR in a subject having or at risk of a condition associated with TTR accumulation; inhibiting toxic effects of TTR aggregates, fibrils or deposits in a subject having or at risk of a condition associated with TTR accumulation; diagnosing the presence or absence of TTR amyloid accumulation in a tissue suspected of comprising the amyloid accumulation; determining a level of TTR deposits in a subject by detecting the presence of bound antibody in the subject following administration of the antibody; detecting the presence of monomeric, misfolded, aggregated, or fibril forms of TTR in a subject; monitoring and evaluating the efficacy of therapeutic agents being used to treat patients diagnosed with a TTR amyloidosis; inducing an immune response comprising antibodies to TTR in a subject; delaying the
- Diagnosis is performed by comparing the number, size, and/or intensity of labeled loci to corresponding base line values.
- the base line values can represent the mean levels in a population of undiseased individuals. Base line values can also represent previous levels determined in the same subject. For example, base line values can be determined in a subject before beginning treatment, and measured values thereafter compared with the base line values. A decrease in values relative to base line generally signals a positive response to treatment.
- the antibodies can be used for detecting monomeric, misfolded, aggregated, or fibril forms of transthyretin (TTR), or fragments thereof, in the context of clinical diagnosis or treatment or in research.
- TTR transthyretin
- the antibodies can be used to detect the presence of monomeric, misfolded, aggregated, or fibril forms of TTR in a biological sample as an indication that the biological sample comprises TTR amyloid deposits.
- Binding of the antibodies to the biological sample can be compared to binding of the antibodies to a control sample.
- the control sample and the biological sample can comprise cells of the same tissue origin. Control samples and biological samples can be obtained from the same individual or different individuals and on the same occasion or on different occasions.
- vernier/CDR foundation residues include residues 4, 35, 46, 49, 66, 68, and 69 by Kabat numbering in Table 8.
- K74R R appears to stabilize the loop compared to K at this position, so
- H84 (A or S): S and A are present in the two frameworks considered, so each residue was tried in separate versions.
- H89 (V or M) V and M are present in the two frameworks considered, so each was tried in separate versions.
- Hu9D5VL version 4 (P8A, L9P, A19V, Y36F, K39R, D60S, D70A, and K74R substitutions in lowercase):
- Table 12 summarizes the Biacore association rate (k a ), dissociation rate (kd), and binding affinity constant (K D ) of the murine, chimeric, and humanized 9D5 variants for recombinant human TTR F87M/L110M.
- Examples of canonical/CDR interacting residues include residues 2, 48, 64, and 71 by Kabat numbering in Table 14.
- Examples of interface/packing (VH+VL) residues include residues 36, 38, 44, 47, 87, and 98 by Kabat numbering in Table 14.
- D70A D is much more frequent than A in human IgG frameworks. However, D will form ionic bond with R24 in light chain CDR1, so both A and D were included in separate versions.
- Hul4G8VL version 1 (P8A, L9P, A19V, Y36F, D70A substitutions in lowercase):
- Hul4G8VH version 3 (Q1E and W47L substitutions in lowercase): e VQLVES GGGLVQPGGS LKLS C A AS GFTFS S YTMS WVRQTPEKRLE1V AEINNS GDTT Y Y PDTVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARHYYYGGGYGGWFFDVWGQ GTLVTVSS (SEQ ID NO: 66)
- Table 18 summarizes the association rate (k a ), dissociation rate (kd), and binding affinity constant (KD) of the mouse 14G8, chimeric- 14G8, Hul4G8 H2L1, Hul4G8 H2L2, Hul4G8H2L3, and Hul4G8 H3L1 for recombinant human TTR F87M/L110M.
- KD binding affinity constant
- Hybridoma selection was based on the following ELISA screen: 96-well ELISA plates were coated with chicken anti-His, 1 ⁇ g/mL PBS and incubated for 1 hour. Plates were blocked with of 1% BS A/PBS solution, 200 uL/well for 15 minutes then 0.5 ⁇ g/mL pH4-TTR, 50 lL/we ⁇ was added and incubated for 1 hour. pH4-TTR is TTR that has been subjected to low pH (50 mM sodium acetate, pH 4.0) in order to dissociate/aggregate TTR, exposing the TTR89- 97 epitope. Plates were washed twice with TBS-T.
- E. coli (BL21-A1) cells were transformed with a pET21a(+) plasmid containing a TTR insert (Met-hTTR-(His)e or a TTR variant containing an F87M/L110M double mutation. Cells were grown in 2YT broth containing 100 g/ml ampicillin. Expression of TTR was induced overnight at 20°C in the presence of ImM IPTG and 005% arabinose.
- Immunohistochemistry was performed on lightly paraformaldheyde-fixed, 10 ⁇ slide-mounted cryosections and on 5 ⁇ paraffin sections.
- the immunoperoxidase method was the principal detection system, which was performed on the Leica Bond Rx (Leica Biosystems, Buffalo Grove, IL) using the Bond Polymer Refine Detection Kit (DS980, Leica Biosystems).
- the primary antibodies were incubated for one hour (according to concentrations in Table 2) followed by incubation with anti-mouse and anti-rabbit polymeric HRP-linker antibody conjugates.
- the staining was visualized with a DAB chromogen, which produced a brown deposit.
