WO2015092335A2 - Proteines recombinantes possedant une activite de facteur h - Google Patents

Proteines recombinantes possedant une activite de facteur h Download PDF

Info

Publication number
WO2015092335A2
WO2015092335A2 PCT/FR2014/053484 FR2014053484W WO2015092335A2 WO 2015092335 A2 WO2015092335 A2 WO 2015092335A2 FR 2014053484 W FR2014053484 W FR 2014053484W WO 2015092335 A2 WO2015092335 A2 WO 2015092335A2
Authority
WO
WIPO (PCT)
Prior art keywords
factor
sequence
domains
scr20
scr1
Prior art date
Application number
PCT/FR2014/053484
Other languages
English (en)
Other versions
WO2015092335A3 (fr
Inventor
Toufik ABACHE
Original Assignee
Laboratoire Francais Du Fractionnement Et Des Biotechnologies
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Laboratoire Francais Du Fractionnement Et Des Biotechnologies filed Critical Laboratoire Francais Du Fractionnement Et Des Biotechnologies
Priority to JP2016541495A priority Critical patent/JP2017500049A/ja
Priority to US15/105,829 priority patent/US20170190753A1/en
Priority to EP14830995.8A priority patent/EP3083664A2/fr
Priority to CA2934558A priority patent/CA2934558A1/fr
Publication of WO2015092335A2 publication Critical patent/WO2015092335A2/fr
Publication of WO2015092335A3 publication Critical patent/WO2015092335A3/fr

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/472—Complement proteins, e.g. anaphylatoxin, C3a, C5a
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027—New or modified breeds of vertebrates
    • A01K67/0275—Genetically modified vertebrates, e.g. transgenic
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag

Definitions

  • the invention relates to a recombinant protein having an H factor activity.
  • Factor H is a 155 kDa plasma protein whose main function is the regulation of complement activity induced by the alternative pathway.
  • Factor H is composed of 20 short repeat consensus (SCR) domains (also called CCP or SHUSHI) of about 60 amino acids linked together by a short linker sequence of 3 to 8 amino acids.
  • SCR1-4 domains carry the activity of accelerating the dissociation of C3 and C5 convertases and the factor I regulatory activity which allows the inactivation of the C3b protein.
  • SCR1-4 domains carry the activity of accelerating the dissociation of C3 and C5 convertases and the factor I regulatory activity which allows the inactivation of the C3b protein.
  • These N-terminal domains are sufficient to regulate the activity of C3 convertase in the liquid phase, but the SCR19-20 domains are necessary for the activity of factor H on the cell surface.
  • the other Factor H SCR domains may also contribute more or less directly to the activity of the factor H, some containers of the binding sites for other molecules such as heparan sulfates and glycosaminoglycans, pentraxins (CRP, PTX3), fibromodulin or malondialdehyde. Some of these domains also contain glycosylation sites that may contribute to the half-life of the molecule and the efficiency of its production in recombinant form, others may have an important role for the three-dimensional conformation of factor H, as for example, SCR12, SCR13, SCR14 domains which confer on the H factor a particular hairpin-like folding (Schmidt et al., J. Mol Biol., 2010 January 08; 395 (1): 105-122).
  • Factor H is a promising therapeutic factor for the treatment of many diseases related to dense deposits of C3 or complement activation or uncontrolled inflammation.
  • AMD age-related macular degeneration
  • type 2 GNMP Glomerulonephritis Membrano -Proliferate
  • atypical HUS Uremic Hemorrhagic Syndrome
  • certain autoimmune diseases the use of Factor H could be limited due to some disadvantages: bioavailability, pharmacokinetics and pharmacodynamics, immunogenicity, heparan sulfate binding, binding to unidentified ligands, binding to pathogens allowing immune escape (S. pneumoniae, N.meningitidis, ...) and These disadvantages are related to the molecular properties of the factor H and thus to the organization of the SCR domains of the factor H.
  • a factor H derivative combining the CRI to SCR4 S domains with the S CRI 9 and SCR20 H factor domains has been proposed.
  • this factor H derivative constructed to direct the activity of factor H on the cell surface the two domains of complement regulation and surface recognition are linked together by the 6 naturally occurring amino acids found between the fourth domain cysteine. SCR4 and the first cysteine of the SCR19 domain.
  • the Applicant here responds to this need by proposing recombinant proteins derived from factor H having a rearrangement of the number and organization of SCR domains of factor H which retain an activity of factor H.
  • the recombinant proteins according to the invention comprise at least one the SCR1-4 domains (SCR1, SCR2, SCR3 and SCR4, in that order), SCR19 and SCR20 of the H factor.
  • An object of the invention therefore relates to a recombinant protein having a factor H activity, comprising, from the N-terminus to the C-terminus, a first amino acid sequence comprising at least the domains SCR1 to SCR4 of factor H, and a second amino acid sequence comprising at least the domains SCR19 and SCR20 of factor H, said recombinant protein not being a natural factor H, and provided that if the first sequence consists of domains SCR1 to SCR4 and the second sequence consists of domains SCR19 and SCR20, the linker is a synthetic linker.
  • the subject of the invention is also a nucleic acid encoding a recombinant protein according to the invention, a vector comprising such a nucleic acid, a host cell comprising such a nucleic acid or such a vector and a transgenic animal whose genome comprises such a nucleic acid.
  • the invention also relates to a recombinant protein according to the invention, for the treatment of diseases due to uncontrolled inflammation or deposition of uncontrolled C3 convertase. More generally, the recombinant protein according to the invention may be useful for the treatment of any disease for which anti-complement factor H activity is beneficial.
  • the present invention relates to a factor H-derived recombinant protein having a rearrangement of the SCR domains, both in terms of their number and their organization, said recombinant protein comprising, in this order, a first sequence of acids. amino acids comprising the H-factor SCR1-4 domains and a second amino acid sequence comprising the F-factor SCR19 and SCR20 domains. The first and / or second amino acid sequence may further comprise one or more other factor SCR domains. H rearranged
  • one or more SCR domains of the factor H may be present in multiple copies.
