WO2016015014A1 - Novel glp-1 receptor modulators - Google Patents
Novel glp-1 receptor modulators Download PDFInfo
- Publication number
- WO2016015014A1 WO2016015014A1 PCT/US2015/042114 US2015042114W WO2016015014A1 WO 2016015014 A1 WO2016015014 A1 WO 2016015014A1 US 2015042114 W US2015042114 W US 2015042114W WO 2016015014 A1 WO2016015014 A1 WO 2016015014A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- compound
- mmol
- chr
- butyl
- tert
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 *C(C(CC1)CC1=*)=O Chemical compound *C(C(CC1)CC1=*)=O 0.000 description 11
- ZRMZOLWSSDIXDQ-SFHVURJKSA-N CC(C)(C)OC([C@H](Cc(cc1)ccc1O)NC(OCc1ccccc1)=O)=O Chemical compound CC(C)(C)OC([C@H](Cc(cc1)ccc1O)NC(OCc1ccccc1)=O)=O ZRMZOLWSSDIXDQ-SFHVURJKSA-N 0.000 description 2
- PUDATRIBTMIDRR-UHFFFAOYSA-N C1OC(CC2)(CCC2C2CCCCC2)OC1 Chemical compound C1OC(CC2)(CCC2C2CCCCC2)OC1 PUDATRIBTMIDRR-UHFFFAOYSA-N 0.000 description 1
- AXQLHEWHNBIVAY-DEOSSOPVSA-N CC(C)(C)OC(C(C1)CN1C([C@H](Cc(cc1)ccc1-c(nc1)ncc1Br)NC(OCc1ccccc1)=O)=O)=O Chemical compound CC(C)(C)OC(C(C1)CN1C([C@H](Cc(cc1)ccc1-c(nc1)ncc1Br)NC(OCc1ccccc1)=O)=O)=O AXQLHEWHNBIVAY-DEOSSOPVSA-N 0.000 description 1
- JJTNKNLDRTZRLJ-UHFFFAOYSA-N CC(C)(C)OC(NCc(cc1)ccc1N1OC(C)(C)C(C)(C)O1)=O Chemical compound CC(C)(C)OC(NCc(cc1)ccc1N1OC(C)(C)C(C)(C)O1)=O JJTNKNLDRTZRLJ-UHFFFAOYSA-N 0.000 description 1
- UTAARZADILZEAO-QFIPXVFZSA-N CC(C)(C)c(cc1)ccc1C(N[C@@H](Cc(cc1)ccc1-c(nc1)ncc1Br)C(C)=O)=O Chemical compound CC(C)(C)c(cc1)ccc1C(N[C@@H](Cc(cc1)ccc1-c(nc1)ncc1Br)C(C)=O)=O UTAARZADILZEAO-QFIPXVFZSA-N 0.000 description 1
- QXFQRNPJRRIVQV-UHFFFAOYSA-N CC(C)(C)c1ccc(C(NC(Cc(cc2)ccc2-c(nc2)ncc2Br)C(O)=O)=O)[s]1 Chemical compound CC(C)(C)c1ccc(C(NC(Cc(cc2)ccc2-c(nc2)ncc2Br)C(O)=O)=O)[s]1 QXFQRNPJRRIVQV-UHFFFAOYSA-N 0.000 description 1
- RRJCGTBHSCJFHI-QHCPKHFHSA-N CC(C)NC([C@H](Cc(cc1)ccc1-c(nc1)ncc1Br)NC(c1ccc(C(C)(C)C)cc1)=O)=O Chemical compound CC(C)NC([C@H](Cc(cc1)ccc1-c(nc1)ncc1Br)NC(c1ccc(C(C)(C)C)cc1)=O)=O RRJCGTBHSCJFHI-QHCPKHFHSA-N 0.000 description 1
- PSWKHWQPBJANKW-NNHYKBDLSA-O CCCC(CC1)CCC1C(CC1)CC=C1c1cnc(-c2ccc(C[C@@H](C(N(C3)CC3C(OC(C)(C)C)=O)=[OH+])NC(OCc3ccccc3)=O)cc2)nc1 Chemical compound CCCC(CC1)CCC1C(CC1)CC=C1c1cnc(-c2ccc(C[C@@H](C(N(C3)CC3C(OC(C)(C)C)=O)=[OH+])NC(OCc3ccccc3)=O)cc2)nc1 PSWKHWQPBJANKW-NNHYKBDLSA-O 0.000 description 1
- IIIZKTBGDNOSHT-JHJOSGQCSA-N CCC[C@H](CC1)CC[C@@H]1C(CC1)CC(C)=C1O[Si](C)(C)C Chemical compound CCC[C@H](CC1)CC[C@@H]1C(CC1)CC(C)=C1O[Si](C)(C)C IIIZKTBGDNOSHT-JHJOSGQCSA-N 0.000 description 1
- GQKPLGZEPYJIHJ-OWBHPGMISA-N CCNC(C1CC(C)(C)C/C=C\CCCCCCCCC1)=O Chemical compound CCNC(C1CC(C)(C)C/C=C\CCCCCCCCC1)=O GQKPLGZEPYJIHJ-OWBHPGMISA-N 0.000 description 1
- BEWIEMLNBLYPCC-UHFFFAOYSA-N CCOC(C)(CC1)CCC1C(CC1)CCC11[O](C)CC[O]1C Chemical compound CCOC(C)(CC1)CCC1C(CC1)CCC11[O](C)CC[O]1C BEWIEMLNBLYPCC-UHFFFAOYSA-N 0.000 description 1
- RBJOYJDYIPWIMB-HUYACMLCSA-N CC[C@@H](CC1)CCC1(CCC1)CCC/C1=N/NS(c1ccc(C)cc1)(=O)=O Chemical compound CC[C@@H](CC1)CCC1(CCC1)CCC/C1=N/NS(c1ccc(C)cc1)(=O)=O RBJOYJDYIPWIMB-HUYACMLCSA-N 0.000 description 1
- VXQROEXTWNTASQ-UHFFFAOYSA-N CNC(c1ccccc1)=S Chemical compound CNC(c1ccccc1)=S VXQROEXTWNTASQ-UHFFFAOYSA-N 0.000 description 1
- KHRDUTMGGCRRHS-POPKIHAOSA-N C[C@H](CC1)CC[C@@H]1C1=CCC(c2cnc(C3=CC=C(CC(C(N=O)=O)NC(C4=CC=C(C(C)(C)C)SC4)=[U])[I]=C3)nc2)=CC1 Chemical compound C[C@H](CC1)CC[C@@H]1C1=CCC(c2cnc(C3=CC=C(CC(C(N=O)=O)NC(C4=CC=C(C(C)(C)C)SC4)=[U])[I]=C3)nc2)=CC1 KHRDUTMGGCRRHS-POPKIHAOSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/05—Dipeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/155—Amidines (), e.g. guanidine (H2N—C(=NH)—NH2), isourea (N=C(OH)—NH2), isothiourea (—N=C(SH)—NH2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/4985—Pyrazines or piperazines ortho- or peri-condensed with heterocyclic ring systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/506—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7004—Monosaccharides having only carbon, hydrogen and oxygen atoms
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D401/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
- C07D401/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
- C07D401/10—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a carbon chain containing aromatic rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D401/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
- C07D401/14—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D403/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
- C07D403/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
- C07D403/06—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D403/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
- C07D403/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
- C07D403/10—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings linked by a carbon chain containing aromatic rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D403/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
- C07D403/14—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing three or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D409/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms
- C07D409/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings
- C07D409/10—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a carbon chain containing aromatic rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D409/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms
- C07D409/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings
- C07D409/12—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D409/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms
- C07D409/14—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing three or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D471/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00
- C07D471/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00 in which the condensed system contains two hetero rings
- C07D471/08—Bridged systems
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/06—Dipeptides
- C07K5/06139—Dipeptides with the first amino acid being heterocyclic
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the invention relates to compounds that bind the glucagon-like peptide 1 (GLP- 1) receptor, methods of their synthesis, and methods of their therapeutic and/or 5 prophylactic use.
- the present invention is directed to compounds adapted to act as modulators of the GLP-1 receptor, and potentiators of incretin peptides, such as GLP- 1(7-36), GLP-1 (9-36), and oxyntomodulin, as well as peptide-based therapies such as exenatide and liraglutide.
- GLP-1 R Glucagon-like peptide 1 receptor
- GLP-1 R belongs to Family B l of the seven-transmembrane G protein-coupled receptors, and its natural agonist ligand is the peptide hormone glucagon-like peptide- 1 (GLP-1).
- GLP-1 is a peptide hormone arising by its alternative enzymatic cleavage from proglucagon, the prohormone precursor for GLP-1, which is highly expressed in enteroendocrine cells of the intestine, the alpha
- Oxyntomodulin is also generated from L-cell derived proglucagon by alternative proteolysis. Oxyntomodulin is identical to glucagon plus an additional 8 amino acid carboxyterminal extension (Bataille D., et al, Peptides 2 Suppl s:41-4 (1981)). Oxyntomodulin is a dual agonist of both GLP-1 receptor and glucagon
- Oxyntomodulin induces glucose dependent insulin secretion from pancreatic ⁇ cells (Maida, A., et al, Endocrinology 149:5670-8 (2008), and in vivo, oxyntomodulin modulates food intake (Dakin, C.L. et al, Endocrinology 142:4244-50 (2001)) and is significantly anorectic (Baggio, L.L. et al, Gastroenterology 127:46-58 (2004)).
- GLP-1 receptors couple to the a-subunit of G protein, with subsequent activation of adenylate cyclase and increase of cAMP levels, thereby potentiating glucose-stimulated insulin secretion. Therefore, GLP-1 is an attractive therapeutic target to lower blood glucose and preserve the ?-cells of the pancreas of diabetic patients.
- Glucagon has been used for decades in medical practice within diabetes and several glucagon-like peptides are being developed for various therapeutic indications. GLP-1 analogs and derivatives are being developed for the treatment for patients suffering from diabetes.
- the present invention is directed to compounds adapted to act as potentiators or modulators of GLP-1 receptor; methods of their preparation and methods of their use, such as in treatment of a malcondition mediated by GLP-1 receptor activation, or when modulation or potentiation of GLP-1 receptor is medically indicated.
- Certain embodiments of the present invention comprise a compound having the structure of Formula I-R or I-S or a pharmaceutically acceptable isomer, enantiomer, racemate, salt, isotope, prodrug, hydrate or solvate thereof:
- A is pyrimidinyl, pyridinyl, pyridazinyl or pyrazinyl, each of which may be optionally substituted with one or more of R 4 ;
- B is phenyl or heterocycle
- C is a nonaromatic carbocyclyl or nonaromatic carbocyclylalkyl
- each R 1 is independently H or C 1-4 alkyl
- R 2 is -OH, -O-R 8 , -N(R 1 )-SO 2 -R 7 , -NR 41 R 42 , -N(R 1 )-(CR a R b ) m - COOR 8 , -N(R 1 )-(CR a R b ) m -CO-N(R 1 )(R 40 ), -N(R 1 )-(CR a R b ) m -N(R 1 )C(O)0(R 8 ), -N(R 1 )- (CR a R b ) m -N(R 1 )(R 40 ), -N(R 1 )-(CR a R b ) m -CO-N(R 1 )-heterocyclyl, or -N(R 1 )-(CR a R b ) m - heterocyclyl, which heterocyclyl may be optionally (singly or multiply
- each R 3 and R 4 is independently H, halo, alkyl, alkyl substituted (singly or multiply) with R 31 , alkoxy, haloalkyl, perhaloalkyl, haloalkoxy, perhaloalkoxy, aryl, heterocyclyl, -OH, -OR 7 , -CN, -NO 2 , -NR 1 R 7 , -C(O)R 7 , -(O)NR 1 R 7 , -NR 1 C(O)R 7 , -SR 7 .
- R 6 is H, alkyl, aryl, heteroaryl, heterocyclyl, heterocycloalkyl, any of which may be optionally substituted (singly or multiply) with R 7 or -(CR a R b ) m -L 2 - (CR a R b ) m -R 7 ; each R 7 is independently R 10 ; a ring moiety selected from cycloalkyl, aryl, aralkyl, heterocyclyl or heterocyclylalkyl, where such ring moiety is optionally (singly or multiply) substituted with R 10 ; or when a carbon atom bears two R 7 groups such two R 7 groups are taken together to form oxo or thioxo, or are taken together (when attached to the same carbon atom or different carbon atoms) to form a ring moiety selected from cycloalkyl, aryl, heterocyclyl or heterocyclylalkyl, wherein such ring moiety is optionally sing
- each R 8 is independently H, alkyl, haloalkyl, aryl, -(CR a R b ) m L 2 - (CR a R b ) m -R 1 or -(-L 3 -(CR a R b )r-)s-L 3 -R 1 ;
- each R 10 is independently H, halo, alkyl, haloalkyl, haloalkoxy, perhaloalkyl,
- each R 31 is independently H, halo, hydroxyl, -NR 41 R 42 , or alkoxy;
- each R 40 is independently H, R 7 , alkyl which may be optionally (singly or multiply) substituted with R 7 ,or R 40 and R 1 taken together with the N atom to which they are attached form a 3- to 7-membered heterocyclyl which may be optionally (singly or multiply) substituted with R 7 ;
- each R 41 and R 42 is independently R 40 , -(CHR 40 ) n -C(O)0-R 40 , -(CHRio)n- C(O)-R 40 , -(CH2) n -N(R 1 )(R 7 ), aryl or heteroaryl any of which aryl or heteroaryl may be optionally (singly or multiply) substituted with R 7 ; or any two R 41 and R 42 taken together with the N atom to which they are attached form a 3- to 7-membered heterocyclyl which may be optionally (singly or multiply) substituted with R 7 ;
- each R a and R b is independently H, halo, alkyl, alkoxy, aryl, aralkyl, heterocyclyl, heterocyclylalkyl (any of which alkyl, alkoxy, aryl, aralkyl, heterocyclyl or heterocyclylalkyl may be optionally (singly or multiply) substituted with R 7 ), -(CHR 40 ) m C(O)OR 40 , -(CHR 40 ) m OR 40 , -(CHR 40 ) m SR 40 , -(CHR 40 ) m N R 41 R 42 , -(CHR 4 0) m C(O)NR 41 R 42 , -(CH R40 ) m C(O)N(R 1 )(CHR 40 ) m NR 41 R 42 , -(CHR 40 ) m C(O)N(R 1 )(CHR 4 ) m NR 41 R 42 ,
- L 2 is independently, from the proximal to distal end of the structure of Formula I-R or I-S, null, -O-, -OC(O)-, -NR 1 - , -C(O)NR 1 -, -N(R 1 )-C(O)-, -S(O 2 )-, - S(O)-, -S-, -C(O)- or -S(O 2 )-N(R 1 )-;
- each L 3 is independently null, -O-, or -N(R 1 )- each m is independently 0, 1 , 2, 3, 4, 5 or 6;
- each n is independently 0 or 1 or 2;
- p 0, 1, 2 or 3;
- q 0, 1, 2 or 3;
- each r is independently 2, 3, or 4;
- each s is independently 1, 2, 3, or 4.
- a pharmaceutical composition comprising a compound of the invention together with at least one pharmaceutically acceptable carrier, diluent or excipient is provided.
- a method of use of a compound of the invention comprising preparation of a medicament is provided.
- the invention provides a pharmaceutical combination comprising a compound of the invention and a second medicament.
- the second medicament is an agonist or modulator for glucagon receptor, GIP receptor, GLP-2 receptor, or PTH receptor, or glucagon-like peptide 1 (GLP-1) receptor.
- the second medicament is exenatide, liraglutide, taspoglutide, albiglutide, or lixisenatide or other insulin regulating peptide.
- the second medicament is medically indicated for the treatment of type II diabetes.