- THP-1 human monocytes were cultured in cell culture media (RMPI, 10% low IgG serum, pen/strep). A 20 ⁇ g/mL aliquot of pHrodo-labeled TTR was separately pre-incubated with 40 ⁇ g/mL antibody at 37°C in cell culture media for 30 min prior to the addition of 5E+04 THP-1 cells in a 1 : 1 volumetric ratio. After tissue culture incubation (3 h), cells were washed with cell culture media three times, incubated in media for 10 min, then washed twice with and resuspended in FACS buffer (1% FBS in PBS). Red pHrodo fluorescence intensity was detected using Texas Red channel filters.
- RMPI 10% low IgG serum, pen/strep
- TTR-F87M/L110M was covalently labeled with the pH-sensitive fluorescent dye pHrodo.
- the pHrodo tag has minimal fluorescence under physiological pH, but fluorescence is enhanced upon engulfment into the low pH environments of endocytic vesicles and thus marks cellular uptake of tagged particles.
- THP-1 monocytes were added to pHrodo-tagged TTR (native or non-native, TTR-F87M/L110M) after treatment with either 14G8 or the isotype control antibody. Low levels of fluorescence were observed with either antibody incubated with native TTR, and after incubation of the control antibody with non-native TTR.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Biomedical Technology (AREA)
- General Chemical & Material Sciences (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Psychiatry (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Pain & Pain Management (AREA)
- Hospice & Palliative Care (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (29)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| HRP20221538TT HRP20221538T1 (hr) | 2015-01-28 | 2016-01-28 | Anti-transtiretinska antitijela |
| BR112017016330-6A BR112017016330B1 (pt) | 2015-01-28 | 2016-01-28 | Anticorpo humanizado, composição farmacêutica, ácido nucleico e uso de um regime e de uma quantidade eficaz do anticorpo humanizado |
| EA201791712A EA036080B1 (ru) | 2015-01-28 | 2016-01-28 | Антитела к транстиретину |
| DK16702812.5T DK3250592T3 (en) | 2015-01-28 | 2016-01-28 | Anti-transthyretin-antistoffer |
| KR1020177023749A KR102598180B1 (ko) | 2015-01-28 | 2016-01-28 | 항-트랜스타이레틴 항체 |
| PL16702812.5T PL3250592T3 (pl) | 2015-01-28 | 2016-01-28 | Przeciwciała przeciwko transtyretynie |
| AU2016210888A AU2016210888C1 (en) | 2015-01-28 | 2016-01-28 | Anti-transthyretin antibodies |
| IL284022A IL284022B2 (en) | 2015-12-11 | 2016-01-28 | Anti-transthyretin antibodies |
| CN201680010882.7A CN107406499B (zh) | 2015-01-28 | 2016-01-28 | 抗甲状腺素运载蛋白抗体 |
| EP22195219.5A EP4134379A1 (en) | 2015-01-28 | 2016-01-28 | Anti-transthyretin antibodies |
| SG11201706124VA SG11201706124VA (en) | 2015-01-28 | 2016-01-28 | Anti-transthyretin antibodies |
| CA2974912A CA2974912A1 (en) | 2015-01-28 | 2016-01-28 | Anti-transthyretin antibodies |
| CU2017000097A CU24480B1 (es) | 2015-01-28 | 2016-01-28 | Anticuerpos anti-transtiretina |
| LTEPPCT/IB2016/050415T LT3250592T (lt) | 2015-01-28 | 2016-01-28 | Antikūnai prieš transtiretiną |
| EP16702812.5A EP3250592B1 (en) | 2015-01-28 | 2016-01-28 | Anti-transthyretin antibodies |
| RS20221170A RS63906B1 (sr) | 2015-01-28 | 2016-01-28 | Anti-transtiretin antitela |
| MX2017009806A MX394170B (es) | 2015-01-28 | 2016-01-28 | Anticuerpos anti-transtiretina |
| SI201631652T SI3250592T1 (sl) | 2015-01-28 | 2016-01-28 | Anti-transtiretin protitelesa |
| MYPI2017702751A MY193688A (en) | 2015-01-28 | 2016-01-28 | Anti-transthyretin antibodies |
| NZ733896A NZ733896B2 (en) | 2016-01-28 | Anti-transthyretin antibodies | |
| KR1020237037602A KR102677203B1 (ko) | 2015-01-28 | 2016-01-28 | 항-트랜스타이레틴 항체 |
| UAA201708667A UA122142C2 (uk) | 2015-01-28 | 2016-01-28 | Антитіло до транстиретину |
| ES16702812T ES2934656T3 (es) | 2015-01-28 | 2016-01-28 | Anticuerpos antitranstiretina |
| JP2017539650A JP6748086B2 (ja) | 2015-01-28 | 2016-01-28 | 抗トランスサイレチン抗体 |
| FIEP16702812.5T FI3250592T3 (fi) | 2015-01-28 | 2016-01-28 | Transtyretiinin vastaisia vasta-aineita |
| PH12017501318A PH12017501318A1 (en) | 2015-01-28 | 2017-07-20 | Anti-transthyretin antibodies |
| IL253633A IL253633B (en) | 2015-01-28 | 2017-07-24 | Anti-transthyretin antibodies |
| ZA2017/05663A ZA201705663B (en) | 2015-01-28 | 2017-08-21 | Anti-transthyretin antibodies |
| CONC2017/0008476A CO2017008476A2 (es) | 2015-01-28 | 2017-08-22 | Anticuerpos anti-transtiretina |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562109002P | 2015-01-28 | 2015-01-28 | |
| US62/109,002 | 2015-01-28 | ||
| US201562266556P | 2015-12-11 | 2015-12-11 | |
| US62/266,556 | 2015-12-11 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016120810A1 true WO2016120810A1 (en) | 2016-08-04 |