  • a recombinant protein according to the invention may include one, two, three, or more than three copies of the same SCR, for example one, two, three or more than three copies of the domain SCR1, SCR2, SCR3, SCR4 , SCR5, SCR6, SCR7, SCR8, SCR9, SCR10, SCR11, SCR12, SCR13, SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 and / SCR20 of the factor H.
  • the recombinant protein according to The invention comprises one, two, three or more than three copies of the SCR7 domain of factor H, in particular the SCR7 domain of the Y402 variant of factor H.
  • Another variant includes a recombinant protein comprising multiple copies of a set of SCR domains.
  • the recombinant protein according to the invention may comprise one, two, three or more repetitions of SCR1 to SCR4 domains, i.e. the protein comprises the (SCR1-SCR4) n motif, n being an integer equal to 1, 2, 3 or greater than 3, in particular n being equal to 1, 2 or 3.
  • the domain or set of domains present in multiple copies are not repetitions domains or set of domains, but may be present in the recombinant protein separated by other SCR domains.
  • the invention relates in particular to recombinant proteins comprising, in this order, the domains SCR1-SCR4, SCR7, SCR7 and SCR19-SCR20, or the SCR1-SCR4, SCR7, SCR1-SCR4, and SCR19-20 domains, or any other possible combination of these domains.
  • the factor H from which the protein according to the invention is derived can be any factor H whose activity is that of the natural factor H.
  • H factor is understood to mean any protein having the amino acid sequence of human native H factor or from another species (for example bovine, porcine, canine or murine).
  • the recombinant protein is derived from human factor H.
  • the term also includes any recombinant, derivative or mutant having a sequence substantially homologous to native H-factor.
  • substantially homologous sequence includes any sequence subject to one or more substitutions, additions and / or deletions, preferably conservative.
  • substitutions, additions and / or deletions express any replacement, addition or deletion of amino acid residue by another, without major alteration of the general conformation and / or biological activity of factor H.
  • Conservative substitution includes , but not limited to, replacement with an amino acid having similar properties (such as, for example, shape, polarity, hydrogen bonding potential, acidity, basicity, hydrophobicity and the like). Amino acids with similar properties are well known in the art.
  • H factor further includes natural allelic variations and / or factor H isoforms found naturally in individuals of the same species, and any form or degree of glycosylation or other post-translational modification.
  • H-factor also included in the term "H-factor" are homologues or derivatives of factor H which exhibit the same activity, or a higher biological activity with respect to the activity of the wild-type form and / or which have a sequence identity of from at least 80%, preferably at least 85%, more preferably at least 90%, more preferably at least 95%, more preferably at least 98%, more preferably at least 99%.
  • the factor H variant used to design the recombinant protein of the present invention may in particular be a variant mentioned in the website http://www.uniprot.org/uniprot/P08603.
  • Factor H complies with factor B for C3b binding and accelerates the dissociation of the already formed alternating C3 convertase (C3bBb). It acts as a cofactor of Factor I in the proteolysis of C3b, free or bound to the cell surface, which leads to the inactive form C3bi.
  • the immune complexes composed of an antigen-antibody complex associated with the complement component C3b or the activating factors of the alternative complement pathway (bacterial surfaces, infected cells, yeasts, parasites, lipopolysaccharides, endotoxins) can no longer activate the subsequent cascade of complement (C5-C9 components).
  • the term "biological activity" of factor H thus includes here the ability to inhibit C3 convertase and / or to act as a factor I co-factor, resulting in the inhibition of activation of the complement cascade.
  • the recombinant protein retains the biological activity of a plasma human factor H.
  • the biological activity of human plasma H-factor includes regulation of Factor I activity, inhibition of alternating C3 convertase formation and acceleration of C3 convertase dissociation.
  • said recombinant protein retains the biological activity of a plasma human factor H to accelerate the dissociation of C3 convertase.
  • the amount of dissociated C3 convertase can be determined as a function of the concentration of recombinant protein added.
  • the IC50 is determined from the equation calculated for a variable slope sigmoid.
  • said recombinant protein retains the biological activity of a plasma H factor to regulate factor I activity.
  • factor H can be evaluated by measuring the protection activity of red blood cells against lysis by complement according to procedures well known in the state of the art.
  • the sequence SEQ ID NO: 1 represents the amino acid sequence of the Y402 variant of human factor H in which the amino acid at position 402 is a tyrosine. This sequence does not include a signal peptide.
  • the sequence SEQ ID NO: 2 represents the amino acid sequence of the human factor H402 variant in which the amino acid at position 402 is a histidine. This sequence does not include a signal peptide.
  • one or more SCR domains of the recombinant protein according to the invention are derived from one or the other of these two variants.
  • the recombinant protein comprises the SCR7 domain of the Y402 variant of the factor H.
  • the first sequence of the recombinant protein comprises the S domains CRI to SCR7, the S domains CRI to SCR8 or S domains CRI to SCR9 of the factor H, the domain SCR7 in this first sequence being the domain SCR7 of the variant Y402 of the factor H.
  • the other domains SCR can be derived from variant Y402 of factor H or another variant of factor H.
  • the first sequence can in particular be combined with a second amino acid sequence comprising domains SCR19 and SCR20, SCR18 to SCR20, SCR17 to SCR20 or SCR16 to SCR20 of factor H, the second amino acid sequence being in particular derived from the Y402 variant or the H402 factor H variant.
  • These recombinant proteins include the Y402 polymorphism present in SCR7.
  • the recombinant protein according to the invention comprises, in this order, the domains SCR1, SCR2, SCR3, SCR4, SCR19 and SCR20 of the factor H.
  • the domains SCR4 and SCR19 are linked between them by an unnatural (or synthetic) linker consisting of a sequence comprising between 2 and 20 amino acids.
  • the term "non-natural (or synthetic) linker” refers in particular to a linker that does not correspond to the sequence found between the fourth cysteine of the SCR4 domain and the first cysteine of the SCR19 domain.