- the second medicament is a biguanide, a sulfonylurea, a meglitinide, a thiazolidinedione, an a- glucosidase inhibitor, a bile acid sequestrant, an SGLT inhibitor, and/or a dopamine-2 agonist, and in more specific embodiments is metformin (a biguanide), sitagliptin (a DPPIV inhibitor), or canagliflozin, dapagliflozin or empagliflozin (an SGLT inhibitor).
- a method of activation, potentiation or agonism of a GLP-1 receptor comprising contacting the receptor with a compound, pharmaceutical composition or pharmaceutical combination of the invention.
- a method for treatment of a malcondition in a subject for which activation, potentiation or agonism of a GLP-1 receptor is medically indicated comprises administering to such subject a compound, pharmaceutical composition or pharmaceutical combination of the invention.
- selective activation, potentiation or agonism of a GLP-1 receptor is medically indicated.
- the malcondition comprises type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
- the invention provides methods for synthesis of certain compounds including compounds of the invention. In certain other embodiments, the invention provides certain intermediate compounds associated with such methods of synthesis.
- Certain embodiments comprise a compound having the chiral structure of Formula I-R or I-S (with the chirality as indicated) or a pharmaceutically acceptable isomer, enantiomer, racemate, salt, isotope, prodrug, hydrate or solvate thereof:
- Certain embodiments of the present invention comprise a compound having the structure of Formula I-R or I-S or a pharmaceutically acceptable isomer, enantiomer, racemate, salt, isotope, prodrug, hydrate or solvate thereof:
- A, B, C, R 1 , R 2 , R 3 , R 4 , R 5 , n, p and q are as defined above.
- the invention provides a compound of Formula I-R and/or Formula I-S where B is phenyl.
- the invention provides a compound of Formula I-R and/or Formula I-S where B is heterocyle.
- the invention provides a compound of Formula I-R and/or Formula I-S where B is thiophenyl.
- the invention provides a compound of Formula I-R and/or Formula I-S where B is pyrimidinyl.
- the invention provides a compound of Formula I-R and/or Formula I-S where B is pyrazolyl.
- the invention provides a compound of Formula I-R and/or Formula I-S where B is pyridinyl.
- the invention provides a compound of Formula I-R and/or Formula I-S where B is indolyl.
- Certain embodiments of the present invention comprise a compound having the structure of Formula I-R or I-S or a pharmaceutically acceptable isomer, enantiomer, racemate, salt, isotope, prodrug, hydrate or solvate thereof:
- A is pyrimidinyl, pyridinyl, pyridazinyl or pyrazinyl, each of which may be optionally substituted with one or more of R 4 ;
- B is phenyl or thiophenyl
- C is a nonaromatic carbocyclyl or nonaromatic carbocyclylalkyl
- each R 1 is independently H or C 1-4 alkyl
- R 2 is -OH, -O-R 8 , -N(R 1 )-SO 2 -R 7 , -NR 41 R 42 , -N(R 1 )-(CR a R b ) m - COOR 8 , -N(R 1 )-(CR a R b ) m -CO-N(R 1 )(R 40 ), -N(R 1 )-(CR a R b ) m -N(R 1 )C(O)O(R 8 ), -N(R 1 )- (CR a R b ) m -N(R 1 )(R 40 ), -N(R 1 )-CCR a R b ) m -CO-N(R 1 )-heterocyclyl, or -N(R 1 )-(CR a R b ) m - heterocyclyl, which heterocyclyl may be optionally (singly or multiply
- R 6 is H, alkyl, aryl, heteroaryl, heterocyclyl, heterocycloalkyl, any of which may be optionally substituted (singly or multiply) with R 7 or -(CR a R b ) m L 2 - (CR a R b ) m -R 7 ;
- each R 7 is independently R 10 ; a ring moiety selected from cycloalkyl, aryl, aralkyl, heterocyclyl or heterocyclylalkyl, where such ring moiety is optionally (singly or multiply) substituted with R 10 ; or when a carbon atom bears two R 7 groups such two R 7 groups are taken together to form oxo or thioxo, or are taken together to form a ring moiety selected from cycloalkyl, aryl, heterocyclyl or heterocyclylalkyl, wherein such ring moiety is optionally singly or multiply substituted with R 10 ;
- each R 8 is independently H, alkyl, haloalkyl, aryl, -(CR a R b ) m -L 2 - (CR a R b ) m -R 1 or -(-L 3 -(CR a R b ) r -) s -L 3 -R 1 ;
- each R 10 is independently H, halo, alkyl, haloalkyl, haloalkoxy, perhaloalkyl,
- each R 31 is independently H, halo, hydroxyl, -N R 41 R 42 , or alkoxy;
- each R 40 is independently H, R 7 , alkyl which may be optionally (singly or multiply) substituted with R 7 ,or R 40 and R 1 taken together with the N atom to which they are attached form a 3- to 7-membered heterocyclyl which may be optionally (singly or multiply) substituted with R 7 ;
- each R 41 and R 42 is independently R 40 , -(CHR 40 ) n -C(O)0-R 40 , -(CHR 40 ) n - C(O)-R 40 , -(CH2) n -N(R 1 )(R.7), aryl or heteroaryl any of which aryl or heteroaryl may be optionally (singly or multiply) substituted with R 7 ; or any two R 41 and R 42 taken together with the N atom to which they are attached form a 3- to 7-membered heterocyclyl which may be optionally (singly or multiply) substituted with R 7 ;
- each R a and R b is independently H, halo, alkyl, alkoxy, aryl, aralkyl, heterocyclyl, heterocyclylalkyl (any of which alkyl, alkoxy, aryl, aralkyl, heterocyclyl or heterocyclylalkyl may be optionally (singly or multiply) substituted with R 7 ), -(CHR 40 ) m C(O)OR 40 , -(CHR 40 ) m OR 40 , -(CHR 40 ) m SR 40 , -(CHR 40 ) m NR 41 R 42 , -(CHR 4 o) m C(O)NR 4 .R 42 , -(CHR 40 ) m C(O)N(R 1 )(CHR 40 ) m NR 41 R 42 , -(CHR 40 ) m C(O)N(R 1 )(CHR 4 o) m C(O)NR
- L 2 is independently, from the proximal to distal end of the structure of Formula I-R or I-S, null, -0-, -OC(O)-, -NR 1 - , -C(O)NR 1 -, -N(R 1 )-C(O)-, -S(O 2 )-, - S(O)-, -S-, -C(O)- or -S(O 2 )-N(R 1 )-;
- each L 3 is independently null, -O-, or -N(R 1 )- each m is independently 0, 1, 2, 3, 4, 5 or 6;
- each n is independently 0 or 1 or 2;
- p 0, 1, 2 or 3;
- q 0, 1, 2 or 3;
- each r is independently 2, 3, or 4;
- each s is independently 1, 2, 3, or 4.
- the compounds have the structure of Formula I- R or a pharmaceutically acceptable isomer, enantiomer, salt, isotope, prodrug, hydrate or solvate thereof.
- the compounds have the structure of Formula I-S or a pharmaceutically acceptable isomer, enantiomer, salt, isotope, prodrug, hydrate or solvate thereof.
- the compounds can be substantially enantiomerically pure.
- the invention provides a compound of Formula I-R and/or Formula I-S where A is pyrimidinyl optionally substituted with one or more of R 4 .
- Representative compounds of this embodiment include compounds of the following structures (wherein " " represents either or both the R and S form of the compound):
- the invention provides a compound of Formula I-R and/or Formula I-S where A is pyridinyl optionally substituted with one or more of R 4 .
- Representative compounds of this embodiment include compounds of the following structures (wherein " ⁇ ⁇ " represents either or both the R and S form of the compound):
- the invention provides a compound of Formula I-R and/or Formula I-S where A is pyridazinyl optionally substituted with one or more of R 4 .
- Representative compounds of this embodiment include compounds of the following structures (wherein represents either or both the R and S form of the compound):
- the invention provides a compound of Formula I-R and/or Formula I-S where A is pyrazinyl optionally substituted with one or more of R 4 .
- Representative compounds of this embodiment include compounds of the following structures (wherein represents either or both the R and S form of the compound):
- the invention provides compounds of each of structures I-R/S (l)-(5) where B is pyrimidinyl, pyrazolyl, pyridinyl or indolyl, and in further embodiments the invention provides compounds of each of structures I-R/S (1)- (5) where the B group is:
- the invention provides compounds of each of structures I-R/S (1)-(5) where the B group is phenyl.
- Representative compounds of this embodiment include compounds of the following structures (wherein represents either or both the R and S form of the compound):
- the invention provides compounds of each of structures I-R/S (7)-(9) where n is 0 or 1.
- Representative compounds of this embodiment include compounds of the following structures (wherein represents either or both the R and S form of the compound):
- the invention provides compounds of each of structures I-R/S (1)-(3) where the B group is thiophenyl.
- Representative compounds of this embodiment include compounds of the following structures (wherein represents either or both the R and S form of the compound):
- the invention provides compounds of each of structures I-R/S (13)-(15) where the B group is thiophen-2-yl.
- Representative compounds of this embodiment include compounds of the following structures (wherein represents either or both the R and S form of the compound):
- the invention provides compounds of each of structures I-R/S (16)-(18) where n is 0 or 1.
- Representative compounds of this embodiment include compounds of the following structures (wherein " " represents either or both the R and S form of the compound):
- the invention provides compounds of each of structures I-R S (1)-(21) where the C group is nonaromatic carbocyclyl.
- the invention provides compounds of each of structures I-R/S (1)-(21) where the C group is cycloalkyl.
- the invention provides compounds of each of structures I-R/S (1)-(21) where the C group is cycloalkenyl.
- the invention provides compounds of each of structures I-R/S (1)-(21) where the C group is nonaromatic carbocyclylalkyl.
- the invention provides compounds of each of structures 1-R S (1)-(21) where the C group is cycloalkylalkyl.
- the invention provides compounds of each of structures I-R S (1)-(21) where the C group is cycloalkenylalkyl. [0041] In certain embodiments, the invention provides compounds of each of structures I-R/S (1)-(21) where the C group is:
- the invention provides compounds of structures I-R/S (22)-(23):
- the invention provides compounds of each of structures I-R/S (1)-(23) where R 1 is H. [0044] In certain embodiments, the invention provides compounds of each of structures I-R/S (1)-(23) where R 4 is H.
- the invention provides compounds of each of structures I-R/S (1)-(23) where q is zero.
- the invention provides compounds of each of structures I-R/S (l)-(23) where q is one, two or three.
- the invention provides compounds of each of structures I-R/S (1)-(23) where q is one.
- the invention provides compounds of structure I-R/S(l)-(23) where q is one and R 5 is -(CR a R b ) m -L 2 -(CR a R b ) m -R 7 or -(-L 3 -(CR a R b ) r -) s - L 3 -R 7 .
- the invention provides compounds of structure I-R/S(l)-(23) where q is one and R 5 is R 7 .
- the invention provides compounds of structure I-R/S(l)-(23) where q is one and R 5 is R 7 and R 7 is a ring moiety selected from cycloalkyl, aryl, aralkyl, heterocyclyl or heterocyclylalkyl, where such ring moiety is optionally (singly or multiply) substituted with halo, -OH, -CN, alkyl, alkoxy, haloalkyl or perhaloalkyl.
- the invention provides compounds of structure I-R/S(l)-(23) where q is one and R 5 is R 7 and R 7 is a ring moiety selected from cycloalkyl singly substituted with alkyl. [0053] In certain embodiments, the invention provides compounds of structure I-R/S(l)-(23) where q is one and R 5 is R 7 and R 7 is a ring moiety selected from cycloalkyl singly substituted with a linear C3- 6 alkyl.
- the invention provides compounds of structure I-R/S(1)-(23) where p is one and R 3 is halo, alkyl, alkyl substituted with R 31 , alkoxy, haloalkyl, perhaloalkyl, haloalkoxy, perhaloalkoxy, aryl, heterocyclyl, -OH, -OR 7 , -CN, -NO 2 , -NR 1 R 7 , ,-C(O)R 7 , -C(O)NR 1 R 7 , -NR 1 C(O)R 7 , -SR 7, S(O)R 7 , -S(O) 2 R 7 , -OS(O) 2 R 7 ,
- the invention provides compounds of structure I-R/S(l)-(23) where p is one and R 3 is alkyl.
- the invention provides compounds of structure I-R/S(l)-(23) where p is one and R 3 is t-butyl.
- the invention provides compounds of structures I-R/S (24)-(25):
- the invention provides compounds of structures I-R/S (26)-(27):
- the invention provides compounds of structure I-R/S(24)-(27) where each depicted alkyl is a straight chain or branched alkyl, and in some embodiments is a C 1 -C 8 straight chain or branched alkyl, such as methyl, ethyl, n- propyl, n-butyl, n-pentyl, n-hexyl, isopropyl, iso-butyl, sec-butyl or t-butyl.
- the invention provides compounds of structure I-R/SUM27) where R 2 is -OH.
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is -N(R1) C R a R b ) m COOR 8 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is -N(R 1 )SO 2 R 7 .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is -NHCH 2 COOH.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is -NH(CHR b )COOH where R b is alkyl optionally substituted with R 7 , -(CHR 40 ) m OR 40 , -(CHR 40 ) m SR 40 , -(CHR 40 ) m N R 41 R 42 , (CHR 40 ) m C(O)NR 41 R 42 , -(CHR 40 ) m C(O)N(R 1 )(CHR 40 ) m NR 41 R 42 , -(CHR 40 ) m C(O)N(R 1 ) (CHR 40 ) m C(O)NR 41 R 42 , -(CHR 40 ) m C(O)N(R 1 )(CHR 40 ) m C(O)OR 40 or -(CHR 40 )m-S-S- R 40 .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is -NH(CR a R b ) m COOH where R a and R b are independently H, alkyl optionally substituted with
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is -NR 1 (CHR b ) m COOH where R 1 and R b taken together form heterocyclyl.
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is -NR 1 (CR a R b ) m COOH where R 1 and one of R b taken together form heterocyclyl.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is -NR 1 (CR a R b ) m COOH where any two R a and R b taken together with the carbon to which they are attached form a cycloalkyl.
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is -NH(CR a R b ) m COOH where one of R a and R b is H and the other R a and R b is aryl substituted with R 7 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is -NR 1 (CR a R b ) m COOH, m is 2, R 1 is hydrogen, each occurrence of R a and R b are hydrogen, and R 8 is hydrogen:
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is -NRj(CR a R b ) m COOH, m is 1 and R 1 , R b and R 8 are hydrogen:
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is -NR 1 (CR a R b ) m COOH, m is 2, a single R a (i.e., one of the two) is hydrogen, each occurrence of R b is hydrogen, and R 8 is hydrogen:
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -C) where R a is alkyl optionally substituted with R 7 , wherein alkyl includes straight and branched alkyl groups such as methyl, ethyl, n- propyl, iso-propyl, n-butyl, iso-butyl, sec-butyl and tert-buty,l as well as cycloalkyl groups such as cyclopropyl, cyclobutyl, cyclopentyl and cyclohexyl.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -C) where R a is methyl, ethyl, n-propyl, iso- propyl, n-butyl, iso-butyl, sec-butyl or tert-buty.l
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is methyl.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is cyclopropyl, cyclobutyl, cyclopentyl or cyclohexyl.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -C) where R a is heterocycle or heterocyclylalkyl, either which may be optionally substituted with R 7 .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is heterocycle, such as pyrazinyl, pyrimidinyl, pyridazinyl, thiadiazolyl, oxadiazolyl, imidazolinyl, hexahydropyrimidinyl, diazepanyl, triazinyl, imidazolyl, pyrrolidinyl, furanyl, tetrahydrofuranyl, tetrahydro-2H-pyranyl, dioxolanyl, piperidinyl, piperazinyl, morpholinyl, pyrrolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, thiazolyl, pyridinyl, thiophenyl, benzothioph
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is aryl or aralkyl, either of which may be optionally substituted with R 7 .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is aryl or aralkyl, such as phenyl or benzyl.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is aryl or heteroaryl substituted with R 7 .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is phenyl or benzyl substituted with hydroxyl.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -CH(OH)C 6 H 5 .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CHR 40 ) m C(O)OR 40 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CH 2 ) m C(O)OH.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CHR 40 ) m OR 40 . [0087] In certain embodiments, the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CH 2 ) m OH.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -CH 2 OH.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CHR 40 ) m SR 40 .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CH 2 ) m SR 40 , where R 40 is H or alkyl.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CHR 40 ) m NR 41 R 42 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CH 2 ) m NR 41 R 42 .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CHR 40 ) m C(O)NR 41 R 42 .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CH 2 ) m C(O)NR 41 R 42 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -CH 2 C(O)NH 2 or -CH 2 CH 2 C(O)NH 2
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CHR 40 ) m C(O)N(R 1 )(CHR 40 ) m NR 41 R 42 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CH 2 ) m C(O)N(R 1 )(CH 2 ) m NR 41 R 42 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CHR 40 ) m C(O)N(R 1 )(CHR 40 ) m C(O)NR 41 R 42 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CH 2 ) m C(O)N(R 1 )(CH 2 ) m C(O)NR 41 R 42 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CHR 40 ) m C(O)N(R 1 )(CHR 40 ) m C(O)OR 40 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CH 2 ) m C(O)N(R 1 )(CH 2 ) m C(O)OR 40 .