Family
ID=55299694
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2016/050415 Ceased WO2016120810A1 (en) | 2015-01-28 | 2016-01-28 | Anti-transthyretin antibodies |
Country Status (31)
| Country | Link |
|---|---|
| US (1) | US20160251418A1 (https=) |
| EP (2) | EP4134379A1 (https=) |
| JP (2) | JP6748086B2 (https=) |
| KR (2) | KR102598180B1 (https=) |
| CN (1) | CN107406499B (https=) |
| AU (1) | AU2016210888C1 (https=) |
| CA (1) | CA2974912A1 (https=) |
| CL (2) | CL2017001924A1 (https=) |
| CO (1) | CO2017008476A2 (https=) |
| CU (1) | CU24480B1 (https=) |
| DK (1) | DK3250592T3 (https=) |
| EA (1) | EA036080B1 (https=) |
| ES (1) | ES2934656T3 (https=) |
| FI (1) | FI3250592T3 (https=) |
| HR (1) | HRP20221538T1 (https=) |
| HU (1) | HUE060878T2 (https=) |
| IL (1) | IL253633B (https=) |
| LT (1) | LT3250592T (https=) |
| MX (1) | MX394170B (https=) |
| PE (1) | PE20180217A1 (https=) |
| PH (1) | PH12017501318A1 (https=) |
| PL (1) | PL3250592T3 (https=) |
| PT (1) | PT3250592T (https=) |
| RS (1) | RS63906B1 (https=) |
| SA (1) | SA517382002B1 (https=) |
| SG (2) | SG10202101763VA (https=) |
| SI (1) | SI3250592T1 (https=) |
| TW (2) | TWI786505B (https=) |
| UA (1) | UA122142C2 (https=) |
| WO (1) | WO2016120810A1 (https=) |
| ZA (1) | ZA201705663B (https=) |
Cited By (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9879080B2 (en) | 2015-01-28 | 2018-01-30 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| WO2018007922A3 (en) * | 2016-07-02 | 2018-02-15 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| WO2019071206A1 (en) | 2017-10-06 | 2019-04-11 | Prothena Biosciences Limited | METHODS OF DETECTING TRANSTHYRETIN |
| WO2019108689A1 (en) | 2017-11-29 | 2019-06-06 | Prothena Biosciences Limited | Lyophilized formulation of a monoclonal antibody against transthyretin |
| US10464999B2 (en) | 2015-01-28 | 2019-11-05 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US10633433B2 (en) | 2015-01-28 | 2020-04-28 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| WO2020094883A1 (en) | 2018-11-09 | 2020-05-14 | Neurimmune Ag | Patient-derived amyloid xenograft non-human animal model |
| WO2021185961A1 (en) | 2020-03-18 | 2021-09-23 | Al-S Pharma Ag | Misfolded sod1 assay |
| WO2021228987A1 (en) | 2020-05-12 | 2021-11-18 | Neurimmune Ag | Combination therapy for ttr amyloidosis |
| US11267877B2 (en) | 2017-10-06 | 2022-03-08 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| WO2023099788A1 (en) | 2021-12-03 | 2023-06-08 | Neurimmune Ag | Novel potency assay for antibody-based drugs and useful means therefor |
| WO2024105062A1 (en) | 2022-11-15 | 2024-05-23 | Neurimmune Ag | Methods for treating or preventing transthyretin-mediated amyloidosis |
| WO2024197157A1 (en) * | 2023-03-21 | 2024-09-26 | Biograph 55, Inc. | Cd19/cd38 multispecific antibodies |
| EP4237005A4 (en) * | 2020-10-28 | 2024-10-09 | Novo Nordisk A/S | ANTI-TRANSTHYRETIN ANTIBODIES AND METHODS OF USE THEREOF |
| WO2024240562A1 (en) | 2023-05-19 | 2024-11-28 | Neurimmune Ag | Novel immunotherapy for musculoskeletal disorders and conditions |
| WO2025104243A1 (en) | 2023-11-15 | 2025-05-22 | Neurimmune Ag | Anti-transthyretin antibody, compositions comprising said antibody and methods for treating or preventing transthyretin-mediated amyloidosis |
| WO2025125544A1 (en) | 2023-12-15 | 2025-06-19 | Novo Nordisk A/S | Stable liquid formulations |
| WO2025238147A1 (en) | 2024-05-15 | 2025-11-20 | Neurimmune Ag | Maintenance treatment of cardiac ttr amyloidosis using anti-transthyretin antibodies |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021231982A1 (en) * | 2020-05-14 | 2021-11-18 | City Of Hope | Smc1a antibodies and uses thereof |
| CN113845593B (zh) * | 2021-10-27 | 2023-03-10 | 福州迈新生物技术开发有限公司 | 抗α-SMA蛋白单克隆抗体、细胞系及其应用 |
| US20250019425A1 (en) * | 2021-11-12 | 2025-01-16 | Adrx, Inc. | Transthyretin (ttr) monomer binding antibodies |
| AU2023364181A1 (en) * | 2022-10-19 | 2025-04-03 | Ibio, Inc. | Chemokine receptor 8 (ccr8) antibodies |
Citations (52)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4634666A (en) | 1984-01-06 | 1987-01-06 | The Board Of Trustees Of The Leland Stanford Junior University | Human-murine hybridoma fusion partner |
| US4634664A (en) | 1982-01-22 | 1987-01-06 | Sandoz Ltd. | Process for the production of human mono-clonal antibodies |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5304489A (en) | 1987-02-17 | 1994-04-19 | Genpharm International, Inc. | DNA sequences to target proteins to the mammary gland for efficient secretion |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5741957A (en) | 1989-12-01 | 1998-04-21 | Pharming B.V. | Transgenic bovine |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5786464A (en) | 1994-09-19 | 1998-07-28 | The General Hospital Corporation | Overexpression of mammalian and viral proteins |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5834597A (en) | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