  • the amino acid sequence of the linker is chosen such that it is encoded by a nucleic acid which, when introduced into a cloning and / or expression vector, comprises a unique restriction site ( see below).
  • the linker may be of GASG sequence (SEQ ID NO: 3).
  • the first or second amino acid sequence of the recombinant protein according to the invention comprises one or more additional SCR domains of the factor H chosen from among the domains SCR5, SCR6, SCR7, SCR8, SCR9, SCR10, SCR11, SCR12, SCR13, SCR14, SCR15, SCR16, SCR17 and SCR18.
  • the order of these domains in the recombinant protein may correspond to the order of the same domains in the natural factor H. Alternatively, the order of the domains may be different from that of the natural H factor.
  • the amino acid sequence of the SCR1 domain (amino acids 21 to 80) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 4 (CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPL R C).
  • the sequence of the SCR1 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, especially at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 4.
  • the sequence of the SCR1 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 4.
  • the amino acid sequence of the SCR2 domain (amino acids 85 to 141) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 5 (CGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPIC ).
  • the sequence of the SCR2 domain introduced into the protein according to the invention has at least 85%, especially at least 90%, especially at least 95%, especially at least 99% identity with the sequence SEQ ID NO: 5.
  • the sequence of the SCR2 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 5.
  • the amino acid sequence of the SCR3 domain (amino acids 146 to 205) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 6 (CLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKE KPKC).
  • the sequence of the SCR3 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 6.
  • the sequence of the SCR3 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 6.
  • amino acid sequence of the SCR4 domain (amino acids 210 to 262) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 7 (CKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSC).
  • sequence SEQ ID NO: 7 CKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSC.
  • sequence of the SCR4 domain introduced into the protein according to the invention has at least 85%, especially at least 90%, especially at least 95%, especially at least 99% identity with the sequence SEQ ID NO: 7.
  • the sequence of the SCR4 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 7.
  • the amino acid sequence of the SCR5 domain (amino acids 266 to 320) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 8 (CDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRC).
  • the sequence of the SCR5 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 8.
  • the sequence of the SCR5 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 8.
  • amino acids 325 to 385 of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 9 (CDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGW SPAVPC).
  • sequence SEQ ID NO: 9 CDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGW SPAVPC.
  • the sequence of the SCR6 domain introduced into the protein according to the invention has at least 85%, especially at least 90%, especially at least 95%, especially at least 99%. % identity with the sequence SEQ ID NO: 9.
  • the sequence of the SCR6 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 9.
  • amino acids 389 to 442 of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 10 (CYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRC).
  • sequence SEQ ID NO: 10 CYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRC.
  • the sequence of the SCR7 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, especially at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 10.
  • the sequence of the SCR7 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 10.
  • amino acids 448 to 505 of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 11 (CSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTC).
  • sequence SEQ ID NO: 11 CSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTC.
  • the sequence of the SCR8 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 1.
  • the sequence of the SCR8 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 11.
  • the amino acid sequence of the SCR9 domain (amino acids 509 to 564) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 12 (CDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPIC).
  • the sequence of the SCR9 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 12.
  • the sequence of the SCR9 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 12.
  • amino acids 569 to 623 of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 13 (CELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPIC).
  • sequence SEQ ID NO: 13 CELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPIC.
  • sequence SEQ ID NO: 13 CELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPIC.
  • the sequence of the SCR10 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 13.
  • the sequence of the domain SCR10 introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 13.
  • the amino acid sequence of the SCR11 domain (amino acids 630 to 674) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 14 (CGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVC).
  • the sequence of the SCR11 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 14.
  • the sequence of the SCR11 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 14.
  • amino acid sequence of the SCR12 domain (amino acids 691 to 744) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 15 (CGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQC).
  • sequence SEQ ID NO: 15 CCDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQC.
  • the sequence of the SCR12 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 15.
  • the sequence of the SCR12 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 15.
  • amino acids 753 to 803 of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 16 (CKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNC).
  • sequence SEQ ID NO: 16 CKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNC.
  • the sequence of the SCR13 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 16.
  • the sequence of the SCR13 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 16.
  • the amino acid sequence of domain SCR14 (amino acids 811 to 864) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 17 (CPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLC).
  • the sequence of the SCR14 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 17.
  • the sequence of the SCR14 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 17.
  • the amino acid sequence of domain SCR15 (amino acids 869 to 926) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 18 (CSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQC).
  • the sequence of the SCR15 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 18.
  • the sequence of the SCR15 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 18.
  • amino acid sequence of domain SCR16 (amino acids 931 to 984) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 19 (CKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSC).
  • sequence SEQ ID NO: 19 CKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSC.
  • the sequence of the SCR16 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 19.
  • the sequence of the SCR16 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 19.
  • amino acid sequence of domain SCR17 (amino acids 989 to 1043) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 20 (CLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTC).
  • sequence SEQ ID NO: 20 CLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTC.
  • sequence of the SCR17 domain introduced into the protein according to the invention has at least 85%, especially at least 90%, especially at least 95%, especially at least 99% identity with the sequence SEQ ID NO: 20.
  • the sequence of the SCR17 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 20.
  • the amino acid sequence of the SCR18 domain (amino acids 1048 to 1102) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 21 (CVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQC).
  • the sequence of the SCR18 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, especially at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 21.
  • the sequence of the SCR18 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 21.
  • the amino acid sequence of domain SCR19 (amino acids 1109 to 1163) of the human factor H variant Y402 is represented by the sequence SEQ ID NO: 22 (CGPPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCR GQWSEPPKC).
  • the sequence of the SCR19 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 22.
  • the sequence of the SCR18 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 22.
  • amino acid sequence of domain SCR20 (amino acids 1167 to 1231) of human factor H variant Y402 is represented by the sequence SEQ ID NO: 23 (CVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKL EYPTCAKR).
  • sequence SEQ ID NO: 23 CVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKL EYPTCAKR.
  • sequence of the SCR18 domain introduced into the protein according to the invention has at least 85%, in particular at least 90%, in particular at least 95%, in particular at least 99% identity with the sequence SEQ ID NO: 23.