- the invention provides compounds of structure I-R S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where R a is -(CHR 40 ) m -S-S-R 40 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where, within the R a group, R 1 , R 40 , R 41 and R 42 are hydrogen.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where, within the R a group, m is 1.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -b) or (R 2 -c) where, within the R a group, m is 2.
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is -NCR 1 XCRJ i m COOR 8 where m is 1, R 8 is hydrogen, R b is hydrogen and R ⁇ and R a taken together with the atoms to which they are attached form a heterocyclyl optionally substituted (singly or multiply) with R 7 :
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is -N(R 1 )(CR a R b ) m COOR « where m is 2, R 8 is hydrogen, R b of the second (CR a Rt > ) group is hydrogen and R 1 and R a of the second (CR a R 1> ) group taken together with the atoms to which they are attached form a heterocyclyl optionally substituted (singly or multiply) with R :
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -d) or (R 2 -e) where R 1 and R a taken together with the atoms to which they are attached form azetidinyl, pyrrolindinyl or piperidinyl, each of which is optionally substituted (singly or multiply) with R 7 .
- Representative compounds of this embodiment include compounds of structure I-R/S(l)-(27) where R 2 is:
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is N(R 1 )(R 42 ): R 42
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -f) where R 41 and R 42 are independently R 40 , -(CHR 40 ),,- C(O)OR 40 , -(CHR 40 ) n -C(O)R 40 , -(CH 2 ) necessarilyN(R 1 )(R 7 ), aryl or heteroaryl, which aryl or heteroaryl is optionally substituted (singly or multiply) with R 7 .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -f) where Rn is hydrogen and R 42 is alkyl optionally substituted (singly or multiply) with R 7 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -f) where R 41 is hydrogen and R 42 is -(CHR 40 ) n C(O)OR 40 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -f) where R 41 is hydrogen and R 42 is -(CHR 40 ) n C(O)R 40 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is (R 2 -f) where R 41 is hydrogen and R42 is -(CH 2 ) n N(R 1 )(R 7 ).
- the invention provides compounds of structure I-R S(1)-(27) where R 2 is (R 2 -f) where Ru is hydrogen and R 42 is aryl optionally substituted (singly or multiply) with R .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -f) where R 41 is hydrogen and R 42 is heteroaryl optionally substituted (singly or multiply) with R .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -l) where R41 and R 42 taken together with the N atom to which they are attached form a 3- to 7-membered heterocyclyl optionally substituted (singly or multiply) with R 7 .
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -f) where R 41 and R42 taken together with the N atom to which they are attached form pyrazinyl, pyrimidinyl, pyridazinyl, thiadiazolyl, oxadiazolyl, imidazolinyl, hexahydropyrimidinyl, diazepanyl, triazinyl, imidazolyl,pyrrolidinyl, piperidinyl, piperazinyl, morpholinyl, pyrrolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, thiazolyl or pyridinyl, any of which may be optionally substituted (singly or multiply) with R 7 .
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is-N(R 1 )(CR a R b ) m CON(R 1 )(R 40 ). [0120] In certain embodiments, the invention provides compounds of structure I-R/S(l)-(27) where R 2 is R 2 is-N(R 1 )(CR a R b ) m CON(R 1 )(R 40 ) where m is 1, R b is hydrogen and Rj and R a taken together with the atoms to which they are attached form a heterocyclyl optionally substituted (singly or multiply) with R 7 :
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is R 2 is-N(R 1 )(CR a R b ) m CON(R 1 )(R 40 ) where m is 2, R b of the second (CR a R b ) group is hydrogen and R 1 and R a of the second (CR a Rt > ) group taken together with the atoms to which they are attached form a heterocyclyl optionally substituted (singly or multiply) with R 7 :
- the invention provides compounds of structure I-R/S(1)-(27) where R 2 is (R 2 -I1) where R 1 and R a taken together with the atoms to which they are attached form azetidinyl, pyrrolindinyl, piperidinyl optionally substituted (singly or multiply) with R .
- Representative compounds of this embodiment include compounds of structure I-R/S(l)-(27) where R 2 is: R 40
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is-N(R 1 )(CR a R b ) m N(R 1 )C(O)O(R 8 ).
- the invention provides compounds of structure I-R S(1)-(27) where R 2 is-N(R 1 )(CR a R b ) m N(R 1 )(R 7 ).
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is-N(R 1 )(CR a R b ) m CON(R 1 )heterocyclyl.
- the invention provides compounds of structure I-R/S(l)-(27) where R 2 is-N(Rt)(CR a R b ) m -heterocyclyl, which heterocyclyl may be optionally substituted with R 7 .
- the invention provides a pharmaceutical composition
- a pharmaceutical composition comprising a compound of the invention together with at least one pharmaceutically acceptable carrier, diluent or excipient.
- the invention provides a pharmaceutical composition comprising a compound of the invention and a second medicament.
- the second medicament is a GLP-1 agonist or a DPPIV inhibitor.
- the invention provides a method of use of compounds of the invention for preparation of a medicament.
- the invention provides a pharmaceutical combination comprising a compound of the invention and a second medicament.
- the second medicament is an agonist or modulator for glucagon receptor, GIP receptor, GLP-2 receptor, or PTH receptor, or glucagon-like peptide 1 (GLP-1) receptor.
- the second medicament is exenatide, liraglutide, taspoglutide, albiglutide, or lixisenatide or other insulin regulating petptide.
- the second medicament is a DPPIV inhibitor, such as sitagliptin.
- the second medicament is medically indicated for the treatment of type II diabetes.
- the second medicament is a sodium-glucose co-transporter (SGLT) inhibitor, such as a SGLT1 and/or SGLT2 inhibitor, including dapagliflozin, empagliflozin and canagliflozin.
- SGLT sodium-glucose co-transporter
- the second medicament is a biguanide such as metformin, a sulfonylurea such as glibenclamide, glipizide, gliclazide, and glimepiride, a meglitinide such as repaglinide and mateglinide, a thiazolidinedione such as pioglitazone and rosiglitazone, an a-glucosidase inhibitor such as acarbose and miglitol, a bile acid sequestrant such as colesevelam, and/or a dopamine-2 agonist such as bromocriptine.
- a biguanide such as metformin, a sulfonylurea such as glibenclamide, glipizide, gliclazide, and glimepiride
- a meglitinide such as repaglinide and mateglinide
- a thiazolidinedione such as pi
- the invention provides a pharmaceutical composition comprising a compound of the invention and a second medicament, wherein the second medicament is metformin.
- the invention provides a pharmaceutical composition comprising a compound of the invention and a second medicament, wherein the second medicament is sitagliptin.
- a method for activation, potentiation or agonism of a glucagon-like peptide 1 comprising contacting the receptor with an effective amount of a compound, pharmaceutical composition or pharmaceutical combination of the invention.
- a method for activation or agonism of a GLP-1 receptor by contacting the receptor with an effective amount of an invention compound and GLP-1 peptides GLP-l(9-36) and GLP-1 (7-36), pharmaceutical composition or pharmaceutical combination, wherein the GLP-1 receptor is disposed within a living mammal; in certain embodiments wherein such mammal is a human.
- a method for treatment of a malcondition in a subject for which activation, potentiation or agonism of a GLP-1 receptor is medically indicated, by administering an effective amount of an invention compound to the subject at a frequency and for a duration of time sufficient to provide a beneficial effect to the patient.
- a method for treatment of a malcondition in a patient for which activation, potentiation, or agonism of a GLP-1 receptor is medically indicated by administering an effective amount of an invention compound to the patient at a frequency and for a duration of time sufficient to provide a beneficial effect to the patient, wherein the malcondition comprises type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
- the subject is a patient or a human being.
- the human being is afflicted with, or at risk of developing, a disease or condition selected from the group consisting of type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, and metabolic disorder.
- a disease or condition selected from the group consisting of type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, and metabolic disorder.
- said disease is type I diabetes or type II diabetes.
- the invention provides methods for synthesis of certain compounds including compounds of the invention as more fully illustrated herein. In certain other embodiments, the invention provides certain intermediate compounds associated with such methods of synthesis as illustrated herein.
- methods are provided for use of an invention compound for preparation of a medicament adapted for treatment of a disorder or a malcondition wherein activation or inhibition of a GLP-1 receptor is medically indicated.
- the malcondition comprises type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, and metabolic disorder.
- said disease is type I diabetes or type II diabetes.
- the method additionally comprises administering to the subject a second medicament selected from the group of biguanides, peptidic GLP-1 agonists and DPPIV inhibitors, wherein such second medicament is either a component of the pharmaceutical composition or a second pharmaceutical composition.
- the second medicament can be metformin, exenatide or sitagliptin.
- mammals as used herein, means both mammals and non-mammals.
- Mammals include, for example, humans; non-human primates, e.g., apes and monkeys; cattle; horses; sheep; and goats.
- Non-mammals include, for example, fish and birds.
- a "receptor”, as is well known in the art, is a biomolecular entity usually comprising a protein that specifically binds a structural class of ligands or a single native ligand in a living organism, the binding of which causes the receptor to transduce the binding signal into another kind of biological action, such as signaling a cell that a binding event has occurred, which causes the cell to alter its function in some manner.
- An example of transduction is receptor binding of a ligand causing alteration of the activity of a "G-protein" in the cytoplasm of a living cell.
- GLP-1 compound or "GLP-1 agonist” or “GLP-1 activator” or “GLP-1 inhibitor” or “GLP-1 antagonist” or “GLP-1 potentiator” or “GLP-1 modulator” as the terms are used herein refer to compounds that interact in some way with the GLP-1 receptor. They can be agonists, potentiators, or activators, or they can be antagonists or inhibitors. A “GLP-1 compound” of the invention can be selective for action of the GLP-1 receptor family.
- substantially as the term is used herein means completely or almost completely; for example, a composition that is "substantially free” of a component either has none of the component or contains such a trace amount that any relevant functional property of the composition is unaffected by the presence of the trace amount, or a compound is "substantially pure” is there are only negligible traces of impurities present.
- substantially enantiomerically or diasteromerically pure means a level of enantiomeric or diasteromeric enrichment of one enantiomer with respect to the other enantiomer or diasteromer of at least about 80%, and more preferably in excess of 80%, 85%, 90%, 95%, 98%, 99%, 99.5% or 99.9%.
- Treating or “treatment” within the meaning herein refers to an alleviation of symptoms associated with a disorder or disease, or inhibition of further progression or worsening of those symptoms, or prevention or prophylaxis of the disease or disorder.
- the expression "effective amount”, when used to describe use of a compound of the invention in providing therapy to a patient suffering from a disorder or malcondition mediated by GLP-1 refers to the amount of a compound of the invention that is effective to bind to as an agonist or as an antagonist a GLP-1 receptor in the individual's tissues, wherein the GLP-1 is implicated in the disorder, wherein such binding occurs to an extent sufficient to produce a beneficial therapeutic effect on the patient.
- an "effective amount” or a “therapeutically effective amount” of a compound of the invention refers to an amount of the compound that alleviates, in whole or in part, symptoms associated with the disorder or condition, or halts or slows further progression or worsening of those symptoms, or prevents or provides prophylaxis for the disorder or condition.
- a “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result by acting as an agonist of GLP-1 activity.
- a therapeutically effective amount is also one in which any toxic or detrimental effects of compounds of the invention are outweighed by the therapeutically beneficial effects.
- a therapeutically effective amount of a GLP-1 receptor agonist of the invention is an amount sufficient to control the malcondition, to mitigate the progress of the malcondition, or to relieve the symptoms of the malcondition.
- malconditions that can be so treated include, but not limited to, type II diabetes.
- the isomers resulting from the presence of a chiral center comprise a pair of non-superimposable isomers that are called "enantiomers.”
- Single enantiomers of a pure compound are optically active, i.e., they are capable of rotating the plane of plane polarized light.
- Single enantiomers are designated according to the Cahn-Ingold-Prelog system.
- isolated optical isomer means a compound which has been substantially purified from the corresponding optical isomer(s) of the same formula.
- the isolated isomer is at least about 80%, and preferably at least 80% or even at least 85% pure. In other embodiments, the isolated isomer is at least 90% pure or at least 98% pure, or at least about 99% pure, by weight.
- Enantiomers are sometimes called optical isomers because a pure enantiomer rotates plane-polarized light in a particular direction. If the light rotates clockwise, then that enantiomer is labeled "(+)” or “d” for dextrorotatory, its counterpart will rotate the light counterclockwise and is labeled "(-)” or "1” for levorotatory.
- racemate and “racemic mixture” are frequently used interchangeably.
- a racemate is an equal mixture of two enantiomers.
- a racemate is labeled “( ⁇ )” because it is not optically active (i.e., will not rotate plane-polarized light in either direction since its constituent enantiomers cancel each other out).
- substituted refers to an organic group as defined herein in which one or more bonds to a hydrogen atom contained therein are replaced by one or more bonds to a non-hydrogen atom such as, but not limited to, a halogen (i.e., F, CI, Br, and I); an oxygen atom in groups such as hydroxyl groups, alkoxy groups, aryloxy groups, aralkyloxy groups, oxo(carbonyl) groups, carboxyl groups including carboxylic acids, carboxylates, and carboyxlate esters; a sulfur atom in groups such as thiol groups, alkyl and aryl sulfide groups, sulfoxide groups, sulfone groups, sulfonyl groups, and sulfonamide groups; a nitrogen atom in groups such as amines, hydroxylamines, nitriles, nitro groups, N-oxides, hydrazides, azides,
- Non-limiting examples of substituents that can be bonded to a substituted carbon (or other) atom include F, CI, Br, I, OR', OC(O)N(R')2, CN, CF 3 , OCF 3 , R ⁇ O, S, C(O), S(O), methylenedioxy, ethylenedioxy, N(R') 2 , SR', SOR', SO 2 R ⁇ SO 2 N(R') 2 , SO 3 R ⁇ C(O)R', C(O)C(O)R ⁇ C(O)CH 2 C(O)R', C(S)R ⁇ C(O)OR * , OC(O)R', C(O)N(R') 2 , OC(O)N(R') 2 , C(S)N(R') 2 , (CH 2 ) 0 .
- Substituted alkyl, alkenyl, alkynyl, cycloalkyl, and cycloalkenyl groups as well as other substituted groups also include groups in which one or more bonds to a hydrogen atom are replaced by one or more bonds, including double or triple bonds, to a carbon atom, or to a heteroatom such as, but not limited to, oxygen in carbonyl (oxo), carboxyl, ester, amide, imide, urethane, and urea groups; and nitrogen in imines, hydroxyimines, oximes, hydrazones, amidines, guanidines, and nitriles.