| US5837242A (en) | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5849992A (en) | 1993-12-20 | 1998-12-15 | Genzyme Transgenics Corporation | Transgenic production of antibodies in milk |
| US5858657A (en) | 1992-05-15 | 1999-01-12 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| US5871907A (en) | 1991-05-15 | 1999-02-16 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5877218A (en) | 1994-01-10 | 1999-03-02 | Teva Pharmaceutical Industries, Ltd. | Compositions containing and methods of using 1-aminoindan and derivatives thereof and process for preparing optically active 1-aminoindan derivatives |
| US5888809A (en) | 1997-05-01 | 1999-03-30 | Icos Corporation | Hamster EF-1α transcriptional regulatory DNA |
| US6063598A (en) | 1995-10-24 | 2000-05-16 | Dr. Karl Thomae Gmbh | Strong homologous promoter obtained from hamsters |
| US6114148A (en) | 1996-09-20 | 2000-09-05 | The General Hospital Corporation | High level expression of proteins |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| WO2003057838A2 (en) | 2001-12-28 | 2003-07-17 | Abgenix, Inc. | Antibodies against the muc18 antigen |
| US6624821B1 (en) | 1999-02-05 | 2003-09-23 | Samsung Electronics Co., Ltd. | Image texture retrieving method and apparatus thereof |
| WO2004050884A2 (de) | 2002-11-29 | 2004-06-17 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Neue neomycin-phosphotransferase-gene und verfahren zur selektion von hochproduzierenden rekombinanten zellen |
| US20050009150A1 (en) | 1998-11-30 | 2005-01-13 | Elan Pharmaceuticals, Inc. | Humanized antibodies that recognize beta amyloid peptide |
| WO2005019442A2 (de) | 2003-08-19 | 2005-03-03 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Verfahren zur reklonierung von produktionszellen |
| US6881557B2 (en) | 2001-07-12 | 2005-04-19 | Arrowsmith Technologies Llp | Super humanized antibodies |
| WO2008012142A1 (de) | 2006-07-26 | 2008-01-31 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Regulatorische nukleinsäureelemente |
| WO2008107388A1 (en) | 2007-03-02 | 2008-09-12 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Improvement of protein production |
| WO2009027471A1 (de) | 2007-08-29 | 2009-03-05 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Verfahren zur steigerung von proteintitern |
| US7569339B2 (en) | 2004-11-10 | 2009-08-04 | Boehringer Ingelheim Pharma Gmbh & Co., Kg | Use of flow-cytrometric analysis to optimize cell banking strategies for CHO cells |
| US20110008255A1 (en) | 2006-04-21 | 2011-01-13 | The Department Of Health And Human Services | Beta-amyloid pet imaging agents |
| US8455622B2 (en) | 2006-12-01 | 2013-06-04 | Seattle Genetics, Inc. | Variant target binding agents and uses thereof |
| US20140056904A1 (en) | 2012-08-24 | 2014-02-27 | University Health Network | Antibodies to TTR and Methods of Use |
| WO2014124334A2 (en) * | 2013-02-08 | 2014-08-14 | Misfolding Diagnostics, Inc. | Transthyretin antibodies and uses thereof |
| WO2015010118A2 (en) * | 2013-07-19 | 2015-01-22 | The University Of Texas | Transthyretin amyloid-selective and polyreactive catabodies |
| WO2019071206A1 (en) | 2017-10-06 | 2019-04-11 | Prothena Biosciences Limited | METHODS OF DETECTING TRANSTHYRETIN |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FI20115165A0 (fi) * | 2011-02-21 | 2011-02-21 | Polysackaridforskning I Uppsala Ab | Terapeuttisia ja diagnostisia menetelmiä |
-
2016
- 2016-01-27 TW TW110100085A patent/TWI786505B/zh active
- 2016-01-27 TW TW105102535A patent/TWI718122B/zh active
- 2016-01-28 SG SG10202101763VA patent/SG10202101763VA/en unknown
- 2016-01-28 JP JP2017539650A patent/JP6748086B2/ja active Active
- 2016-01-28 PT PT167028125T patent/PT3250592T/pt unknown
- 2016-01-28 CA CA2974912A patent/CA2974912A1/en active Pending
- 2016-01-28 CU CU2017000097A patent/CU24480B1/es unknown
- 2016-01-28 SI SI201631652T patent/SI3250592T1/sl unknown
- 2016-01-28 UA UAA201708667A patent/UA122142C2/uk unknown
- 2016-01-28 EP EP22195219.5A patent/EP4134379A1/en active Pending
- 2016-01-28 DK DK16702812.5T patent/DK3250592T3/da active
- 2016-01-28 KR KR1020177023749A patent/KR102598180B1/ko active Active
- 2016-01-28 CN CN201680010882.7A patent/CN107406499B/zh active Active
- 2016-01-28 LT LTEPPCT/IB2016/050415T patent/LT3250592T/lt unknown