  • the sequence of the SCR20 domain introduced into the protein according to the invention is that represented in the sequence SEQ ID NO: 23.
  • the first or second amino acid sequence comprises at least the SCR12, SCR13, and SCR14 domains of the H factor. In another embodiment, none of the SCR12, S CRI3, and S CRI4 domains are is present in the recombinant protein according to the invention.
  • An embodiment variant of the present invention relates to a recombinant protein whose SCR domains consist, in this order, of domains SCR1, SCR2, SCR3, SCR4, SCR12, SCR13, SCR14, SCR19 and SCR20. Such a protein is represented in the sequence SEQ ID NO: 142.
  • Each SCR domain included in the first or second amino acid sequence may be linked to the contiguous SCR (s) by means of the natural linker found between said SCR domains, as appropriate.
  • the linker between each SCR domain of the recombinant protein may be a non-natural linker.
  • the unnatural linker may consist of a sequence comprising between 2 and 20 amino acids, in particular between 3 and 8 amino acids.
  • the link between the first and the second amino acid sequence can be achieved by means of a natural or synthetic linker present in the C-terminal position of the first amino acid sequence or in the N-terminal position of the second sequence. in amino acids.
  • the first and second polypeptide may be linked by a GASG sequence linker (SEQ ID NO: 3).
  • first and second amino acid sequences may be linked together by a linker combining the natural linker sequence according to the last domain of the first sequence (ie the C-terminal domain of the first sequence) and a linker. synthetic such as the linker GASG.
  • the Natural linkers found at the C-terminal position of each of the SCR domains of the factor H are, for example: QKRP (SEQ ID NO: 143) for the SCR1 domain; EVVK (SEQ ID NO: 144) for the SCR2 domain; VEIS (SEQ ID NO: 145) for the SCR3 domain; EEKS (SEQ ID NO: 146) for the SCR4 domain; TLKP (SEQ ID NO: 147) for the SCR5 domain; LRK for the SCR6 domain; IRVKT (SEQ ID NO: 148) for the SCR7 domain; IKS for the SCR8 domain; YERE (SEQ ID NO: 149) for the SCR9 domain; KEQVQS (SEQ ID NO: 150) for the SCR10 domain; IVEEST (SEQ ID NO: 151) for the SCR1 domain l; VAIDKLKK (SEQ ID NO: 152) for the SCR12 domain; SMAQIQL (SEQ ID NO: 153) for the domain S
  • the first amino acid sequence comprises the domains SCR1, SCR2, SCR3 and SCR4 of the factor H.
  • the first amino acid sequence comprises the domains SCR1, SCR2, SCR3, SCR4 and SCR5 of the factor H.
  • the first amino acid sequence comprises the domains SCR1, SCR2, SCR3, SCR4, SCR5 and SCR6 of the factor H.
  • the first amino acid sequence comprises the SCR1, SCR2, SCR3, SCR4, SCR5, SCR6 and SCR7 domains of the factor H.
  • the first amino acid sequence comprises the SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7 and SCR8 domains of the H factor.
  • the first amino acid sequence comprises the SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7, SCR8 and SCR9 domains of the H factor.
  • the first amino acid sequence comprises the SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7, SCR8, SCR9 and SCR10 domains of the H factor.
  • the first amino acid sequence comprises the domains SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7, SCR8, SCR9, SCR10 and SCR1, factor H.
  • the first amino acid sequence comprises the SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7, SCR8, SCR9, SCR10, SCR1 and SCR12 H-factor domains.
  • the first amino acid sequence comprises the SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7, SCR8, SCR9, SCR10, SCR1, SCR12 and SCR13 H-factor domains.
  • the second amino acid sequence comprises the domains SCR19 and SCR20 of the factor H.
  • the second amino acid sequence comprises the domains SCR18, SCR19 and SCR20 of the factor H.
  • the second amino acid sequence comprises the domains SCR17, SCR18, SCR19 and SCR20 of the factor H.
  • the second amino acid sequence comprises the domains SCR16, SCR17, SCR18, SCR19 and SCR20 of the factor H.
  • the second amino acid sequence comprises the domains SCR15, SCR16, SCR17, SCR18, SCR19 and SCR20 of the factor H.
  • the second amino acid sequence comprises the domains
  • the second amino acid sequence comprises the domains
  • the second amino acid sequence comprises the domains
  • the second amino acid sequence comprises the domains
  • the second amino acid sequence comprises the SCR10, SCR1, SCR12, SCR13, SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 and SCR20 domains of the H factor.
  • the second amino acid sequence comprises the SCR9, SCR10, SCR1, SCR12, SCR13, SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 and SCR20 domains of the H factor.
  • the second amino acid sequence comprises the SCR8, SCR9, SCR10, SCR1, SCR12, SCR13, SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 and SCR20 domains of the H factor.
  • the recombinant protein having a factor H activity comprises the first and second amino acid sequences listed in Table 1 below. below, these sequences being separated by a linker, in particular an artificial linker, in particular the GASG linker (SEQ ID NO: 3).
  • the recombinant protein having a factor H activity comprises the first and second amino acid sequences listed in Table 2 below, these sequences being separated by a linker, in particular an artificial linker, in particular the linker G AS G (SEQ ID NO: 3).
  • the first sequence comprises the domains SCR1 to SCR7 of factor H
  • the second sequence is chosen from the group consisting of: domains SCR9 to SCR20,
  • the first sequence comprises the domains SCR1 to SCR8 and the second sequence comprises the domains SCR10 to SCR20.
  • the first sequence comprises the domains SCR1 to SCR4 of the factor H and the second sequence comprises the domains SCR16 to SCR20 of the factor H, a third sequence comprising the domain SCR7 of the factor 7 being between the first and the second sequence, and being more particularly separated from these by linkers such as those described above.
  • the first amino acid sequence comprises a signal peptide (PS) in the N-terminal position.
  • the signal peptide can be the natural signal peptide of factor H (MRLLAKIICLMLWAICVA - SEQ ID NO: 24), the signal peptide of a protein different from factor H, or a signal peptide described in application PCT / 2001/050544, especially the peptide MRWSWIFLLLLSITSANA (SEQ ID NO: 25, or otherwise referred to as PS-MB7 thereafter).