- Substituted ring groups include substituted aryl, heterocyclyl and heteroaryl groups. Substituted ring groups can be substituted by one or more substituents at any available ring position. In some embodiments, two substituents on a substituted ring group may taken together with the ring to which they are attached to form a ring, such that the two rings are fused together. For example, benzodioxolyl is a fused ring system formed by two substituents taken together on a phenyl group.
- substituted ring groups also include rings and fused ring systems in which a bond to a hydrogen atom is replaced with a bond to a carbon atom. Therefore, substituted aryl, heterocyclyl and heteroaryl groups can also be substituted with alkyl, alkenyl, cycloalkyl, aryl, heteroaryl, and alkynyl groups as defined herein, which can themselves be further substituted.
- heteroatoms refers to non-carbon and non- hydrogen atoms, capable of forming covalent bonds with carbon, and is not otherwise limited. Typical heteroatoms are N, O, and S.
- sulfur (S) When sulfur (S) is referred to, it is understood that the sulfur can be in any of the oxidation states in which it is found, thus including sulfoxides (R-S(O)-R') and sulfones (R-S(O) 2 -R'), unless the oxidation state is specified; thus, the term “sulfone” encompasses only the sulfone form of sulfur; the term “sulfide” encompasses only the sulfide (R-S-R') form of sulfur.
- heteroatoms selected from the group consisting of O, NH, NR' and S or "[variable] is O, S . . .” are used, they are understood to encompass all of the sulfide, sulfoxide and sulfone oxidation states of sulfur.
- Alkyl groups include straight chain and branched alkyl groups and cycloalkyl groups having from 1 to about 20 carbon atoms, and typically from 1 to 12 carbons (C 1-C 12 alkyl), or, in some embodiments, from 1 to 8 carbon atoms (C
- straight chain alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, n-butyl, n-pentyl, n-hexyl, n-heptyl, and n-octyl groups.
- branched alkyl groups include, but are not limited to, isopropyl, iso-butyl, sec-butyl, t-butyl, neopentyl, isopentyl, and 2,2-dimethylpropyl groups.
- Alkyl groups as used herein may optionally include one or more further substituent groups.
- Representative substituted alkyl groups can be substituted one or more times with any of the groups listed above, for example, amino, hydroxy, cyano, carboxy, nitro, thio, alkoxy, and halogen groups.
- alkenyl groups include straight and branched chain and cyclic alkyl groups as defined above, except that at least one double bond exists between two carbon atoms. Thus, alkenyl groups have from 2 to about 20 carbon atoms, and typically from 2 to 12 carbons or, in some embodiments, from 2 to 8 carbon atoms.
- alkynyl groups include straight and branched chain alkyl groups, except that at least one triple bond exists between two carbon atoms.
- Cycloalkyl groups are alkyl groups forming a ring structure, which can be substituted or unsubstituted, wherein the ring is either completely saturated, partially unsaturated, or fully unsaturated, wherein if there is unsaturation, the conjugation of the pi-electrons in the ring do not give rise to aromaticity.
- Examples of cycloalkyl include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl groups.
- the cycloalkyl group has 3 to 8 ring members, whereas in other embodiments the number of ring carbon atoms range from 3 to 5, 3 to 6, or 3 to 7.
- Cycloalkyl groups further include polycyclic cycloalkyl groups such as, but not limited to, norbornyl, adamantyl, bornyl, camphenyl, isocamphenyl, and carenyl groups, and fused rings such as, but not limited to, decalinyl, and the like. Cycloalkyl groups also include rings that are substituted with straight or branched chain alkyl groups as defined above.
- Representative substituted cycloalkyl groups can be mono-substituted or substituted one or more times with any of the groups listed above, for example, but not limited to, amino, hydroxy, cyano, carboxy, nitro, thio, alkoxy, and halogen groups.
- (Cycloalkyl)alkyP' groups also referred to as “cycloalkylalkyl" are alkyl groups as defined above in which a hydrogen or carbon bond of the alkyl group is replaced with a bond to a cycloalkyl group as defined above.
- cycloalkenyl alone or in combination denotes a cyclic alkenyl group wherein at least one double bond is present in the ring structure.
- Cycloalkenyl groups include cycloalkyl groups having at least one double bond between two adjacent carbon atoms.
- cycloalkenyl groups include but are not limited to cyclohexenyl, cyclopentenyl, and cyclohexadienyl groups, as well as polycyclic and/or bridging ring systmes such as adamantine.
- (Cycloalkenyl)alkyl groups, also referred to as “cycloalkylalkyl”, are alkyl groups as defined above in which a hydrogen or carbon bond of the alkyl group is replaced with a bond to a cycloalkenyl group as defined above.
- Carbocyclic and “carbocyclyl” denote a ring structure wherein the atoms of the ring are carbon. In some embodiments, the carbocyclyl has 3 to 8 ring members, whereas in other embodiments the number of ring carbon atoms is 4, 5, 6, or 7. Carbocyclyl includes, for example, cycloalkyl and cycloalkenyl. Unless specifically indicated to the contrary, the carbocyclic ring can be substituted with as many as N substituents wherein N is the size of the carbocyclic ring with for example, amino, hydroxy, cyano, carboxy, nitro, thio, alkyl, alkoxy, and halogen groups.
- (Carbocyclyl)alkyF' groups also referred to as “carbocyclylalkyls" are alkyl groups as defined above in which a hydrogen or carbon bond of the alkyl group is replaced with a bond to a carbocyclyl as defined above.
- a "nonaromatic carbocyclyl” or a “nonaromatic carbocyclylalkyl” is a group in which the carbocyclic ring of the carbocyclyl or carbocyclylalkyl is a completely saturated, a partially unsaturated, or a fully unsaturated carbocyclyl, wherein if there is unsaturation, the conjugation of the pi-electrons of the carbocyclic ring do not give rise to aromaticity.
- Aryl groups are cyclic aromatic hydrocarbons that do not contain heteroatoms.
- aryl groups include, but are not limited to, phenyl, azulenyl, heptalenyl, biphenyl, indacenyl, fluorenyl, phenanthrenyl, triphenylenyl, pyrenyl, naphthacenyl, chrysenyl, biphenylenyl, anthracenyl, and naphthyl groups.
- aryl groups contain 6-14 carbons in the ring portions of the groups.
- aryl groups includes groups containing fused rings, such as fused aromatic- aliphatic ring systems (e.g., indanyl, tetrahydronaphthyl, and the like), and also includes substituted aryl groups that have other groups, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups, bonded to one of the ring atoms.
- fused aromatic- aliphatic ring systems e.g., indanyl, tetrahydronaphthyl, and the like
- substituted aryl groups that have other groups, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups, bonded to one of the ring atoms.
- Representative substituted aryl groups can be mono-substituted or substituted more than once, such as, but not limited to, 2-, 3-, 4-, 5-, or 6-substituted phenyl or naphthyl groups, which can be substituted with groups including but not limited to those listed above.
- Alkyl groups are alkyl, alkenyl or alkynyl groups as defined above in which a hydrogen atom of an alkyl, alkenyl or alkynyl group is replaced with an aryl group as defined above.
- heterocyclyl or “heterocyclic” groups include aromatic and non- aromatic ring moieties containing 3 or more ring members, of which one or more is a heteroatom such as, but not limited to, N, O, S, or P.
- heterocyclyl groups include 3 to 20 ring members, whereas other such groups have 3 to 15 ring members, including for example single ring systems containing 5, 6 or 7 ring members.
- At least one ring contains a heteroatom, but every ring in a polycyclic system need not contain a heteroatom.
- a dioxolanyl ring and a benzdioxolanyl ring system are both heterocyclyl groups within the meaning herein.
- a heterocyclyl group designated as a C 2 -heterocyclyl can be a 5- ring with two carbon atoms and three heteroatoms, a 6-ring with two carbon atoms and four heteroatoms, and so forth.
- a C4-heterocyclyl can be a 5-ring with one heteroatom, a 6-ring with two heteroatoms, and so forth. The number of carbon atoms plus the number of heteroatoms sums up to equal the total number of ring atoms.
- heterocyclyl includes fused ring species including those having fused aromatic and non-aromatic groups.
- the phrase also includes polycyclic and/or bridging ring systems containing a heteroatom such as, but not limited to, quinuclidyl and 7-azabicyclo[2.2.1]heptane, and also includes heterocyclyl groups that have substituents, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups, bonded to one of the ring members.
- a heterocyclyl group as defined herein can be a heteroaryl group or a partially or completely saturated cyclic group including at least one ring heteroatom.
- Heterocyclyl groups include, but are not limited to, pyrazinyl, pyrimidinyl, pyridazinyl, thiadiazolyl, oxadiazolyl, imidazolinyl, hexahydropyrimidinyl, diazepanyl, triazinyl, imidazolyl,pyrrolidinyl, furanyl, tetrahydrofuranyl, tetrahydro-2H-pyranyl, dioxolanyl, piperidinyl, piperazinyl, morpholinyl, pyrrolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, thiazolyl, pyridinyl, thiophenyl, benzothiophenyl, benzofuranyl, dihydrobenzofuranyl, indolyl, dihydroindolyl, azaindo
- Heterocyclyl groups can be substituted.
- Heteroaryl groups are aromatic ring moieties containing 5 or more ring members, of which, one or more is a heteroatom such as, but not limited to, N, O, and S.
- a heteroaryl group designated as a C 2 -heteroaryl can be a 5-ring with two carbon atoms and three heteroatoms, a 6-ring with two carbon atoms and four heteroatoms and so forth.
- a C 4 -heteroaryl can be a 5-ring with one heteroatom, a 6-ring with two heteroatoms, and so forth. The number of carbon atoms plus the number of heteroatoms sums up to equal the total number of ring atoms.
- Heteroaryl groups include, but are not limited to, groups such as pyrrolyl, pyrazolyl, pyridinyl, pyridazinyl, pyrimidyl, pyrazyl, pyrazinyl, pyrimidinyl, thiadiazolyl, imidazolyl, oxadiazolyl, thienyl, triazolyl, tetrazolyl, triazinyl, thiazolyl, thiophenyl, oxazolyl, isoxazolyl, benzothiophenyl, benzofuranyl, indolyl, azaindolyl, indazolyl, benzimidazolyl, azabenzimidazolyl, benzoxazolyl, benzothiazolyl, benzothiadiazolyl, imidazopyridinyl, isoxazolopyridinyl, thianaphthalenyl, purinyl, xant
- heteroaryl and heteroaryl groups include fused ring compounds such as wherein at least one ring, but not necessarily all rings, are aromatic, including tetrahydroquinolinyl, tetrahydroisoquinolinyl, indolyl and 2,3-dihydro indolyl.
- the term also includes heteroaryl groups that have other groups bonded to one of the ring members, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups.
- Representative substituted heteroaryl groups can be substituted one or more times with groups such as those listed above.
- aryl and heteroaryl groups include but are not limited to phenyl, biphenyl, indenyl, naphthyl (1-naphthyl, 2-naphthyl), N- hydroxytetrazolyl, N-hydroxytriazolyl, N-hydroxyimidazolyl, anthracenyl (1- anthracenyl, 2-anthracenyl, 3-anthracenyl), thiophenyl (2-thienyl, 3-thienyl), furyl (2- furyl, 3-furyl), indolyl, oxadiazolyl (1,2,4-oxadiazolyl, 1,3,4-oxadiazolyl), thiadiazolyl (1,2,4-thiadiazolyl, l,3,4-thiadiazolyl),isoxazolyl, quinazolinyl, fluorenyl, xanthenyl, isoindanyl, benzhydryl
- Heterocyclylalkyl groups are alkyl, alkenyl or alkynyl groups as defined above in which a hydrogen or carbon bond of an alkyl, alkenyl or alkynyl group is replaced with a bond to a heterocyclyl group as defined above.
- heterocyclyl alkyl groups include, but are not limited to, furan-2-yl methyl, furan-3-yl methyl, pyridine-2-yl methyl (a-picolyl), pyridine-3-yl methyl ( ⁇ -picolyl), pyridine-4-yl methyl ( ⁇ -picolyl), tetrahydrofuran-2-yl ethyl, and indol-2-yl propyl.
- Heterocyclylalkyl groups can be substituted on the heterocyclyl moiety, the alkyl, alkenyl or alkynyl moiety, or both.
- Heteroarylalkyl groups are alkyl, alkenyl or alkynyl groups as defined above in which a hydrogen or carbon bond of an alkyl, alkenyl or alkynyl group is replaced with a bond to a heteroaryl group as defined above. Heteroarylalkyl groups can be substituted on the heteroaryl moiety, the alkyl, alkenyl or alkynyl moiety, or both.
- ring system as the term is used herein is meant a moiety comprising one, two, three or more rings, which can be substituted with non-ring groups or with other ring systems, or both, which can be fully saturated, partially unsaturated, fully unsaturated, or aromatic, and when the ring system includes more than a single ring, the rings can be fused, bridging, or spirocyclic.
- spirocyclic is meant the class of structures wherein two rings are fused at a single tetrahedral carbon atom, as is well known in the art.
- a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring” as the term is used herein refers to a ring system including an unsaturated ring possessing 4n+2 pi electrons, or a partially reduced (hydrogenated) form thereof.
- the aromatic or partially aromatic ring can include additional fused, bridged, or spiro rings that are not themselves aromatic or partially aromatic.
- naphthalene and tetrahydronaphthalene are both a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring" within the meaning herein.
- a benzo-[2.2.2]- bicyclooctane is also a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring" within the meaning herein, containing a phenyl ring fused to a bridged bicyclic system.
- a fully saturated ring has no double bonds therein, and is carbocyclic or heterocyclic depending on the presence of heteroatoms within the meaning herein.
- alkoxy refers to an oxygen atom connected to an alkyl group, including a cycloalkyl group, as are defined above.
- linear alkoxy groups include but are not limited to methoxy, ethoxy, n-propoxy, n-butoxy, n-pentyloxy, n- hexyloxy, n-heptyloxy, n-octyloxy n-nonyloxy, and the like.
- branched alkoxy include but are not limited to isopropoxy, sec-butoxy, tert-butoxy, isopentyloxy, isohexyloxy, and the like.
- cyclic alkoxy include but are not limited to cyclopropyloxy, cyclobutyloxy, cyclopentyloxy, cyclohexyloxy, and the like.
- aryloxy and arylalkoxy refer to, respectively, an aryl group bonded to an oxygen atom and an aralkyl group bonded to the oxygen atom at the alkyl moiety. Examples include but are not limited to phenoxy, naphthyloxy, and benzyloxy.
- acyl group refers to a group containing a carbonyl moiety wherein the group is bonded via the carbonyl carbon atom.
- the carbonyl carbon atom is also bonded to another carbon atom, which can be part of an alkyl, aryl, aralkyl cycloalkyl, cycloalkylalkyl, heterocyclyl, heterocyclylalkyl, heteroaryl, heteroarylalkyl group or the like.
- the group is a "formyl” group, an acyl group as the term is defined herein.
- An acyl group can include 0 to about 12-20 additional carbon atoms bonded to the carbonyl group.
- An acyl group can include double or triple bonds within the meaning herein.
- An acryloyl group is an example of an acyl group.
- An acyl group can also include heteroatoms within the meaning here.
- a nicotinoyl group (pyridyl-3-carbonyl) group is an example of an acyl group within the meaning herein.
- Other examples include acetyl, benzoyl, phenylacetyl, pyridylacetyl, cinnamoyl, and acryloyl groups and the like.
- the group containing the carbon atom that is bonded to the carbonyl carbon atom contains a halogen, the group is termed a "haloacyl" group.
- An example is a trifluoroacetyl group.
- amine includes primary, secondary, and tertiary amines having, e.g., the formula N(group) 3 wherein each group can independently be H or non- H, such as alkyl, aryl, and the like.