- 2016-01-28 PE PE2017001287A patent/PE20180217A1/es unknown
- 2016-01-28 US US15/009,662 patent/US20160251418A1/en not_active Abandoned
- 2016-01-28 MX MX2017009806A patent/MX394170B/es unknown
- 2016-01-28 HU HUE16702812A patent/HUE060878T2/hu unknown
- 2016-01-28 WO PCT/IB2016/050415 patent/WO2016120810A1/en not_active Ceased
- 2016-01-28 EP EP16702812.5A patent/EP3250592B1/en active Active
- 2016-01-28 EA EA201791712A patent/EA036080B1/ru unknown
- 2016-01-28 HR HRP20221538TT patent/HRP20221538T1/hr unknown
- 2016-01-28 ES ES16702812T patent/ES2934656T3/es active Active
- 2016-01-28 KR KR1020237037602A patent/KR102677203B1/ko active Active
- 2016-01-28 AU AU2016210888A patent/AU2016210888C1/en active Active
- 2016-01-28 PL PL16702812.5T patent/PL3250592T3/pl unknown
- 2016-01-28 RS RS20221170A patent/RS63906B1/sr unknown
- 2016-01-28 SG SG11201706124VA patent/SG11201706124VA/en unknown
- 2016-01-28 FI FIEP16702812.5T patent/FI3250592T3/fi active
-
2017
- 2017-07-20 PH PH12017501318A patent/PH12017501318A1/en unknown
- 2017-07-24 IL IL253633A patent/IL253633B/en active IP Right Grant
- 2017-07-27 CL CL2017001924A patent/CL2017001924A1/es unknown
- 2017-07-27 SA SA517382002A patent/SA517382002B1/ar unknown
- 2017-08-21 ZA ZA2017/05663A patent/ZA201705663B/en unknown
- 2017-08-22 CO CONC2017/0008476A patent/CO2017008476A2/es unknown
-
2020
- 2020-08-06 JP JP2020133642A patent/JP7028923B2/ja active Active
-
2022
- 2022-11-02 CL CL2022003027A patent/CL2022003027A1/es unknown
Patent Citations (55)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4634664A (en) | 1982-01-22 | 1987-01-06 | Sandoz Ltd. | Process for the production of human mono-clonal antibodies |
| US4634666A (en) | 1984-01-06 | 1987-01-06 | The Board Of Trustees Of The Leland Stanford Junior University | Human-murine hybridoma fusion partner |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5304489A (en) | 1987-02-17 | 1994-04-19 | Genpharm International, Inc. | DNA sequences to target proteins to the mammary gland for efficient secretion |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5741957A (en) | 1989-12-01 | 1998-04-21 | Pharming B.V. | Transgenic bovine |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5871907A (en) | 1991-05-15 | 1999-02-16 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5858657A (en) | 1992-05-15 | 1999-01-12 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5837242A (en) | 1992-12-04 | 1998-11-17 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5849992A (en) | 1993-12-20 | 1998-12-15 | Genzyme Transgenics Corporation | Transgenic production of antibodies in milk |
| US5877218A (en) | 1994-01-10 | 1999-03-02 | Teva Pharmaceutical Industries, Ltd. | Compositions containing and methods of using 1-aminoindan and derivatives thereof and process for preparing optically active 1-aminoindan derivatives |
| US5786464C1 (en) | 1994-09-19 | 2012-04-24 | Gen Hospital Corp | Overexpression of mammalian and viral proteins |
| US5786464A (en) | 1994-09-19 | 1998-07-28 | The General Hospital Corporation | Overexpression of mammalian and viral proteins |
| US6063598A (en) | 1995-10-24 | 2000-05-16 | Dr. Karl Thomae Gmbh | Strong homologous promoter obtained from hamsters |
| US5834597A (en) | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
| US6114148A (en) | 1996-09-20 | 2000-09-05 | The General Hospital Corporation | High level expression of proteins |
| US6114148C1 (en) | 1996-09-20 | 2012-05-01 | Gen Hospital Corp | High level expression of proteins |
| US5888809A (en) | 1997-05-01 | 1999-03-30 | Icos Corporation | Hamster EF-1α transcriptional regulatory DNA |
| US20050009150A1 (en) | 1998-11-30 | 2005-01-13 | Elan Pharmaceuticals, Inc. | Humanized antibodies that recognize beta amyloid peptide |
| US6624821B1 (en) | 1999-02-05 | 2003-09-23 | Samsung Electronics Co., Ltd. | Image texture retrieving method and apparatus thereof |
| US6881557B2 (en) | 2001-07-12 | 2005-04-19 | Arrowsmith Technologies Llp | Super humanized antibodies |
| WO2003057838A2 (en) | 2001-12-28 | 2003-07-17 | Abgenix, Inc. | Antibodies against the muc18 antigen |
| WO2004050884A2 (de) | 2002-11-29 | 2004-06-17 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Neue neomycin-phosphotransferase-gene und verfahren zur selektion von hochproduzierenden rekombinanten zellen |
| WO2005019442A2 (de) | 2003-08-19 | 2005-03-03 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Verfahren zur reklonierung von produktionszellen |
| US7569339B2 (en) | 2004-11-10 | 2009-08-04 | Boehringer Ingelheim Pharma Gmbh & Co., Kg | Use of flow-cytrometric analysis to optimize cell banking strategies for CHO cells |