  • the natural signal peptide of a protein different from human factor H may be a signal peptide chosen from the signal peptides of all the proteins which are secreted in eukaryotes and in particular in mammals and more particularly in humans, such as those of immunoglobulins. growth factors such as ⁇ , hormones such as insulin, enzymes such as trypsinogen, coagulation factors such as prothrombin.
  • growth factors such as ⁇ , hormones such as insulin, enzymes such as trypsinogen, coagulation factors such as prothrombin.
  • the invention relates to one of the peptides of Table 1 in which the first amino acid sequence comprises at the N-terminal such a signal peptide, in particular the natural peptide of the factor H of sequence SEQ ID NO: 24 or the signal peptide PS-MB7 of sequence SEQ ID NO: 25.
  • the recombinant protein according to the invention is chosen from one of the proteins of Table 1, the first and second sequences being separated by a linker, including a GASG linker (SEQ ID NO: 3).
  • the recombinant protein according to the invention is chosen from one of the proteins listed in Table 2 below in which the first amino acid sequence comprises a signal peptide of sequence SEQ ID NO: 25 and the first and second sequences are separated by a GASG sequence linker (SEQ ID NO: 3).
  • the recombinant protein according to the invention contains a first sequence comprising the domains SCR1 to SCR4 of factor H, and a second sequence chosen from the group consisting of:
  • the recombinant protein according to the invention contains a first sequence comprising the domains SCR1 to SCR7 of factor H, and a second sequence comprising the SCR1 6 to SCR20 domains of the factor H, said second sequence preferably being chosen from the group consisting of:
  • the invention relates to a recombinant protein as described above, the first sequence comprising the domains SCR1 to SCR8 of the factor H, and the second sequence comprising the domains SCR1 6 to SCR20 of the factor H, said second sequence preferably comprising the domains SCR10 to SCR20 of the factor H.
  • the recombinant protein according to the invention contains a first sequence comprising the domains SCR1 to SCR4 of the factor H and a second sequence comprising the domains SCR1 6 to SCR20 of the factor H, a third sequence comprising the domain SCR7 of the factor H being between the first and the second sequence.
  • the first sequence comprises a signal peptide of sequence SEQ ID NO: 25 and domains SCR1 to SCR7 of factor H, and the second sequence is chosen from the group consisting of:
  • the first and the second sequences are separated by a GASG sequence linker.
  • the first sequence comprises a signal peptide of sequence SEQ ID NO: 25 and domains SCR1 to SCR8 and the second sequence comprises domains SCR10 to SCR20.
  • the first and the second sequences are separated by a GASG sequence linker.
  • the first sequence comprises a signal peptide of sequence SEQ ID NO: 25 and domains SCR1 to SCR4 of factor H and the second sequence comprises domains SCR16 to SCR20 of factor H, a third sequence comprising domain SCR7 factor 7 being between the first and the second sequence, and being separated therefrom by linkers such as those described above.
  • the first and the third sequences, and the third and the second sequences are separated by a GASG sequence linker.
  • a sequence is represented in SEQ ID NO: 159.
  • the present invention also relates to a pharmaceutical composition comprising a recombinant protein according to the invention.
  • the invention also relates to a nucleic acid construct encoding a recombinant protein having a factor H activity as described above.
  • nucleic acids encoding the recombinant proteins according to the invention have undergone codon optimization.
  • Codon optimization aims to replace natural codons by codons whose transfer RNA (tRNA) carrying the amino acids are most common in the cell type considered.
  • tRNA transfer RNA
  • the mobilization of frequently encountered tRNAs has the major advantage of increasing the translation speed of the messenger RNAs (mRNA) and therefore of increasing the final titre (JM Carton et al., Protein Expr Purif, 2007).
  • Sequence optimization also plays on the prediction of mRNA secondary structures that could slow down reading by the ribosomal complex. Sequence optimization also has an impact on the percentage of G / C that is directly related to the half-life of the mRNAs and therefore to their potential to be translated (Chechetkin, J. of Theoretical Biology 242, 2006 922-934 ).
  • Codon optimization can be done by substitution of natural codons using codon frequency (Codon Usage Table) tables for mammals and more specifically for Homo sapiens.
  • codon frequency Codon Usage Table
  • a codon-optimized sequence is represented by the sequence SEQ ID NO: 85. This sequence comprises the natural signal peptide of the factor H.
  • the nucleic acids according to the invention may comprise a unique restriction site between the two nucleic acid sequences encoding the first and the second acid sequence. amines of the recombinant protein according to the invention. This unique restriction site may especially correspond to the Nhe I site present in the portion encoding the GASG linker (nucleic sequence: GCCGCTAGCGCC (SEQ ID NO: 86), the underlined portion corresponding to the NheI site which corresponds to the amino acids AS mentioned above.
  • This unique restriction site makes it possible to envisage an improvement in the recombinant proteins produced, in particular by facilitated introduction of one or more additional SCR domains at the level of the protein sequence corresponding to said restriction site, or by introduction of a sequence into Amino acids other than an SCR domain may be, for example, another protein domain not belonging to the natural factor H, or a linker of different size and sequence (especially a longer linker).
  • nucleic acids encoding the recombinant protein according to the invention may be constructed according to any method known to those skilled in the field of molecular biology.
  • said nucleic acid is constructed in two stages according to a method peculiar to the present invention.
  • a nucleic acid library cloned into cloning or expression vectors may be constructed.
  • Each vector of the library contains a sequence encoding one of the first or second amino acid sequences comprising the recombinant protein according to the invention.
  • a vector comprising the sequences coding a first amino acid sequence comprising at least the sequences of the SCR1 to SCR4 domains of factor H (or N-Ter vector) is described.
  • a vector comprising the sequences encoding a second amino acid sequence comprising at least the sequences of the domains SCR19 and SCR20 of the factor H (or C-Ter vector).