- Amines include but are not limited to R-NH 2 , for example, alkylamines, arylamines, alkylarylamines; R 2 NH wherein each R is independently selected, such as dialkylamines, diarylamines, aralkylamines, heterocyclylamines and the like; and R 3 N wherein each R is independently selected, such as trialkylamines, dialkylarylamines, alkyldiarylamines, triarylamines, and the like.
- the term "amine” also includes ammonium ions as used herein.
- amino group is a substituent of the form -NH 2 , -NHR, -NR 2 , - NR 3 + , wherein each R is independently selected, and protonated forms of each. Accordingly, any compound substituted with an amino group can be viewed as an amine.
- ammonium ion includes the unsubstituted ammonium ion NH 4 + , but unless otherwise specified, it also includes any protonated or quaternarized forms of amines. Thus, trimethylammonium hydrochloride and tetramethylammonium chloride are both ammonium ions, and amines, within the meaning herein.
- amide includes C- and N-amide groups, i.e., -C(O)NR 2 , and -NRC(O)R groups, respectively.
- Amide groups therefore include but are not limited to carbamoyl groups (-C(O)NH 2 ) and formamide groups (- NHC(O)H).
- a "carboxamido” group is a group of the formula C(O)NR 2 , wherein R can be H, alkyl, aryl, etc.
- carbonyl refers to a -C(O)- group.
- Halo include fluorine, chlorine, bromine and iodine.
- perhaloalkyl refers to an alkyl group where all of the hydrogen atoms are replaced by halogen atoms. Perhaloalkyl groups include, but are not limited to, -CF 3 and -C(CF 3 ) 3 .
- haloalkyl refers to an alkyl group where some but not necessarily all of the hydrogen atoms are replaced by halogen atoms. Haloalkyl groups include but are not limited to -CHF 2 and -CH 2 F.
- perhaloalkoxy refers to an alkoxy group where all of the hydrogen atoms are replaced by halogen atoms.
- Perhaloalkoxy groups include, but are not limited to, -OCF 3 and -OC(CF 3 ) 3 .
- haloalkoxy refers to an alkoxy group where some but not necessarily all of the hydrogen atoms are replaced by halogen atoms.
- Haloalkoxy groups include but are not limited to -OCHF 2 and -OCH 2 F.
- a “salt” as is well known in the art includes an organic compound such as a carboxylic acid, a sulfonic acid, or an amine, in ionic form, in combination with a counterion.
- acids in their anionic form can form salts with cations such as metal cations, for example sodium, potassium, and the like; with ammonium salts such as N3 ⁇ 4 + or the cations of various amines, including tetraalkyl ammonium salts such as tetramethylammonium, or other cations such as trimethylsulfonium, and the like.
- a “pharmaceutically acceptable” or “pharmacologically acceptable” salt is a salt formed from an ion that has been approved for human consumption and is generally non-toxic, such as a chloride salt or a sodium salt.
- a “zwitterion” is an internal salt such as can be formed in a molecule that has at least two ionizable groups, one forming an anion and the other a cation, which serve to balance each other. For example, amino acids such as glycine can exist in a zwitterionic form.
- a “zwitterion” is a salt within the meaning herein.
- the compounds of the present invention may take the form of salts.
- the term “salts" embraces addition salts of free acids or free bases which are compounds of the invention.
- Salts can be "pharmaceutical ly-acceptable salts.”
- pharmaceutically-acceptable salt refers to salts which possess toxicity profiles within a range that affords utility in pharmaceutical applications. Pharmaceutically unacceptable salts may nonetheless possess properties such as high crystallinity, which have utility in the practice of the present invention, such as for example utility in process of synthesis, purification or formulation of compounds of the invention.
- Suitable pharmaceutically-acceptable acid addition salts may be prepared from an inorganic acid or from an organic acid.
- inorganic acids include hydrochloric, hydrobromic, hydriodic, nitric, carbonic, sulfuric, and phosphoric acids.
- Appropriate organic acids may be selected from aliphatic, cycloaliphatic, aromatic, araliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids, examples of which include formic acetic, propionic, succinic, glycolic, gluconic, lactic, malic, tartaric, citric, ascorbic, glucuronic, maleic, fumaric, pyruvic, aspartic, glutamic, benzoic, anthranilic, 4-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic), methanesulfonic.
- ethanesulfonic benzenesulfonic, panthothenic, trifluoromethanesulfonic, 2-hydroxyethanesulfonic, p-toluenesulfonic, sulfanilic, cyclohexylaminosulfonic, stearic, alginic, ⁇ -hydroxybutyric, salicylic, galactaric and galacturonic acid.
- pharmaceutically unacceptable acid addition salts include, for example, perchlorates and tetrafluoroborates.
- Suitable pharmaceutically acceptable base addition salts of compounds of the invention include, for example, metallic salts including alkali metal, alkaline earth metal and transition metal salts such as, for example, calcium, magnesium, potassium, sodium and zinc salts.
- Pharmaceutically acceptable base addition salts also include organic salts made from basic amines such as, for example, N ⁇ V-dibenzylethylenediamine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine (N-methylglucamine) and procaine.
- Examples of pharmaceutically unacceptable base addition salts include lithium salts and cyanate salts.
- salts may be useful, for example as intermediates in the synthesis of Formula I compounds, for example in their purification by recrystallization. All of these salts may be prepared by conventional means from the corresponding compound according to Formula I by reacting, for example, the appropriate acid or base with the compound according to Formula I.
- pharmaceutically acceptable salts refers to nontoxic inorganic or organic acid and/or base addition salts, see, for example, Lit et al., Salt Selection for Basic Drugs (1986), Int J. Pharm., 33, 201-217, incorporated by reference herein.
- a "hydrate” is a compound that exists in a composition with water molecules.
- the composition can include water in stoichiometric quantities, such as a monohydrate or a dihydrate, or can include water in random amounts.
- a "hydrate” refers to a solid form, i.e., a compound in water solution, while it may be hydrated, is not a hydrate as the term is used herein.
- a “solvate” is a similar composition except that a solvent other that water replaces the water.
- a solvent other that water replaces the water.
- methanol or ethanol can form an “alcoholate”, which can again be stoichiometric or non-stoichiometric.
- a “solvate” refers to a solid form, i.e., a compound in solution in a solvent, while it may be solvated, is not a solvate as the term is used herein.
- a "prodrug” as is well known in the art is a substance that can be administered to a patient where the substance is converted in vivo by the action of biochemicals within the patient's body, such as enzymes, to the active pharmaceutical ingredient.
- prodrugs include esters of carboxylic acid groups, which can be hydrolyzed by endogenous esterases as are found in the bloodstream of humans and other mammals.
- Isotopes are well known in the art and refer to atoms with the same number of protons but different number of neutrons. For example, carbon 12, the most common form of carbon, has six protons and six neutrons, whereas carbon 14 has six protons and eight neutrons.
- the GLP-1 compounds, their pharmaceutically acceptable salts or hydrolyzable esters of the present invention may be combined with a pharmaceutically acceptable carrier to provide pharmaceutical compositions useful for treating the biological conditions or disorders noted herein in mammalian species, and more preferably, in humans.
- a pharmaceutically acceptable carrier may vary depending upon the type of administration desired (e.g., intravenous, oral, topical, suppository, or parenteral).
- compositions in oral liquid dosage forms e.g., suspensions, elixirs and solutions
- typical pharmaceutical media such as water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents and the like
- carriers such as starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like can be employed.
- compositions of the compounds of the invention alone or in combination with another GLP-1 agonist or another type of therapeutic agent or second medicament, or both.
- GLP-1 receptor agonists include exenatide, liraglutide, taspoglutide, albiglutide, lixisenatide, and mixtures thereof.
- the GLP-1 agonist is exenatide (Byetta®) or Byetta LAR®. Exenatide is described, for example, in U.S. Pat. Nos. 5,424,286; 6,902,744; 7,297,761, and others, the contents of each of which is herein incorporated by reference in its entirety.
- the GLP-1 agonist is liraglutide(VICTOZA®) (also called NN-2211 and [Arg34, Lys26]-(N-epsilon-(gamma-Glu(N-alpha-hexadecanoyl))- GLP-1 (7-37)), includes the sequence
- HAEGTFTSDVSSYLEGQAA EFIAWKVRGRG is available from Novo Nordisk (Denmark) or Scios (Fremont, Calif. USA). See, e.g., Elbrond et al., 2002, Diabetes Care. August; 25(8): 1398404; Agerso et al., 2002, Diabetologia. February; 45(2): 195- 202).
- the GLP-1 agonist is taspoglutide (CAS Registry No. 275371-94-3) and is available from Hoffman La-Roche. See, for example, U.S. Pat. No. 7,368,427, the contents of which are herein incorporated by reference in its entirety.
- the GLP-1 agonist isalbiglutide (SYNCRIA® from GlaxoSmithKline).
- the GLP-1 agonist is lixisenatide (Lyxumia® from Sanofi-Aventis/Zealand Pharma).
- Non-limiting examples of the second medicaments are as disclosed above.
- the second medicament is exenatide, liraglutide, taspoglutide, albiglutide, or lixisenatide or other insulin regulating peptide.
- the second medicament is a DPPIV inhibitor.
- the second medicament is medically indicated for the treatment of type II diabetes.
- the second medicament is a biguanide, a sulfonylurea, a meglitinide, a thiazolidinedione, an ⁇ -glucosidase inhibitor, a bile acid sequestrant, and/or a dopamine-2 agonist.
- the second medicament is metformin.
- the second medicament is sitagliptin.
- compositions containing a compound of the invention can be prepared by conventional techniques, e.g., as described in Remington: The Science and Practice of Pharmacy, 19th Ed., 1995, incorporated by reference herein.
- the compositions can appear in conventional forms, for example capsules, tablets, aerosols, solutions, suspensions or topical applications.
- compositions include a compound of the invention and a pharmaceutically acceptable excipient which can be a carrier or a diluent.
- the active compound will usually be mixed with a carrier, or diluted by a carrier, or enclosed within a carrier which can be in the form of an ampoule, capsule, sachet, paper, or other container.
- the active compound when the carrier serves as a diluent, it can be solid, semi-solid, or liquid material that acts as a vehicle, excipient, or medium for the active compound.
- the active compound can be adsorbed on a granular solid carrier, for example contained in a sachet.
- suitable carriers are water, salt solutions, alcohols, polyethylene glycols, polyhydroxyethoxylated castor oil, peanut oil, olive oil, gelatin, lactose, terra alba, sucrose, dextrin, magnesium carbonate, sugar, cyclodextrin, amylose, magnesium stearate, talc, gelatin, agar, pectin, acacia, stearic acid or lower alkyl ethers of cellulose, silicic acid, fatty acids, fatty acid amines, fatty acid monoglycerides and diglycerides, pentaerythritol fatty acid esters, polyoxyethylene, hydroxymethylcellulose and polyvinylpyrrolidone.
- the carrier or diluent can include any sustained release material known in the art, such as glyceryl monostearate or glyceryl distearate, alone or mixed with a wax.
- the formulations can be mixed with auxiliary agents which do not deleteriously react with the active compounds.
- auxiliary agents which do not deleteriously react with the active compounds.
- Such additives can include wetting agents, emulsifying and suspending agents, salt for influencing osmotic pressure, buffers and/or coloring substances preserving agents, sweetening agents or flavoring agents.
- the compositions can also be sterilized if desired.
- the route of administration can be any route which effectively transports the active compound of the invention to the appropriate or desired site of action, such as oral, nasal, pulmonary, buccal, subdermal, intradermal, transdermal or parenteral, e.g., rectal, depot, subcutaneous, intravenous, intraurethral, intramuscular, intranasal, ophthalmic solution or an ointment, the oral route being preferred.
- the carrier will typically comprise sterile water, although other ingredients that aid solubility or serve as preservatives can also be included.
- injectable suspensions can also be prepared, in which case appropriate liquid carriers, suspending agents and the like can be employed.
- the compounds of the present invention can be formulated using bland, moisturizing bases such as ointments or creams.
- the preparation can be tabletted, placed in a hard gelatin capsule in powder or pellet form or it can be in the form of a troche or lozenge. If a liquid carrier is used, the preparation can be in the form of a syrup, emulsion, soft gelatin capsule or sterile injectable liquid such as an aqueous or non-aqueous liquid suspension or solution.
- Injectable dosage forms generally include aqueous suspensions or oil suspensions which can be prepared using a suitable dispersant or wetting agent and a suspending agent Injectable forms can be in solution phase or in the form of a suspension, which is prepared with a solvent or diluent.
- Acceptable solvents or vehicles include sterilized water, Ringer's solution, or an isotonic aqueous saline solution.
- sterile oils can be employed as solvents or suspending agents.
- the oil or fatty acid is non-volatile, including natural or synthetic oils, fatty acids, mono-, di- or tri-glycerides.
- the formulation can also be a powder suitable for reconstitution with an appropriate solution as described above. Examples of these include, but are not limited to, freeze dried, rotary dried or spray dried powders, amorphous powders, granules, precipitates, or particulates.
- the formulations can optionally contain stabilizers, pH modifiers, surfactants, bioavailability modifiers and combinations of these.
- the compounds can be formulated for parenteral administration by injection such as by bolus injection or continuous infusion.
- a unit dosage form for injection can be in ampoules or in multi-dose containers.
- the formulations of the invention can be designed to provide quick, sustained, or delayed release of the active ingredient after administration to the patient by employing procedures well known in the art.
- the formulations can also be formulated for controlled release or for slow release.
- compositions contemplated by the present invention can include, for example, micelles or liposomes, or some other encapsulated form, or can be administered in an extended release form to provide a prolonged storage and/or delivery effect. Therefore, the formulations can be compressed into pellets or cylinders and implanted intramuscularly or subcutaneously as depot injections. Such implants can employ known inert materials such as silicones and biodegradable polymers, e.g., polylactide-polyglycolide. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides).
- the preparation can contain a compound of the invention, dissolved or suspended in a liquid carrier, preferably an aqueous carrier, for aerosol application.
- a liquid carrier preferably an aqueous carrier
- the carrier can contain additives such as solubilizing agents, e.g., propylene glycol, surfactants, absorption enhancers such as lecithin (phosphatidylcholine) or cyclodextrin, or preservatives such as parabens.
- injectable solutions or suspensions preferably aqueous solutions with the active compound dissolved in polyhydroxylated castor oil.
- Dosage forms can be administered daily, or more than once a day, such as twice or thrice daily. Alternatively dosage forms can be administered less frequently than daily, such as every other day, or weekly, if found to be advisable by a prescribing physician.
- Dosing regimens include, for example, dose titration to the extent necessary or useful for the indication to be treated, thus allowing the patient's body to adapt to the treatment and/or to minimize or avoid unwanted side effects associated with the treatment.
- Other dosage forms include delayed or controlled-release forms. Suitable dosage regimens and/or forms include those set out, for example, in the latest edition of the Physicians' Desk Reference, incorporated herein by reference.
- An embodiment of the invention also encompasses prodrugs of a compound of the invention which on administration undergo chemical conversion by metabolic or other physiological processes before becoming active pharmacological substances. Conversion by metabolic or other physiological processes includes without limitation enzymatic (e.g., specific enzymatically catalyzed) and non-enzymatic (e.g., general or specific acid or base induced) chemical transformation of the prodrug into the active pharmacological substance.
- prodrugs will be functional derivatives of a compound of the invention which are readily convertible in vivo into a compound of the invention. Conventional procedures for the selection and preparation of suitable prodrug derivatives are described, for example, in Design of Prodrugs, ed. H. Bundgaard, Elsevier, 1985.
- methods of making a composition of a compound described herein including formulating a compound of the invention with a pharmaceutically acceptable carrier or diluent.
- the pharmaceutically acceptable carrier or diluent is suitable for oral administration.
- the methods can further include the step of formulating the composition into a tablet or capsule.