| US20110008255A1 (en) | 2006-04-21 | 2011-01-13 | The Department Of Health And Human Services | Beta-amyloid pet imaging agents |
| WO2008012142A1 (de) | 2006-07-26 | 2008-01-31 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Regulatorische nukleinsäureelemente |
| US8455622B2 (en) | 2006-12-01 | 2013-06-04 | Seattle Genetics, Inc. | Variant target binding agents and uses thereof |
| WO2008107388A1 (en) | 2007-03-02 | 2008-09-12 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Improvement of protein production |
| WO2009027471A1 (de) | 2007-08-29 | 2009-03-05 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Verfahren zur steigerung von proteintitern |
| US20140056904A1 (en) | 2012-08-24 | 2014-02-27 | University Health Network | Antibodies to TTR and Methods of Use |
| WO2014124334A2 (en) * | 2013-02-08 | 2014-08-14 | Misfolding Diagnostics, Inc. | Transthyretin antibodies and uses thereof |
| WO2015010118A2 (en) * | 2013-07-19 | 2015-01-22 | The University Of Texas | Transthyretin amyloid-selective and polyreactive catabodies |
| WO2019071206A1 (en) | 2017-10-06 | 2019-04-11 | Prothena Biosciences Limited | METHODS OF DETECTING TRANSTHYRETIN |
Non-Patent Citations (80)
| Title |
|---|
| "Fundamental Immunology", 1989, RAVEN PRESS |
| "Molecular Medicine and Medicinal Chemistry", 1 January 2011, article OLIVIER LÉGER ET AL: "Antibody Drug Discovery Chapter 1: "Humanization of Antibodies"", pages: 1 - 23, XP055119233 * |
| "Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", pages: 303 - 16 |
| AKAHORI ET AL.: "Construction and characterization of antibody libraries: isolation of therapeutic human antibodies and application to functional genomics", DIRECT SUBMISSION, 25 July 2001 (2001-07-25) |
| ALMAGRO JUAN C ET AL: "Humanization of antibodies", FRONTIERS IN BIOSCIENCE, FRONTIERS IN BIOSCIENCE, ALBERTSON, NY, US, vol. 13, 1 January 2008 (2008-01-01), pages 1619 - 1633, XP009126790, ISSN: 1093-9946 * |
| ALMEIDA; SARAIVA, FEBS LETTERS, vol. 586, 2012, pages 2891 - 2896 |
| ANDO ET AL., ORPHANET JOURNAL OF RARE DISEASES, vol. 8, 2013, pages 31 |
| ANDO ET AL., ORPHANET JOURNAL OF RARE DISEASES, vol. 8, pages 31 |
| ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", pages: 243 - 56 |
| ATWAL ET AL., SCI. TRANS. MED., vol. 3, 2011, pages 84RA43 |
| BANNER ET AL., ACTA. CRYSTALLOGR. D. BIOL. CRYSTALLOGR., vol. 69, 2013, pages 1124 - 1137 |
| BERTSCHINGER ET AL., PROTEIN ENG. DES. SEL., vol. 20, 2007, pages 57 - 68 |
| BRACK ET AL., MOL. CANCER THER., vol. 13, 2014, pages 2030 - 2039 |
| CARDOSO; SARAIVA, FASEB J, vol. 20, no. 2, 2006, pages 234 - 239 |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883 |
| CHOTHIA, J. MOL. BIOL., vol. 196, 1987, pages 901 |
| CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CO ET AL., J. IMMUNOL., vol. 148, 1992, pages 1149 |
| COVACEUSZACH ET AL., ACTA CRYSTALLOGR. D BIOL. CRYSTALLOGR, vol. 57, 2001, pages 1307 - 1309 |
| DAMAS; SARAIVA, J. STRUCT. BIOL., vol. 130, pages 290 - 299 |
| DESHPANDE ET AL., NUCLEIC ACIDS RES., vol. 33, 2005, pages D233 - 7 |
| DWULET; BENSON, BIOCHEM. BIOPHYS. RES. COMMUN, vol. 114, 1983, pages 657 - 662 |
| DWULET; BENSON, BIOCHEM. BIOPHYS. RES. COMMUN., vol. 114, 1983, pages 657 - 662 |
| ELLEN ROSE: "Protena discontinues development of NEOD001 for AL Amyloidosis", PROTENA - PRESS RELEASE, 23 April 2018 (2018-04-23), XP055672663, Retrieved from the Internet <URL:http://ir.prothena.com/news-releases/news-release-details/prothena-discontinues-development-neod001-al-amyloidosis> |
| FOOTE; WINTER, J. MOL. BIOL, vol. 224, 1992, pages 487 - 499 |
| GOLDSTEINS G ET AL: "Exposure of cryptic epitopes on transthyretin only in amyloid and in amyloidogenic mutants", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 96, no. 6, 16 March 1999 (1999-03-16), pages 3108 - 3113, XP002987251, ISSN: 0027-8424, DOI: 10.1073/PNAS.96.6.3108 * |
| GONZALES ET AL., MOL. IMMUNOL., vol. 41, 2004, pages 863 |
| GRABULOVSKI ET AL., J. BIOL. CHEM., vol. 282, 2007, pages 3196 - 3204 |
| HARLOW; LANE: "Antibodies, A Laboratory Manual", 1988, CSHP |
| HAZRA ET AL., CELL BIOPHYS, vol. 24-25, 1994, pages 1 - 7 |
| HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery", pages: 623 - 53 |
| HINTON ET AL., J. BIOL. CHEM., vol. 279, 2004, pages 6213 |
| INOUE ET AL.: "Specific pathogen free conditions prevent transthyretin amyloidosis in mouse models", TRANSGENIC RESEARCH, vol. 17, 2008, pages 817 - 826, XP019616159 |
| ITO; MAEDA: "Recent Advances in Transthyretin Evolution, Structure, and Biological Functions", 2009, SPRINGER, article "Mouse Models of Transthyretin Amyloidosis", pages: 261 - 280 |