  • the N-Ter and C-Ter vectors are designed to include unique restriction sites useful for excising and then assembling nucleic acid fragments encoding each of the portions of the recombinant protein into a single vector.
  • the constructs allowing the expression of the proteins of Table 2 above can thus be produced from 8 N-Ter vectors and 10 C-Ter vectors. This strategy is described in the examples below.
  • the nucleic acids according to the invention may also comprise any useful sequence, in particular any sequence which makes it possible to optimize the expression or the secretion of the recombinant protein or to facilitate the cloning and subcloning of the nucleic acids of the invention.
  • the nucleic acid may comprise at least one restriction site, a coding sequence and / or a signal peptide coding sequence.
  • it may in particular be useful to introduce a sequence encoding an amino acid unit useful for the labeling or purification of the recombinant protein, for example a histidine tag, and one or more restriction sites.
  • the nucleic acid construct according to the invention comprises a sequence encoding a signal peptide chosen from:
  • nucleic acid represented by the sequence SEQ ID NO: 87 and coding the natural signal peptide of the factor H, or
  • nucleic acid represented by the sequence SEQ ID NO: 88 or by a sequence having at least 85%, in particular 90%, especially 95% of sequence identity with the sequence SEQ ID NO: 88, and coding the signal peptide factor H, (optimized natural PS) or
  • nucleic acid encoding a natural signal peptide of a protein different from the factor H, or
  • nucleic acid encoding the signal peptide encoded by the sequence SEQ ID NO: 89 (described in application PCT / FR2011 / 050544) or by a sequence having at least 85%, in particular 90%), particularly 95% identity of sequence with the sequence SEQ ID NO: 89.
  • sequence SEQ ID NO: 88 or a sequence having at least 85%, especially 90%>, especially 95% of sequence identity with the sequence SEQ ID NO: 88 is a sequence obtained by codon optimization from the sequence SEQ ID NO: 87.
  • nucleic acid construct encoding the recombinant protein according to the invention comprises, or consists of:
  • nucleic acid encoding a signal peptide in particular a nucleic acid represented by the sequence SEQ ID NO: 87 and encoding the natural signal peptide of factor H, or a nucleic acid represented by the sequence SEQ ID NO: 88 or by a sequence having at least 85%), especially 90%, particularly 95% of sequence identity with the sequence SEQ ID NO: 88, and coding the signal peptide of factor H, (optimized natural PS) or a nucleic acid encoding a natural signal peptide a protein different from the factor H, or a nucleic acid encoding the signal peptide encoded by the sequence SEQ ID NO: 89 (described in application PCT / FR2011 / 050544) or by a sequence having at least 85%, in particular 90% especially 95% sequence identity with the sequence SEQ ID NO: 89;
  • nucleic acid encoding at least the domains SCR1, SCR2, SCR3 and SCR4 of factor H; a nucleic acid encoding a linker, in particular a GASG linker (SEQ ID NO: 3), said nucleic acid encoding a linker comprising a unique restriction site, in particular an NheI site;
  • nucleic acid encoding at least the domains SCR19 and SCR20 of the factor H.
  • the nucleic acid construct allows the expression of a recombinant protein selected from one of the sequences SEQ ID NO: 26 to SEQ ID NO: 84.
  • the invention also relates to an expression vector comprising the nucleic acid construct described above, operably linked to sequences for controlling the expression of said nucleic acid.
  • the control sequences may in particular comprise a promoter (in particular a CMV promoter), an enhancer, and any sequence known to those skilled in the art useful for allowing the expression of the recombinant protein in a eukaryotic cell, in particular a mammalian cell.
  • the invention also relates to a recombinant eukaryotic cell, in particular a mammalian cell, more particularly a non-human (eg a CHO cell) or human cell, transformed by means of the nucleic acid construct or the vector. expression according to the invention.
  • the recombinant protein as described above is produced in the PER.C6® cell line or a HEK cell line, in particular the HEK 293F cell line.
  • the PER.C6® cell line is derived from human primary retinal cells in which an Ad5 adenoviral DNA fragment that contains both the E1A gene and the ElB gene is inserted into the cells by a vector.
  • This adenoviral DNA fragment makes it possible to impart immortality to the cells in which it is inserted, via the ElB protein which inhibits the p53 protein.
  • the El A protein has a tropism for the hCMV viral promoter and allows its transactivation and the potentiation of the gene sequence which will be inserted 3 'of the latter and which may be the recombinant protein according to the invention.
  • the present invention particularly relates to the use of the cell line PER.C6® for the implementation of a method for preparing a recombinant protein having a factor H activity, in particular one of the proteins of sequence SEQ ID NO: 26 to SEQ ID NO: 84.
  • the present invention also particularly relates to the use of the HEK 293F cell line for implementing a method for preparing a recombinant protein according to the invention, in particular one of the recombinant proteins represented by one of the SEQ sequences. ID NO: 26 to SEQ ID NO: 84.
  • the invention also relates to a process for the production of a recombinant protein having an activity of factor H.
  • the method according to the invention in particular one of the proteins represented by the sequences SEQ ID NO: 26 to 84, said method comprising the culture of a recombinant cell according to the invention transformed by a vector comprising the nucleic acid construct according to the invention coding for said recombinant protein.
  • the vector comprising such a nucleic acid may be any expression vector for eukaryotic cell lines known to those skilled in the art.
  • the transformation of the cell line can be carried out by electroporation, AMAXA type nucleofection, a "gene gun” (gun gene) or else using a transfection agent known to man of the art, such as cationic agents, liposomes or polymers such as fectin or PEI agent.
  • a transfection agent known to man of the art, such as cationic agents, liposomes or polymers such as fectin or PEI agent.
  • the method according to the present invention comprises the following steps:
  • the expression vector may contain an antibiotic resistance gene to allow selection of transfected cells upon establishment of cells stably producing the protein of interest.
  • the recombinant protein according to the invention is produced at a concentration greater than or equal to 10 mg / L as detected by ELISA assay of culture supernatant, after 7 days of production in batch mode.
  • the purification of the recombinant protein can be carried out by chromatographic techniques in one, two or more steps.