- the pharmaceutically acceptable carrier or diluent is suitable for parenteral administration.
- the methods further include the step of lyophilizing the composition to form a lyophilized preparation.
- the compounds of the invention can be used therapeutically in combination with i) one or more other GLP-1 modulators and/or ii) one or more other types of therapeutic agents or second medicaments which can be administered orally in the same dosage form, in a separate oral dosage form (e.g., sequentially or non-sequentially) or by injection together or separately (e.g., sequentially or non-sequentially).
- combination therapeutic agents include Metformin, Sitagliptin (MK-0431 ,Januvia) an oral antihyperglycemic (antidiabetic drug) of the dipeptidyl peptidase-4 (DPP-4) inhibitor class and Exenatide (Byetta) an incretin mimetic.
- the second medicament is a biguanide such as metformin, a sulfonylurea such as glibenclamide, glipizide, gliclazide, and glimepiride, a meglitinide such as repaglinide and nateglinide, a thiazolidinedione such as pioglitazone and rosiglitazone, an oc-glucosidase inhibitor such as acarbose and miglitol, a bile acid sequestrant such as colesevelam, and/or a dopamine-2 agonist such as bromocriptine.
- a biguanide such as metformin, a sulfonylurea such as glibenclamide, glipizide, gliclazide, and glimepiride
- a meglitinide such as repaglinide and nateglinide
- a thiazolidinedione
- Combinations of the invention include mixtures of compounds from i) and ii) in a single formulation and compounds from i) and ii) as separate formulations. Some combinations of the invention can be packaged as separate formulations in a kit. In some embodiments, two or more compounds from ii) are formulated together while a compound of the invention is formulated separately.
- the present invention encompasses compounds that bind with high affinity and specificity to the GLP-1 receptor in an agonist manner or as an activator or a potentiator.
- a compound of the invention acts as a positive allosteric modulator of GLP-1 receptor.
- the present invention provides a method for activating, potentiating, or agonizing (i.e., to have an agonic effect, to act as an agonist) a GLP-1 receptor, with a compound of the invention.
- the method involves contacting the receptor with a suitable concentration of an inventive compound to bring about activation of the receptor.
- the contacting can take place in vitro, for example in carrying out an assay to determine the GLP-1 receptor activation activity of an inventive compound undergoing experimentation related to a submission for regulatory approval.
- the method for activating a GLP-1 receptor can also be carried out in vivo, that is, within the living body of a mammal, such as a human patient or a test animal.
- the inventive compound can be supplied to the living organism via one of the routes as described above, e.g., orally, or can be provided locally within the body tissues. In the presence of the inventive compound, activation of the receptor takes place, and the effect thereof can be studied.
- An embodiment of the present invention provides a method of treatment of a malcondition in a patient for which activation of an GLP-1 receptor is medically indicated, wherein the patient is administered the inventive compound in a dosage, at a frequency, and for a duration to produce a beneficial effect on the patient.
- the inventive compound can be administered by any suitable means, examples of which are described above.
- the present invention is directed to compounds adapted to act as modulators or potentiators of Class B GPCR 8 . These compounds may have activity on their own or in the presence of receptor ligands. Receptors include incretin peptides including GLP-l(7-36) and GLP-l(9-36).
- Methods of treatments provided by the invention include administration of a compound of the invention, alone or in combination with another pharmacologically active agent or second medicament to a subject or patient having a malcondition for which activation, potentiation or agonism of a glucagon-like peptide 1 receptor is medically indicated such as type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
- methods of treatment provided by the invention include administration of a compound of the invention for the treatment of nonalcoholic fatty liver disease (NAFLD) and/or non-alcoholic steatohepatitis (NASH).
- NAFLD nonalcoholic fatty liver disease
- NASH non-alcoholic steatohepatitis
- NAFLD is believed to be caused by the disruption of hepatic lipid homeostasis and, at least in a portion of patients, can progress to NASH.
- NAFLD is associated with insulin resistance in type 2 diabetes mellitus, and GLP1 increases insulin sensitivity and aids glucose metabolism.
- the compounds of this invention are beneficial in this context by serving to increase fatty acid oxidation, decrease lipogenesis, and/or improve hepatic glucose metabolism (see e.g., Lee et. al., Diabetes Metab. J.
- PG is a protecting group and X A and X B are CR 4 or N;
- DIEA 1,1,l-trifluoro-N-phenyl-N-((trifluoromethyl) sulfonyl) methanesulfonamide, DCM
- KOAc bis-pinacolatoborane, PdCl 2 (dppf) or Pd(dppf)Cl 2 , Na 2 CO 3 , THF, ACN, water;
- Pd(dppf)Cl 2 Na 2 CO 3 , THF, ACN, water;
- PG is a protecting group and X A and X B are CR 4 or N; (i) Pd(dppf)Cl 2 , Na 2 CO 3 , THF, ACN, water; (ii) Pd(dppf)Cl 2 , Na 2 CO 3 , THF, ACN, water; (iii) Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
- PG 1 and PG 2 are protecting groups; (i) DIE A, 1.1.1 -trifluoro-N-phenyl-.V-
- PG 1 and PG 2 are protecting groups and X A and X B are CR 4 or N;
- Deprotection of PG 2 e.g.
- PG is a protecting group;(i) (a) where R 2 is NR 1 -(CR a R b ) m -COOH: NHR 1 - (CR a R b ) m -COOPG, HATU, DMF then deprotection e.g., tert-butyl ester deprotection: DCM, TFA;(b) where R 2 is NH-SO 2 -R 8 : R 8 SO 2 NH 2 , DCC, DMAP, DCM (c) where R 2 is NR 41 R 42 : HNR 41 R 42 , HATU, DMF then deprotection e.g., tert-butyl ester deprotection: DCM, TFA; (d) where R 2 is N(R 1 )-(CR a R b )m-CO-N(R 1 )-heterocyclyl: HN(R 1 )-(CR a R b )m
- PG 1 and PG 2 are protecting groups and X A and X B are CR 4 or N;
- Deprotection of PG 1 e.g., tert-butyl ester deprotection: DCM, TFA;
- PG 1 and PG 2 are protecting groups and X A and X B are CR 4 or N;(i) Pd(dppf)Cl 2 , Na 2 CO 3 , THF, ACN, water; (ii) Deprotection of PG 2 , e.g., tert-butyl ester deprotection: DCM, TFA.
- PG 1 and PG 2 are protecting groups and X A and X B are CR 4 or N;
- (ii) Deprotection of PG 2 e.g.,tert- butyl ester deprotection: DCM, TFA.
- PG 1 , PG 2 , and PG3 are protecting groups; (i) Deprotection of PG 1 , e.g., tert- butyl ester deprotection: DCM, TFA; (ii) (a) where R 2 is NR 1 -(CR a R b ) m -COOH: NHR 1- (CR a R b ) m -COOPG 3 , HATU, DMF; (b) where R 2 is NH-SO 2 -R 8 : R 8 SO 2 NH 2 , DCC, DMAP, DCM (c) where R 2 is NR 41 R 42 : HNR 41 R 42 , HATU, DMF (d) where R 2 is N(R 1 )- (CR a R b )m-CO-N(R 1 )-heterocyclyl: HN(R 11 )-(CR a R b ) m -CO-N(R 1 )
- PG 1 and PG 2 are protecting groups and X A and X B are CR 4 or N;(i) Pd(dppf)Cl 2 , KOAc, Na 2 CO 3 , THF, ACN, water; (ii) Pd(dppf)Cl 2 , Na 2 CO 3 , THF, ACN, water.
- PG 1 , PG 2 , and PG 3 are protecting groups;
- (i) Deprotection of PG 2) e.g., Boc deprotection: 6N HC1 in isopropanol, DCM;
- (iii) Deprotection of PG 1 e.g., tert-butyl ester deprotection: DCM, TFA;
- (iv) (a) where R 2 is NH-(CR a R b ) m -COOH: NH 2 -(CR a R b ) m -COOPG 3 , HATU, DMF then deprotection
- Mass spectra were obtained using one of 6 systems.
- System la Agilent 1100/6110 HPLC system equipped with a Thompson ODS-A, 100A, 5 ⁇ (50 x 4.6 mm) column using water with 0.1% formic acid as the mobile phase A, acetonitrile with 0.1% formic acid as the mobile phase B, water with 5 mM ammonium acetate as the mobile phase C, and acetonitrile with 5 mM ammonium acetate as the mobile phase D with a flow rate of 1 mL/min.
- Method 1 20-100% mobile phase B (80- 0% A) over 2.5 min then held at 100% B for 2.5 min.
- Method 2 5% mobile phase B (95% A) for 1 min, 5-95% B over 9 min, then held at 95% B for 5 min.
- Method 3 20- 100% mobile phase B (80-0 % A) over 2.5 min then held at 100% B for 4.5 min.
- Method 12 5% D (95% C) for 1 min. then 5-95% D over 9 min. and held at 95% D for 5 min.
- System lb Agilent 1100/6110 HPLC system equipped with a Agilent Poroshell 120 EC-C8, 2.7 ⁇ (50 x 3 mm) column using water with 5 mM ammonium acetate as the mobile phase C, and acetonitrile with 5 mM ammonium acetate as the mobile phase D with a flow rate of 1 mL/min.
- Method 13 5% D (95% C) to 95% D over 12 min. then held at 95% D for 2.8 min. and to 5% D over 0.2 min.
- System 1c Agilent 1100/6110 HPLC system equipped with a Agilent Poroshell 120 EC-C18, 2.7 ⁇ (50 x 3 mm) column using water with 5 mM ammonium acetate as the mobile phase C, and acetonitrile with 5 mM ammonium acetate as the mobile phase D with a flow rate of 1 mL/min.
- Method 14 5% D (95% C) to 95% D over 12 min. then held at 95% D for 2.8 min. and then to 5% D over 0.2 min.
- Method 15 20% D (80% C) to 95% D over 3 min. and hold at 95% D 1.8 min then to 20% D over 0.2 min.
- Method 16 20% D (80% C) to 95% D over 3.0 min.
- System Id Agilent 1100/6110 HPLC system equipped with a Agilent Poroshell 120 EC-C8, 2.7 ⁇ (50 x 3 mm) column using water with 5 mM ammonium acetate as the mobile phase C, and acetonitrile with 5 mM ammonium acetate as the mobile phase D with a flow rate of 1 mL/min.
- Method 18 20% D (80% C) to 95% D over 3 min. and hold at 95% D 1.8 min then to 20% D over 0.2 min.
- Method 19 20% D (80% C) to 95% D over 3.0 min. and hold at 95% D for 3.8 min. then 20% D over 0.2 min.
- Method 20 5% D (95% C) to 95% D over 12 min then held at 95% D for 2.8 min. and then to 5% D over 0.2 min.
- System le Agilent 1100/6110 HPLC system equipped with a Waters X- Bridge C-8, 3.5 ⁇ (50 x 4.6 mm) column using water with 5 mM ammonium acetate as the mobile phase C, and acetonitrile with 5 mM ammonium acetate as the mobile phase D with a flow rate of 1 mL/min.
- Method 25 20% D (80% C) to 95% D over 3 min. then held at 95% D for 3.8 min. and then to 5% D over 0.2 min.
- Method 26 20% D (80% C) to 95% D over 3 min.
- Method 5 5-95% mobile phase B over 14 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
- System 3 Waters Fractionlynx LCMS system equipped with an Agilent Zorbax Extend RRHT 1.8 ⁇ m, (4.6 x 30 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
- Method 6 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
- Method 7 5-95% mobile phase B over 14 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
- System 4 Agilent 1260 LCMS equipped with an Agilent Zorbax Extend RRHT 1.8 ⁇ m (4.6 x 30 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
- Method 8 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
- Method 9 5-95% mobile phase B over 14 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
- System 5 Agilent 1260 LCMS equipped with a Waters Xselect CSH C18 3.5 ⁇ m (4.6 x 50 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
- Method 10 The gradient was 5- 95% mobile phase B over 13.0 min with a flow rate of 2.5 mL/min, then held at 95% for 1.0 min with a flow rate of 4.5 mL/min.
- Method 11 The gradient was 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 mL/min, then held at 95% for 0.6 min with a flow rate of 4.5 mL/min.
- System 6 Waters Acquity UPLC system equipped with a Acquity UPLC BEH C18, 1.7 ⁇ m (2.1 x 50 mm) or Phenomenex Kinetex C18, 1.7 ⁇ m (2.1 x 50 mm) column using water with 10 mM ammonium formate as mobile phase A, acetonitrile as mobile phase B with a flow rate of 0.5 mL/min.
- Method 17 10% mobile phase B (90% A) for 0.5 min, 10-95% B over 3 min, then held at 95% B for 1.1 min, 95-10% B over 0.1 min then held for 0.3 min and the total run time is 5 min.
- Method 23 20% mobile phase B (80% A) for 0.5 min, 20-95% B over 3 min, then held at 95% B for 1.1 min, 95-20% B over 0.1 min, then held for 0.3 min and the total run time is 5 min.
- Method 24 30% mobile phase B (70% A) for 0.5 min, 30-95% B over 2.2 min, then held at 95% B for 1.9 min, 95-30% B over 0.1 min, then held for 0.3 min and the total run time is 5 min.
- Method 27 40% mobile phase B (60% A) for 0.5 min, 40-95% B over 1.9 min, then held at 95% B for 2.2 min, 95-40% B over 0.1 min, then held for 0.3 min and the total run time is 5 min.
- Method 21 20% mobile phase B (80% A) for 0.5 min, 20-95% B over 2.7 min, then held at 95% B for 1.4 min, 95-20% B over 0.1 min, then held for 0.3 min and the total run time is 5 min.
- Method 22 40% mobile phase B (60% A) for 0.5 min, 40-95% B over 1.6 min, then held at 95% B for 2.5 min, 95-40% B over 0.1 min, then held for 0.3 min and the total run time is 5 min.
- EA ethyl acetate
- NMP 1 -methy-2-pyrrolidinone
- TEA triethylamine
- HOBt N- hydroxybenzotriazole
- EDC N,N-dimethylformamide
- DMF dimethyl acetamide
- DMA Di-tert-butyl dicarbonate
- Boc 2 O N,N-Diisopropylethylamine
- hydrochloric acid (HC1) O-(7-azabenzotriazol-1-yl)-N,N,N',N'- tetramethyluronium hexafluorophosphate
- DMAP 4-dimethylaminopyridine
- t-BuOH sodium hydride
- Chiral Method 2 Enantiomeric excess was determined by integration of peaks that were separated on a Daicel Chiralpak IC, 4.6 x 250 mm column, 5 ⁇ m particle size running an isocratic mixture of 76% (0.2% TFA in iso-hexanes), 19% DCM and 5% EtOH at a flow rate of 1.5 mL/min.
- the coupling reagent could be HATU (1.05 - 2.5 eq) optionally with DMAP (0.01 - 1 eq), EDC (1.5 eq) with HOBt (1.5 eq) or DMAP (0.01 - 1 eq), DCC (1.1 eq) with HOBt (1.1 eq) or DCC (1.5 eq) with DMAP (2.0 eq).
- reaction mixture was stirred until the reaction was complete.
- the reaction was diluted with EA and washed with saturated aqueous NaHCO 3 .
- the organic layer was dried over MgSO 4 and concentrated.
- the product was purified by chromatography or alternatively can be carried on to the next step without further purification.
- the reaction mixture was heated at 120 °C for 1 h in a microwave reactor.
- the reaction mixture was diluted with water (100 mL) and EA (50 mL) and filtered over Celite.
- the aqueous layer was extracted with EA (3 x 30 mL) and the combined organic layer was dried over MgSO 4 , concentrated, and purified by chromatography (EA / hexanes) to provide 342 mg (63%) of tert-butyl (S)-3-(4-(5-bromopyrimidin-2-yl)phenyl)-2-(5-( tert-buty)lthiophene-2- carboxamido)propanoate INT-17.