| IWAHASHI ET AL., MOL. IMMUNOL., vol. 36, 1999, pages 1079 - 1091 |
| JIANG ET AL., BIOCHEMISTRY, vol. 40, 2001, pages 11442 - 11452 |
| JOHNSON ET AL., J. MOL. BIOL., vol. 421, no. 2-3, 2012, pages 185 - 203 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242 |
| KABAT: "Sequences of Proteins of Immunological Interest", 1987, NATIONAL INSTITUTES OF HEALTH |
| KOHNO ET AL., AM. J. PATH., vol. 150, no. 4, 1997, pages 1497 - 1508 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 53 |
| LAZAR ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 4005 |
| LUNDQUIST ET AL., INFECT. IMMUN., vol. 74, no. 6, 2006, pages 3222 - 3231 |
| MARTIN; THORNTON, J MOL. BIOL., vol. 263, 1996, pages 800 - 15 |
| MARTIN; THORNTON, J. MOL. BIOL., vol. 263, 1996, pages 800 - 15 |
| MONICHAN PHAY ET AL: "Transthyretin Aggregate-Specific Antibodies Recognize Cryptic Epitopes on Patient-Derived Amyloid Fibrils", REJUVENATION RESEARCH, vol. 17, no. 2, 1 April 2014 (2014-04-01), US, pages 97 - 104, XP055256411, ISSN: 1549-1684, DOI: 10.1089/rej.2013.1524 * |
| NAGATA ET AL., J. BIOCHEM., vol. 117, 1995, pages 169 - 175 |
| NEUBERGER, NAT. BIOTECHNOL., vol. 14, 1996, pages 826 |
| OESTBERG ET AL., HYBRIDOMA, vol. 2, 1983, pages 361 - 367 |
| OSTERMEIER ET AL., PROTEINS, vol. 21, no. 1, 1995, pages 74 - 77 |
| PASCALIS ET AL., J. IMMUNOL., vol. 169, 2002, pages 3076 |
| PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 4771 - 4775 |
| QUEEN ET AL., IMMUNOL. REV, vol. 89, 1986, pages 49 |
| RUBERG; BERK, CIRCULATION, vol. 126, 2012, pages 1286 - 1300 |
| RUZHEINIKOV ET AL., J. MOL. BIOL., vol. 332, no. 2, 2003, pages 423 - 435 |
| SANTOS ET AL., NEUROBIOLOGY OF AGING, vol. 31, 2010, pages 280 - 289 |
| SARAIVA, FEBS LETTERS, vol. 498, 2001, pages 201 - 203 |
| SARAIVA, HUM. MUTAT., vol. 17, no. 6, 2001, pages 493 - 503 |
| SCHLATTER ET AL., MABS, vol. 4, 2011, pages 497 - 508 |
| SCIENCE, vol. 259, 1993, pages 373 - 377 |
| SCOPES: "Protein Purification", 1982, SPRINGER-VERLAG |
| SHIMADA ET AL., MOL. BIOL. MED., vol. 6, 1989, pages 333 - 343 |
| SHIRAI ET AL., FEBS LETT., vol. 455, 1999, pages 188 - 97 |
| SHRINER ET AL., VACCINE, vol. 24, no. 49-50, 2006, pages 7159 - 7166 |
| SONGSIVILAI; LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321 |
| SOUSA ET AL., AM. J. PATH., vol. 161, 2002, pages 1935 - 1948 |
| TAMURA ET AL., J. IMMUNOL., vol. 164, 2000, pages 1432 - 1441 |
| TENG ET AL., LAB. INVEST., vol. 81, no. 3, 2001, pages 385 - 396 |
| TENG ET AL., LABORATORY INVESTIGATIONS, vol. 81, 2001, pages 385 - 396 |
| THORNTON; MARTIN, J. MOL. BIOL., vol. 263, 1996, pages 800 - 815 |
| THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 58 |
| THORPE ET AL.: "Monoclonal Antibodies 84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", pages: 475 - 506 |
| VAJDOS ET AL., J. OF MOL. BIOL., vol. 320, 2002, pages 415 - 428 |
| WAKASUGI ET AL., PROC. JAPAN ACAD., vol. 63B, 1987, pages 344 - 347 |
| WALL ET AL., ISNM ANNUAL MEETING, 2011 |
| WANG ET AL., MABS, vol. 1, no. 3, 2009, pages 254 - 267 |
| WINNACKER: "From Genes to Clones", 1987, VCH PUBLISHERS |
| WITZIG, CANCER CHEMOTHER. PHARMACOL., vol. 48, no. 1, 2001, pages 591 - S95 |
| WU ET AL.: "Antibody Engineering", 2010, SPRINGER, article "Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-IgTM) Molecule" |
| YU ET AL., SCI. TRANS. MED., vol. 3, 2011, pages 84RA44 |
Cited By (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11267878B2 (en) | 2015-01-28 | 2022-03-08 | Neotope Neuroscience Limited | Anti-transthyretin antibodies |
| US11912759B2 (en) | 2015-01-28 | 2024-02-27 | Novo Nordisk A/S | Anti-transthyretin antibodies |
| US11629185B2 (en) | 2015-01-28 | 2023-04-18 | Novo Nordisk A/S | Anti-transthyretin antibodies |
| US10669330B2 (en) | 2015-01-28 | 2020-06-02 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US10464999B2 (en) | 2015-01-28 | 2019-11-05 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US10494426B2 (en) | 2015-01-28 | 2019-12-03 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US10633433B2 (en) | 2015-01-28 | 2020-04-28 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US11028158B2 (en) | 2015-01-28 | 2021-06-08 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US9879080B2 (en) | 2015-01-28 | 2018-01-30 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US10906967B2 (en) | 2015-01-28 | 2021-02-02 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| WO2018007922A3 (en) * | 2016-07-02 | 2018-02-15 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| US11267877B2 (en) | 2017-10-06 | 2022-03-08 | Prothena Biosciences Limited | Anti-transthyretin antibodies |