  • the one-step purification may be an ion exchange column or an affinity column (heparin, factor H ligand or anti-factor H antibody).
  • the purification in two steps may be a cation exchange column chromatography step followed by an anion exchange column chromatography step or an anion exchange column chromatography step followed by a column chromatography step cation exchange or an ion exchange column chromatography step followed by an affinity column chromatography step or an affinity column chromatography step followed by an ion exchange column chromatography step.
  • the purification in addition to two steps can be performed by a combination of these different chromatographies.
  • a step of diafiltration, ultrafiltration or gel filtration can be carried out in addition.
  • the purity of a product after such purification can reach 99% purified product.
  • the proteins according to the invention can also be produced in the milk of non-human transgenic animals, such as a goat, a rabbit, the sheep, the cow or a pig.
  • the secretion of proteins by the mammary glands involves the control of the expression of the proteins according to the invention in a tissue-dependent manner.
  • Such control methods are well known to those skilled in the art.
  • the control of the expression is carried out by means of sequences allowing the expression of the protein towards a particular tissue of the animal. These include the promoter sequences WAP, beta-casein, beta-lactoglobulin and signal peptide sequences.
  • the process for extracting proteins of interest from the milk of transgenic animals is described in patent EP 0 264 166.
  • Another aspect of the invention also relates to the use of a recombinant protein according to the invention as a medicament.
  • the invention also relates to the use of a recombinant protein according to the invention for the manufacture of a medicament for the treatment of a disease involving an undesirable or inappropriate complement activity, in particular for the treatment of diseases due to inflammation uncontrolled or an uncontrolled C3b deposit.
  • the invention also relates to a method of treating a disease involving an undesirable or inappropriate complement activity, comprising administering a recombinant protein according to the invention to a patient in need of such treatment.
  • treatment includes both curative and prophylactic treatment of the disease.
  • a curative treatment is defined as a treatment resulting in a cure or treatment that alleviates, improves and / or eliminates, reduces and / or stabilizes the symptoms of an illness or the suffering it causes.
  • Prophylactic treatment includes both treatment leading to disease prevention and treatment that reduces and / or delays the incidence or risk of disease.
  • the invention aims in particular at the treatment of a disease selected from the group consisting of age-related macular degeneration (AMD), periodontitis, lupus erythematosus, lupus nephritis, dermatomyositis, myasthenia gravis, glomerulonephritis membranoproliferative (GNMP), psoriasis, multiple sclerosis and lesions of renal ischemia / reperfusion.
  • ASD age-related macular degeneration
  • GNMP glomerulonephritis membranoproliferative
  • psoriasis multiple sclerosis and lesions of renal ischemia / reperfusion.
  • FIG. 1 is a diagram representing the construction strategy of the N-terminal fragments of the recombinant proteins according to the invention.
  • FIG. 2 is a diagram showing the construction strategy of the C-terminal fragments of the recombinant proteins according to the invention.
  • Figures 3A, 3B and 3C are graphs showing the acceleration activity of C3 convertase dissociation for H-factor fragments having the highest productivity.
  • Example 1 Construction of the Factor H N-ter and C-ter Fragments in the pCEP4 Plasmid
  • the purpose is to subclone in different forms the N-terminal and C-terminal fragments of the factor H variant Y402 in an optimized version in the pCEP4 expression vector.
  • the fragments will both be completed 5 'of a NotI site, the kozak sequence and a signal peptide, and at 3' of a His-TAG followed by the BamHI site, the difference will be made by a NheI site. located at 3 'for the N-ter fragments and at 5' for the C-ter fragments.
  • Explanatory diagrams will be described in the protocol below. 1 / Vector construction pCEP4-N-ter
  • the N-ter fragments are constructed by PCR from the pCDNA2001neo-MD3Y vector.
  • This vector corresponds to the vector pCDNA2001neo containing the nucleic acid represented by the sequence SEQ ID NO: 90 which is an optimized sequence encoding the Y402 variant of factor H comprising an artificial signal peptide PS-MB7.
  • the construction strategy is shown in Figure 1.
  • the primers used are the following:
  • antisense primers or P2-NT-X primers:
  • Each of these primers contains, in this order of 5 'to 3': a BamHI site, 2 stop codons, a hexahistidine label, a linker (GS), a NheI site and a factor-specific sequence. These elements are represented on Figure 1.
  • P2-NT-4 (SEQ ID NO: 92)
  • P2-NT-7 (SEQ ID NO: 93)
  • P2-NT-8 (SEQ ID NO: 94)
  • P2-NT-12 (SEQ ID NO: 98)
  • CMV1 and SV40-3 'UTR primers are used for sequencing all vectors. Only the pCEP4-lNTer1, pCEP4-lNTer1 2 and pCEP4-INTer1 3 vectors have additional sequencing with the MD2-3 primer.
  • the C-ter fragments are constructed by PCR from the pCDNA2001neo-MD3Y vector. This vector corresponds to the vector pCDNA2001neo containing the nucleic acid represented by the sequence SEQ ID NO: 90.
  • the construction strategy is shown in Figure 2.
  • the primers used are the following:
  • Each of these primers contains, in this order from 5 'to 3': a NotI site, a Kozack (SK) sequence, a signal peptide (PS), a NheI site and a factor H specific sequence. These elements are represented in Figure 2.
  • Pl-CT-9 (SEQ ID NO: 120) CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACGCTGCTAGCGGCTGTGACATTCCAGTGTTTATGAACG
  • This primer contains, in the 5 'to 3' orientation: a BamHI site, 2 stop codons, a hexahistidine tag, a linker (GGSG) and a specific H factor sequence.
  • the series of Pl-CT-X primer (X, variable) and the P2-CT-FCTH primer are obtained by assembly PCR.
  • PCR1 1-P 1 -CT-FCTH 1 (SEQ ID NO: 125)
  • PCR1 Fragment P1-CT-FCTH-PCR1 (SEQ ID NO: 127)
  • 59 plasmid constructs which correspond to the 59 combinations 1NTX-XCT20 of the fragments FH. These sequences are present in the pCDNA2001neo vector which allows stable expression of these molecules in the PERC6 cell line.