- PdCl 2 dppf (7.13 mg, 9.75 ⁇ m ⁇ ) was charged, the mixture de-gassed, then heated under reflux for 3 h. The reaction was allowed to cool to RT, poured onto water (50 mL) and extracted with EA (3 x 50 mL). The combined organic extracts were dried over Na 2 SO 4 and evaporated.
- reaction was allowed to stir at 0 °C for 2h and then allowed to warm to RT over 2h. Then the reaction mixture was diluted with saturated sodium bicarbonate solution (25 mL), water (25 mL) and EA (100 mL). The layers were separated and the aqueous layer was extracted with EA (2 x 100 mL). The combined organic layers were washed with water, brine and then dried over MgSO 4 and concentrated.
- PdCl 2 dppf (0.18 g, 0.25 mmol) was charged, the mixture was de-gassed again for 2 min, then heated at 70 °C for 7 h. The reaction mixture was allowed to cool to RT and then diluted with EA (20 mL) and water (20 mL). The layers were separated and the aquoues layer was extracted with EA (3 x 50 mL). The combined organic extracts were dried over MgSO 4 and solvent evaporated.
- Compound 2 was prepared from (R)-tert-butyl 2-((S)-3-(4-(5- bromopyrimidin-2-yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanamido) propanoate using General Procedures 10 then 8.
- reaction solution was degassed by nitrogen and was heated to 60 °C for 2 hours.
- the reaction solvent was evaporated under reduced pressure and then diluted in DCM (10 mL).
- the crude material was extracted with aqueous NaHCO 3 (2 x 3 mL).
- the combined organics were dried over M g SO 4 and the solvent was evaporated.
- To the crude material in 1 ml DCM was added 0.1 mL of TFA and stirred at room temperature for 18 hours.
- the reaction solution was degassed by nitrogen and was heated to 60 °C for 2 hours.
- the reaction solvent was evaporated under reduced pressure and then diluted in DCM (5 mL).
- the crude material was extracted with aqueous NaHCO 3 (2 x 1 mL).
- the combined organics were dried over MgSO 4 and the solvent was evaporated.
- the crude material was dissolved in 1 ml MeOH and 0.1 mL of aqueous IN NaOH and stirred at room temperature for 18 hours.
- PdCl 2 dppf (0.178 g, 0.24 mmol) was charged and the mixture heated under reflux. After 6 h, the mixture was diluted with water (200 mL) and acidified with acetic acid (3.41 mL, 48.6 mmol). After stirring for 1 h, the precipiate was collected by filtration, washed with water (2 x 30 mL) then MeOH (20 mL).
- Compound 41 was prepared from INT-71 using General procedures 10 and 18 sequentially.
- Compound 70 was prepared from INT-72 using General procedure 37.
- PdCl 2 (dppf) (0.352 g, 0.48 mmol) was added and the mixture heated under reflux for 1 h. The mixture was allowed to cool then diluted with water (200 mL), acidified with AcOH and extracted with EA (2 x 150 mL).
- Compound 82 was prepared from (S)-tert-butyl 3-(4-(5-bromopyrimidin- 2-yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanoate INT-17 using General Procedures 8, 10, 7 and 8 sequentially.
- Compound 83 was prepared from (S)-1-(3-(4-(5-bromopyrimidin-2- yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanoyl)azetidine-3-carboxylic acid INT-71 and (rs,4's)-4'-ethoxy-[1.1'-bi(cyclohexan)]-4-one using General Procedure 37.
- Compound 84 was prepared from (S)-1-(3-(4-(5-bromopyrimidin-2- yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanoyl)azetidine-3-carboxylic acid INT-71 and (1r.4r) -4'-ethoxy-[1.1'-bi(cyclohexan)]-4-one using General Procedure 37.
- reaction mixture was stirred at -78°C for 1 h, allowed to warm to room temperature over 2 h and saturated aqueous NH 4 CI (40 mL) was added.
- the reaction mixture was extracted with Et 2 O (100 mL) and the organic layer washed with water (100 mL) and brine (100 mL). The organic was then dried over MgSO 4 and solvents evaporated.
- the residue was purified by column chromatography (EA/iso-hexane) to afford 1.30 g (58%) of 2-methyl-4-(1 ,4- dioxaspiro[4.5]decan-8-yl)cyclohexanone as an off-white solid.
- Compound 85 was prepared from (S)-1-(3-(4-(5-bromopyrimidin-2- yl)phenyl)-2-(5 -(tert-butyl)thiophene-2-carboxamido)propanoyl)azetidine-3 -carboxy lie acid INT-71 and 4,4,5,5-tetramethyl-2-(3'-methyl-4'-propyl-[1,1'-bi(cyclohexan)]-3-en- 4-yl)-l,3,2-dioxaborolane using General Procedure 10.
- reaction mixture was stirred at -78°C for 30 min and then a solution of N-(5- chloropyridin-2-yl)- 1,1,1 -trifluoro-N-((trifluoromethyl)sulfonyl)methanesulfonamide (359 mg, 0.91 mmol) in THF (3 mL) was added.
- the reaction mixture was stirred at - 78°C for 30 min then at room temperature.
- a saturated solution of NaHCO 3 (20 mL) was added to the reaction mixture and the aqueous layer was extracted with EA (2 x 20 mL). The combined organic layers were dried over MgSO 4 and solvents evaporated.
- PdCl 2 (dppf) (6.16 mg, 8.41 ⁇ m ⁇ l) was added and the mixture again degassed then heated to 90°C for 3 h.
- the reaction mixture was partitioned with EA (20 mL) and water (20 mL).
- the aqueous layer was extracted once more with EA (20 mL).
- the combined organic layers were dried over MgSO 4 , filtered and solvents evaporated.
- Compound 86 was prepared from (S)-1-(3-(4-(5-bromopyrimidin-2- yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanoyl)azetidine-3-carboxylic acid INT-71 and 2-(4'-iso-butyl-[1,1 , -bi(cyclohexan)]-3-en-4-yl)-4,4,5,5-tetramethyl- 1,3,2-dioxaborolane using General Procedure 10. (1RS,1's,4'RS)-3-methyl-4'-propyl-[1,1'-bi(cyclohexan)l-4-one
- reaction mixture was stirred at -78°C for 1 h, allowed to warm to room temperature over 2 h and saturated aqueous NH 4 C1 (40 mL) was added.
- the reaction mixture was diluted with Et 2 O (100 mL) and the organic layer washed with water (100 mL) and brine (100 mL). The organic was then dried over MgSO 4 , filtered and solvents evaporated.
- the crude product was purified by column chromatography (EA/Iso-hexane) to afford 1.50 g (67%) of (1RS,1's,4'RS)-3-methyl-4'- propyl-[1,1 '-bi(cyclohexan)]-4-one as a pale yellow oil.
- Compound 87 was prepared from (S)-1-(3-(4-(5-bromopyrimidin-2- yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanoyl) azetidine-3-carboxylic acid INT-71 and (1RS,1's,4'RS)-3-methyl-4 , -propyl-[1,1 , -bi(cyclohexan)]-4-one using General Procedure 37.
- Compound 88 was prepared from (S)-1-(3-(4-(5-bromopyrimidin-2- yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanoyl)azetidine-3-carboxylic acid INT-71 and 2-(4'-(methoxymethyl)-[1,1'-bi(cyclohexan)]-3-en-4-yl)-4,4,5,5- tetramethyl-l,3,2-dioxaborolane using General Procedure 10. Trimethyl(((1RS,1's,4'RS)-3-methyl-4'-propyl-[1.1'-bi(cyclohexan)]-3-en-4- yl)oxy)silane
- Compound 89 was prepared from (S)-1-(3-(4-(5-bromopyrimidin-2- yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanoyl)azetidine-3-carboxylic acid INT-71 and 4,4,5,5-tetramethyl-2-((1RS,l's,4'RS)-3-methyl-4 , -propyl-[1,1'- bi(cyclohexan)]-3-en-4-yl)-l,3,2-dioxaborolane using General Procedure 10. l-(4-(benzyloxy)phenyl)-4,4-dimethylcyclohexanol
- Compound 90 was prepared from (S)-1-(3-(4-(5-bromopyrimidin-2- yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanoyl)azetidine-3-carboxylic acid INT-71 and 2-(4',4 , -dimethyl-[1.1'-bi(cyclohexan)]-3-en-4-yl)-4,4,5,5-tetramethyl- 1,3,2-dioxaborolane using General Procedure 10.
- reaction was allowed to stir at 0 °C for 2h and then allowed to warm to RT for 16 h. Then the reaction mixture was diluted with saturated sodium bicarbonate solution (5 mL), water (5 mL) and EA (10 mL). The layers were separated and the aqueous layer was extracted with EA (2 x 10 mL). The combined organic layers were washed with IN hydrochloric acid, water, brine and then dried over MgSO 4 and concentrated.
- Compound 91 was prepared from INT-73 using General Procedure 10 with racemic 4,4,5 ,5-tetramethyl-2-(( 1 RS, 1 'r,4'RS)-4'-methyl-[ 1 , 1 -bi(cyclohexan)] -3- en-4-yl)-l,3,2-dioxaborolane followed by General Procedure 8.
- Compound 92 was prepared from INT-73 using General Procedure 10 with 2-(4 , ,4'-dimethyl-[1,1'-bi(cyclohexan)]-3-en-4-yl)-4,4,5,5-tetramethyl-l ,3,2- dioxaborolane and then General Procedure 8.
- Compound 93 was prepared from INT-73 using General Procedure 10 with racemic 2-(( IRS, 1 ⁇ ,4 ⁇ 5)-4'- ⁇ 1-[1 , l'-bi(cyclohexan)]-3-en-4-yl)-4,4,5,5- tetramethyl-l,3,2-dioxaborolane followed by General Procedure 8.
- PdCl 2 (dppf) (0.356 g, 0.487 mmol) was added and the mixture heated under reflux. After 3 h, the mixture was allowed to cool then poured onto a mixture of ice-water (75 mL) and 1 M HC1 (125 mL). The precipitate was collected by filtration, washing with water (50 mL). The solid was re-slurried from ACN (150 mL) then purified by column chromatography (AcOH/THF/DCM/iso-hexanes).
- the PdCl 2 dppf (6.18 g, 8.44 mmol) was charged and the mixture heated under gentle reflux for 6 h. The mixture was allowed to cool to 40 °C then treated with water (1.8 L) and cooled to 20 °C. The precipitate was collected by filtration. The reaction vessel was washed out with acetone (250 mL) and this solution treated with water (300 mL) to afford a second crop of precipitate that was combined with the bulk material. The precipitated solid was washed successively with water (2 x 500 mL) and iso-hexanes (2 x 500 mL). This was then slurried in EtOH (550 mL) and heated under reflux for 30 min.
- Compound 120 was prepared from (S)-tert-butyl 3-(4-(5- bromopyrimidin-2-yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanoate INT-17 using General Procedure 8 followed by General Procedure 10 using 2-([1, - bi(cyclohexan)]-3-en-4-yl)-4,4,5,5-tetramethyl-l,3,2-dioxaborolane. 8-(4-propyrphenyl) - 1.4-dioxaspiro[4.5]decan-8-ol
- Compound 121 was prepared from (S)-terf-butyl 3-(4-(5- bromopyrimidin-2-yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanoate INT-17 using General Procedure 8 followed by General Procedure 10 using 4,4,5,5- tetramethyl-2-(4'-propyl- 1 ,2,3,6-tetrahydro-[ 1 , 1 -biphenyl]-4-yl)- 1 ,3,2-dioxaborolane.
- Compound 122 was prepared from (S)-tert-butyl 3-(4-(5- bromopyrimidin-2-yl)phenyl)-2-(5-(tert-butyl)thiophene-2-carboxamido)propanoate INT-17 using General Procedure 8 followed by General Procedure 10 using 2-(4',4'- dimethyl-[1.1'-bi(cyclohexan)] -3-en-4-y l)-4,4,5,5-tetramethyl- 1 ,3,2-dioxaborolane.
- Compound 124 was prepared from (S)-tert-butyl 3-(4-(5- bromopyrimidin-2-yl)phenyl)-2-(5-(te ⁇ butyl)thiophene-2-carboxamido)propanoate R- INT-17 using General Procedures 8, 7, 4 and 4,4,5,5-tetramethyl-2-(4'-propyl-l,2,3,6- tetrahydro-[1,1'-biphenyl]-4-yl)-l,3,2-dioxaborolane in step 10 sequentially.
- GLP-1 PAM shift cAMP assay dose response of peptide ligand in presence of fixed concentration of compound.
- a GLP-1 R expressing CRE-bla CHO-K1 cell line was purchased from Invitrogen. Cells were seeded into 384-well white flat bottom plates at 5000 ⁇ L growth media (DMEM-High glucose, 10% dialyzed FBS, 0.1 mM NEAA, 25 mM Hepes, lOOU/mL penicillin/100 ⁇ g/nlL streptomycin, 5 ⁇ g/mL Blasticidin, 600 ⁇ g/mL Hygromycin) and incubated for 18 h at 37°C in 5% CO 2 . Growth medium was replaced with 12 ⁇ ⁇ assay buffer (Hanks Balanced Salt solution, 10 mM Hepes, 0.1% BSA, pH 7.4).
- a 5x peptide dose response curve (12-point) was generated in assay buffer containing 1.5 mM IBMX, 12.5% DMSO, and 50 ⁇ compound.
- Peptide ligand was GLP-1 (9-36).
- the 5x peptide dose response plus compound mix was added (3 ⁇ L) and cells were incubated for 30 min at 37°C.
- Direct detection of cAMP was carried out using DiscoveRx HitHunter cAMP kit according to manufacturer's instructions and luminescence was read using a SpectraMax M5 plate reader. Luminescence was analyzed by non-linear regression to determine the EC50 and Emax.
- a GLP-1 (7-36) dose response was included to determine maximum efficacy.
- GLP-1R CRE-bla CHO-K1 cells cultured in growth medium (DMEM- High glucose, 10% dialyzed FBS, 0.1 mM NEAA, 25 mM Hepes, lOOU/mL penicillin/1 O g/mL streptomycin, 5 ⁇ g/mL Blasticidin, 600 ⁇ g/mL Hygromycin) were trypsinized and plated in suspension into 384 well white flat bottom plates at 5000 cells/well in 12 ⁇ L assay buffer (Hanks Balanced Salt solution, 10 mM Hepes, 0.1% BSA, pH 7.4). A 5x compound dose response curve (12-point) was generated in assay buffer containing 1.5 mM IBMX, 4% DMSO.
- GLP-1 (9-36) was diluted to 4.2 ⁇ in assay buffer containing 1.5 mM IBMX and 4% DMSO. The 5x compound dose response was added (3 ⁇ L), followed by 0.5 ⁇ L of GLP- 1(9-36) and cells were incubated for 30 min at 37°C. Direct detection of cAMP was carried out using DiscoveRx HitHunter cAMP kit according to manufacturer's instructions and luminescence was read using a SpectraMax M5 plate reader. Luminescence was converted to total cAMP using a cAMP standard curve and data was analyzed by nonlinear regression to determine the EC50 and Emax.
- GLP-l(7-36) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH 2
- GLP- 1(9-36) EGTFTSDVSSYLEGQAAKEFIAWLV GR-NH 2 .
- GLP- 1(7-36) was purchased from GenScript.
- GLP- 1(9-36) was purchased from Biopeptide Co., Inc.
- Activity data for representative GLP-1 modulators are displayed in Table 2.
- the EC 2 oGLP- 1(9-36) PAM Activity range is denoted as follows: + denotes activity ⁇ 0.5 ⁇ , ++ denotes activity between 0.5 and 2.5 ⁇ , +++ denotes activity between 2.5 and 5 ⁇ , and ++++ denotes activity 5 to 10 ⁇ .