| WO2019071206A1 (en) | 2017-10-06 | 2019-04-11 | Prothena Biosciences Limited | METHODS OF DETECTING TRANSTHYRETIN |
| CN111757730A (zh) * | 2017-10-06 | 2020-10-09 | 普罗塞纳生物科学有限公司 | 检测甲状腺素运载蛋白的方法 |
| US12247985B2 (en) | 2017-10-06 | 2025-03-11 | Novo Nordisk A/S | Methods of detecting transthyretin |
| JP2021504372A (ja) * | 2017-11-29 | 2021-02-15 | プロセナ バイオサイエンシーズ リミテッド | トランスサイレチンに対するモノクローナル抗体の凍結乾燥製剤 |
| EP3717512A4 (en) * | 2017-11-29 | 2021-08-25 | Prothena Biosciences Limited | LYOPHILIZED FORMULATION OF A MONOCLONAL ANTIBODY AGAINST TRANSTHYRETINE |
| US11873332B2 (en) | 2017-11-29 | 2024-01-16 | Novo Nordisk A/S | Lyophilized formulation of a monoclonal antibody against transthyretin |
| JP7337057B2 (ja) | 2017-11-29 | 2023-09-01 | ノボ ノルディスク エー/エス | トランスサイレチンに対するモノクローナル抗体の凍結乾燥製剤 |
| WO2019108689A1 (en) | 2017-11-29 | 2019-06-06 | Prothena Biosciences Limited | Lyophilized formulation of a monoclonal antibody against transthyretin |
| WO2020094883A1 (en) | 2018-11-09 | 2020-05-14 | Neurimmune Ag | Patient-derived amyloid xenograft non-human animal model |
| WO2021185961A1 (en) | 2020-03-18 | 2021-09-23 | Al-S Pharma Ag | Misfolded sod1 assay |
| WO2021228987A1 (en) | 2020-05-12 | 2021-11-18 | Neurimmune Ag | Combination therapy for ttr amyloidosis |
| EP4237005A4 (en) * | 2020-10-28 | 2024-10-09 | Novo Nordisk A/S | ANTI-TRANSTHYRETIN ANTIBODIES AND METHODS OF USE THEREOF |
| WO2023099788A1 (en) | 2021-12-03 | 2023-06-08 | Neurimmune Ag | Novel potency assay for antibody-based drugs and useful means therefor |
| WO2024105062A1 (en) | 2022-11-15 | 2024-05-23 | Neurimmune Ag | Methods for treating or preventing transthyretin-mediated amyloidosis |
| WO2024197157A1 (en) * | 2023-03-21 | 2024-09-26 | Biograph 55, Inc. | Cd19/cd38 multispecific antibodies |
| US12173081B2 (en) | 2023-03-21 | 2024-12-24 | Biograph 55, Inc. | CD19/CD38 multispecific antibodies |
| WO2024240562A1 (en) | 2023-05-19 | 2024-11-28 | Neurimmune Ag | Novel immunotherapy for musculoskeletal disorders and conditions |
| WO2025104243A1 (en) | 2023-11-15 | 2025-05-22 | Neurimmune Ag | Anti-transthyretin antibody, compositions comprising said antibody and methods for treating or preventing transthyretin-mediated amyloidosis |
| WO2025125544A1 (en) | 2023-12-15 | 2025-06-19 | Novo Nordisk A/S | Stable liquid formulations |
| WO2025238147A1 (en) | 2024-05-15 | 2025-11-20 | Neurimmune Ag | Maintenance treatment of cardiac ttr amyloidosis using anti-transthyretin antibodies |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240141025A1 (en) | Anti-transthyretin antibodies | |
| EP3250592B1 (en) | Anti-transthyretin antibodies | |
| EP3250593B1 (en) | Anti-transthyretin antibodies | |
| EP3250594B1 (en) | Anti-transthyretin antibodies | |
| US10906967B2 (en) | Anti-transthyretin antibodies | |
| US11267878B2 (en) | Anti-transthyretin antibodies | |
| WO2018007922A2 (en) | Anti-transthyretin antibodies | |
| EP3478715A2 (en) | Anti-transthyretin antibodies | |
| EP3478716A2 (en) | Anti-transthyretin antibodies | |
| HK40086865A (en) | Anti-transthyretin antibodies | |
| HK1240248A1 (en) | Anti-transthyretin antibodies | |
| HK1240248B (en) | Anti-transthyretin antibodies | |
| HK1240249B (en) | Anti-transthyretin antibodies | |
| HK1240247A1 (en) | Anti‐transthyretin antibodies | |
| HK1240247B (en) | Anti‐transthyretin antibodies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16702812 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12017501318 Country of ref document: PH |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 253633 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2974912 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2017539650 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 001287-2017 Country of ref document: PE |
|
| REEP | Request for entry into the european phase |
Ref document number: 2016702812 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11201706124V Country of ref document: SG Ref document number: MX/A/2017/009806 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2016210888 Country of ref document: AU Date of ref document: 20160128 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2017/0008476 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 20177023749 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201791712 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: A201708667 Country of ref document: UA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017016330 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112017016330 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170728 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 733896 Country of ref document: NZ |