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Diabetes (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Gastroenterology & Hepatology (AREA)
- Endocrinology (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Emergency Medicine (AREA)
- Child & Adolescent Psychology (AREA)
- Zoology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Plural Heterocyclic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Nitrogen Condensed Heterocyclic Rings (AREA)
- Peptides Or Proteins (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES15745738T ES2819534T3 (es) | 2014-07-25 | 2015-07-24 | Derivados de pirimidina como moduladores del receptor GLP-1 |
| EA201790254A EA032525B1 (ru) | 2014-07-25 | 2015-07-24 | Модуляторы рецептора glp-1 |
| KR1020177003172A KR102564946B1 (ko) | 2014-07-25 | 2015-07-24 | 신규 glp-1 수용체 조절제 |
| MX2017000972A MX382502B (es) | 2014-07-25 | 2015-07-24 | Nuevos moduladores del receptor de peptido similar a glucagon 1 (glp-1). |
| EP15745738.3A EP3172199B1 (en) | 2014-07-25 | 2015-07-24 | Pyrimidine derivatives as glp-1 receptor modulators |
| SG11201700364PA SG11201700364PA (en) | 2014-07-25 | 2015-07-24 | Novel glp-1 receptor modulators |
| JP2017525324A JP6556237B2 (ja) | 2014-07-25 | 2015-07-24 | 新規のglp−1受容体モジュレーター |
| CN201580046095.3A CN107074820B (zh) | 2014-07-25 | 2015-07-24 | Glp-1受体调节剂 |
| AU2015292356A AU2015292356B2 (en) | 2014-07-25 | 2015-07-24 | Novel GLP-1 receptor modulators |
| CA2955836A CA2955836C (en) | 2014-07-25 | 2015-07-24 | Glp-1 receptor modulators |
| IL249896A IL249896B (en) | 2014-07-25 | 2017-01-02 | New modulators for the glp-1 receptor and their use as drugs |
| ZA2017/00342A ZA201700342B (en) | 2014-07-25 | 2017-01-16 | Novel glp-1 receptor modulators |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462028962P | 2014-07-25 | 2014-07-25 | |
| US62/028,962 | 2014-07-25 | ||
| US201462090040P | 2014-12-10 | 2014-12-10 | |
| US62/090,040 | 2014-12-10 | ||
| US201562161650P | 2015-05-14 | 2015-05-14 | |
| US62/161,650 | 2015-05-14 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016015014A1 true WO2016015014A1 (en) | 2016-01-28 |
Family
ID=53777037
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/042114 Ceased WO2016015014A1 (en) | 2014-07-25 | 2015-07-24 | Novel glp-1 receptor modulators |
Country Status (14)
| Country | Link |
|---|---|
| US (2) | US9474755B2 (https=) |
| EP (1) | EP3172199B1 (https=) |
| JP (2) | JP6556237B2 (https=) |
| KR (1) | KR102564946B1 (https=) |
| CN (2) | CN107074820B (https=) |
| AU (1) | AU2015292356B2 (https=) |
| CA (1) | CA2955836C (https=) |
| EA (1) | EA032525B1 (https=) |
| ES (1) | ES2819534T3 (https=) |
| IL (1) | IL249896B (https=) |
| MX (1) | MX382502B (https=) |
| SG (1) | SG11201700364PA (https=) |
| WO (1) | WO2016015014A1 (https=) |
| ZA (1) | ZA201700342B (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018064476A1 (en) | 2016-09-30 | 2018-04-05 | Celgene International Ii Sarl | Dimethylaminoethanol salt of a glp-1 receptor modulator |
Families Citing this family (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP6007417B2 (ja) | 2011-05-31 | 2016-10-12 | レセプトス エルエルシー | 新規glp−1受容体安定剤および調節剤 |
| CN109867630A (zh) | 2013-06-11 | 2019-06-11 | 赛尔基因第二国际有限公司 | 新型glp-1受体调节剂 |
| CA2955836C (en) * | 2014-07-25 | 2023-02-14 | Celgene International Ii Sarl | Glp-1 receptor modulators |
| ES2844573T3 (es) | 2014-12-10 | 2021-07-22 | Receptos Llc | Moduladores del receptor de GLP-1 |
| WO2018200833A1 (en) * | 2017-04-28 | 2018-11-01 | Celgene International Ii Sarl | Novel glp-1 receptor modulators |
| WO2020210582A1 (en) * | 2019-04-11 | 2020-10-15 | University Of The Sciences | Allosteric agonists and positive allosteric modulators of glucagon-like peptide 1 receptor |
| HRP20241159T1 (hr) | 2020-02-07 | 2024-12-06 | Gasherbrum Bio, Inc. | Heterociklički agonisti za glp-1 |
| TW202206429A (zh) | 2020-04-29 | 2022-02-16 | 美商迦舒布魯姆生物有限公司 | 雜環glp—1促效劑 |
| JP2023537501A (ja) | 2020-08-06 | 2023-09-01 | ガシャーブラム・バイオ・インコーポレイテッド | ヘテロ環glp-1アゴニスト |
| CN112121152B (zh) * | 2020-09-25 | 2021-06-22 | 南京大学 | 利司那肽在制备抗肿瘤药物中的应用 |
| CN112898133B (zh) * | 2021-01-27 | 2022-11-15 | 河北迈尔斯通电子材料有限公司 | 一种反式酮类中间体的制备方法 |
| JP2025509281A (ja) | 2022-03-09 | 2025-04-11 | ガシャーブラム・バイオ・インコーポレイテッド | ヘテロ環式glp-1アゴニスト |
| US20250206757A1 (en) | 2022-03-21 | 2025-06-26 | Gasherbrum Bio, Inc. | 5,8-dihydro-1,7-naphthyridine derivatives as glp-1 agonists for the treatment of diabetes |
| US20250250269A1 (en) | 2022-04-14 | 2025-08-07 | Gasherbrum Bio, Inc. | Heterocyclic glp-1 agonists |
| CN120981457A (zh) | 2023-09-14 | 2025-11-18 | 歌礼制药(中国)有限公司 | Glp-1r激动剂及其治疗方法 |
| TW202521534A (zh) | 2023-11-24 | 2025-06-01 | 香港商歌禮製藥(中國)有限公司 | Glp-1r 激動劑及其治療方法 |
| KR20250113341A (ko) | 2024-01-18 | 2025-07-25 | 주식회사 티에치팜 | 나트륨 포도당 운반체-2 저해제 및 안지오텐신 ⅱ 수용체 차단제를 함유하는 비만 예방 또는 치료용 약학적 조성물 |
| WO2025158275A1 (en) | 2024-01-24 | 2025-07-31 | Pfizer Inc. | Combination therapy using glucose-dependent insulinotropic polypeptide receptor antagonist compounds and glp-1 receptor agonist compounds |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013090454A2 (en) * | 2011-12-12 | 2013-06-20 | Receptos, Inc. | Novel glp-1 receptor modulators |
Family Cites Families (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IT1062206B (it) | 1974-02-01 | 1983-09-20 | Rotta Research Lab S P A A S | Derivati della tirosina attivi sulla muscolatura liscia |
| DE2423536A1 (de) | 1974-05-15 | 1975-11-27 | Bayer Ag | 3-amino-phenylessigsaeure-derivate, verfahren zu ihrer herstellung sowie ihre verwendung als herbizide |
| US5424286A (en) | 1993-05-24 | 1995-06-13 | Eng; John | Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same |
| US6174905B1 (en) | 1996-09-30 | 2001-01-16 | Mitsui Chemicals, Inc. | Cell differentiation inducer |
| DE122007000044I2 (de) | 1997-01-07 | 2011-05-05 | Amylin Pharmaceuticals Inc | Verwendung von exedinen und deren antagonisten zur verminderung der lebensmittelaufnahme |
| US6583139B1 (en) | 1997-07-31 | 2003-06-24 | Eugene D. Thorsett | Compounds which inhibit leukocyte adhesion mediated by VLA-4 |
| PL338457A1 (en) * | 1997-07-31 | 2000-11-06 | Elan Pharm Inc | Sulphonylated dipeptidic compounds capable to inhibit adhesion of leucocytes through the mediation of vla-4 |
| EP1005445B1 (en) | 1997-08-22 | 2004-05-26 | F. Hoffmann-La Roche Ag | N-alkanoylphenylalanine derivatives |
| US6191171B1 (en) | 1997-11-20 | 2001-02-20 | Merck & Co., Inc. | Para-aminomethylaryl carboxamide derivatives |
| EP1992641A3 (en) | 1998-12-07 | 2009-07-29 | Ipsen Pharma | GLP-1 analogues |
| US6902744B1 (en) | 1999-01-14 | 2005-06-07 | Amylin Pharmaceuticals, Inc. | Exendin agonist formulations and methods of administration thereof |
| TR200401217T4 (tr) | 2000-03-07 | 2004-06-21 | Aventis Pharma Deutschland Gmbh | İkameli 3-Fenil-5-Alkoksi-1,3,4-Oksdiazol-2-one (ve) hormona duyarlı lipazın önlenmesinde kullanılması |
| WO2003048081A2 (en) | 2001-12-04 | 2003-06-12 | Bristol-Myers Squibb Company | Glycinamides as factor xa inhibitors |
| EP1477482B1 (en) | 2002-02-20 | 2010-04-14 | Ajinomoto Co., Inc. | Novel phenylalanine derivative |
| US7345049B2 (en) | 2003-12-22 | 2008-03-18 | Ajinomoto Co., Inc. | Phenylalanine derivatives |
| CA2555594A1 (en) * | 2004-02-10 | 2005-08-25 | Janssen Pharmaceutica N.V. | Pyridazinones as antagonists of a4 integrins |
| US7825139B2 (en) | 2005-05-25 | 2010-11-02 | Forest Laboratories Holdings Limited (BM) | Compounds and methods for selective inhibition of dipeptidyl peptidase-IV |
| US7816324B2 (en) | 2007-03-13 | 2010-10-19 | Board Of Regents, The University Of Texas System | Composition and method for the treatment of diseases affected by a peptide receptor |
| CA2688136A1 (en) | 2007-06-08 | 2008-12-11 | Advinus Therapeutics Private Limited | Pyrrole-2-carboxamide derivatives as glucokinase activators, their process and pharmaceutical application |
| EA018225B1 (ru) * | 2008-03-07 | 2013-06-28 | Транстек Фарма, Инк. | Соединения оксадиазоантрацена для лечения диабета |
| WO2011094890A1 (en) | 2010-02-02 | 2011-08-11 | Argusina Inc. | Phenylalanine derivatives and their use as non-peptide glp-1 receptor modulators |
| CN102946882B (zh) * | 2010-02-02 | 2016-05-18 | 格斯有限公司 | 苯基丙氨酸衍生物及其作为非肽glp-1受体调节剂的用途 |
| JP2013530963A (ja) | 2010-06-09 | 2013-08-01 | レセプトス インコーポレイテッド | 新規のglp−1受容体安定化薬および調節薬 |
| TWI523844B (zh) * | 2011-01-26 | 2016-03-01 | 賽諾菲公司 | 經胺基取代之3-雜芳醯基胺基-丙酸衍生物及其作為藥物之用途 |
| JP6007417B2 (ja) | 2011-05-31 | 2016-10-12 | レセプトス エルエルシー | 新規glp−1受容体安定剤および調節剤 |
| CN109867630A (zh) * | 2013-06-11 | 2019-06-11 | 赛尔基因第二国际有限公司 | 新型glp-1受体调节剂 |
| CA2955836C (en) * | 2014-07-25 | 2023-02-14 | Celgene International Ii Sarl | Glp-1 receptor modulators |
-
2015
- 2015-07-24 CA CA2955836A patent/CA2955836C/en active Active
- 2015-07-24 EA EA201790254A patent/EA032525B1/ru not_active IP Right Cessation
- 2015-07-24 CN CN201580046095.3A patent/CN107074820B/zh not_active Expired - Fee Related
- 2015-07-24 AU AU2015292356A patent/AU2015292356B2/en not_active Ceased
- 2015-07-24 WO PCT/US2015/042114 patent/WO2016015014A1/en not_active Ceased
- 2015-07-24 MX MX2017000972A patent/MX382502B/es unknown
- 2015-07-24 SG SG11201700364PA patent/SG11201700364PA/en unknown
- 2015-07-24 CN CN202011261790.0A patent/CN112457301A/zh active Pending
- 2015-07-24 ES ES15745738T patent/ES2819534T3/es active Active
- 2015-07-24 US US14/809,020 patent/US9474755B2/en active Active
- 2015-07-24 KR KR1020177003172A patent/KR102564946B1/ko active Active
- 2015-07-24 JP JP2017525324A patent/JP6556237B2/ja not_active Expired - Fee Related
- 2015-07-24 EP EP15745738.3A patent/EP3172199B1/en active Active
-
2016
- 2016-09-13 US US15/263,637 patent/US9839664B2/en active Active
-
2017
- 2017-01-02 IL IL249896A patent/IL249896B/en active IP Right Grant
- 2017-01-16 ZA ZA2017/00342A patent/ZA201700342B/en unknown
-
2019
- 2019-06-10 JP JP2019107866A patent/JP2019142984A/ja active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013090454A2 (en) * | 2011-12-12 | 2013-06-20 | Receptos, Inc. | Novel glp-1 receptor modulators |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018064476A1 (en) | 2016-09-30 | 2018-04-05 | Celgene International Ii Sarl | Dimethylaminoethanol salt of a glp-1 receptor modulator |
| US11066395B2 (en) | 2016-09-30 | 2021-07-20 | Receptos Llc | Dimethylaminoethanol salt of a GLP-1 receptor modulator |
Also Published As
| Publication number | Publication date |
|---|---|
| US20160038487A1 (en) | 2016-02-11 |
| US20170216392A1 (en) | 2017-08-03 |
| JP2019142984A (ja) | 2019-08-29 |
| IL249896B (en) | 2021-02-28 |
| CN107074820A (zh) | 2017-08-18 |
| EA201790254A1 (ru) | 2017-07-31 |
| ZA201700342B (en) | 2018-12-19 |
| US9839664B2 (en) | 2017-12-12 |
| SG11201700364PA (en) | 2017-02-27 |
| CN107074820B (zh) | 2021-05-18 |
| MX2017000972A (es) | 2017-07-27 |
| EP3172199A1 (en) | 2017-05-31 |
| CN112457301A (zh) | 2021-03-09 |
| ES2819534T3 (es) | 2021-04-16 |
| AU2015292356A1 (en) | 2017-02-02 |
| JP2017526734A (ja) | 2017-09-14 |
| AU2015292356B2 (en) | 2020-02-06 |
| CA2955836A1 (en) | 2016-01-28 |
| EP3172199B1 (en) | 2020-07-01 |
| KR102564946B1 (ko) | 2023-08-08 |
| MX382502B (es) | 2025-03-13 |
| JP6556237B2 (ja) | 2019-08-07 |
| CA2955836C (en) | 2023-02-14 |
| KR20170040233A (ko) | 2017-04-12 |
| IL249896A0 (en) | 2017-03-30 |
| US9474755B2 (en) | 2016-10-25 |
| EA032525B1 (ru) | 2019-06-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3172199B1 (en) | Pyrimidine derivatives as glp-1 receptor modulators | |
| EP2791112B1 (en) | Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes | |
| KR102271179B1 (ko) | 신규의 glp-1 수용체 조절제 | |
| EP3615524B1 (en) | Novel glp-1 receptor modulators | |
| KR102497644B1 (ko) | Glp-1 수용체 조절제 | |
| HK40042919A (en) | Novel glp-1 receptor modulators | |
| NZ626122B2 (en) | Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes | |
| HK1202864B (en) | Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes | |
| NZ715006B2 (en) | Novel glp-1 receptor modulators |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15745738 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 249896 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2955836 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/000972 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2017525324 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2015292356 Country of ref document: AU Date of ref document: 20150724 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20177003172 Country of ref document: KR Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015745738 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015745738 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201790254 Country of ref document: EA |