  • the FH 1NTX-XCT20 fragments are extracted from the pCDNA2001neo vector by NotI / BamHI digestion and cloned into the pCEP4 vector which allows transient expression in HEK293F cells.
  • NotI / BamHI and NheI / BamHI control digestion are notI / BamHI and NheI / BamHI control digestion.
  • the 1NTX / XCT20 fragments are then extracted by NotI / BamHI digestion and reintroduced into the pCEP4 vector.
  • the HEK 293F cells are subcultured at a cell concentration of 7 E 5 vc / ml.
  • the cell density and viability of HEK 293F cells are determined on the day of transfection.
  • the culture volume corresponding to 30 E 6 cv / ml is centrifuged.
  • the supernatant is removed and the cell pellet is taken up in 28 ml of F17 culture medium (Invitrogen), transferred to a 250 ml Erlenmeyer flask and incubated at 37 ° C.
  • the transfection agent and the DNA corresponding to the vector pCEP4 containing one of the sequences of the FH fragments are prepared in OptiMEM medium (Invitrogen) as follows:
  • the cells are kept in culture for 7 days without adding or renewing culture medium. The 7th day, the cells were centrifuged at 3000g for 15 minutes. The cell pellets are removed and the cell supernatants containing the recombinant FH fragments are filtered in 0.22 ⁇ ⁇ frozen at -20 ° C. 3.2: Assaying human FH fragments in the culture medium by ELISA
  • Antibody coating antibody human anti-Human H mutagen (The Binding Site) diluted extemporaneously in PBS buffer pH 7.4 to obtain a concentration of between 3.5 and 5.5 ⁇ g / ml.
  • Dilution buffer PBS buffer - Tween-20 0.1% (vol / vol) - 0.1% BSA (w / vol)
  • Samples the samples are prediluted so as to obtain a concentration close to that of the first point of range. Then dilute 1 ⁇ 2 to 1 ⁇ 2.
  • Monoclonal Antibody Anti Factor H Monoclonal Immunoglobulins from Purified Mouse Anti Human Factor H (SEROTEC)
  • Revealing antibody Peroxidase-labeled mouse anti-mouse IgG goat immunoglobulins (Jackson Immuno Research Laboratories).
  • Stop Solution 4 N or 2 M sulfuric acid (Fisher Scientif ⁇ c).
  • HRP Conjugate Marking HorseRadish Peroxidase in English, or Horseradish Peroxidase:
  • TMB containing the substrate 100 ⁇ per well of TMB containing the substrate is dispensed at a regular time interval and away from any intense light. Then incubate at room temperature between 5 - 15 minutes. This time must be identical for all dosing points.
  • Example 4 Characterization by SDS-PAGE of the recombinant FH fragments present in the culture supernatant (FIGS. 6A, 6B and 7).
  • a volume corresponding to 1 g of recombinant factor H is diluted to 1 ⁇ 2 in 2x Laemmli buffer, heated at 95 ° C. for 5 minutes and then deposited on a linear gel. 10% polyacrylamide. After migration, the proteins contained in the gel are stained with Coomassie blue. Analysis of the polyacrylamide gels shows that the recombinant FH fragments migrate according to the apparent molecular masses expected.
  • the recombinant FH fragments are diluted to a final concentration of 20 ⁇ g / ml. From this tube a range is achieved by the following successive dilutions: 1/2; 1/10; 1/4; 1/4; 1/4; 1/40. This decreasing concentration range of FH fragments is added to the C3 convertase complex formed in the wells of a 96-well plate which is then incubated 32-34 minutes at + 34 ° C. After several washes, the factor B remaining complexed with the immobilized C3 molecule at the bottom of the well is then assayed by an immunoenzymatic reaction of the ELISA type. Absorbance values obtained as a function of the concentration of added FH fragments are then processed in a nonlinear modeled system (variable slope sigmoid) to determine the IC50 value of each sample. The calculation equation of this model is as follows:
  • X is the logarithm of the concentration (g / ml).
  • the activity determined in the cell supernatant is shown in Figures 3A, 3B and 3C for the fragments having the highest productivity.
  • the FH fragments were purified via the hexahistidine tag which was added to the c-terminus of the proteins.
  • the purification was carried out in an affinity chromatography step using HisTALON (Clontech) columns which contain a resin having high affinity and specificity for polyshistidins.
  • HisTALON Click-ontech
  • the purification was carried out according to the supplier's recommendations (HisTALON Gravity Column Purification Kit User Manual). After purification the samples are dialyzed against PBS buffer and stored at
  • the concentration of the purified recombinant FH fragments is determined by measuring the OD at 280 nm.
  • the purified recombinant FH fragments are diluted to a final concentration of 150 nM and then from this tube a range is achieved by the following successive dilutions: 1/2; 1/10; 1/4; 1/4; 1/4; 1/4; 1/40.
  • This decreasing concentration range of FH fragments is added to the C3 convertase complex formed in the wells of a 96-well plate which is then incubated 32-34 minutes at + 34 ° C.
  • the factor B remaining complexed with the immobilized C3 molecule at the bottom of the well is then assayed by an ELISA-type immunoenzymatic reaction, using TMB (3,3 ', 5,5'-tetramethylbenzidine) or OPD (ortho-phenylenediamine) as reaction substrate.
  • Absorbance values obtained as a function of the concentration of added FH fragments are then processed in a nonlinear modeled system (variable slope sigmoid) to determine the IC50 value of each sample.
  • the calculation equation of this model is as follows:
  • X is the logarithm of the concentration (g / ml).
  • pCEP4- 1NT4-19CT20 0.0916 73% pCEP4- 1NT7- 8CT20 0.5419 72% pCEP 4-lNT9-l l CT20 0.1716 69% pCEP 4-lNT9-10CT20 0.5517 64% pCEP 4-lNT9-14 CT20 0.5698 64% pCEP4- 1NT8-14CT20 0.6454 61% pCEP4- 1NT7-10CT20 0.6015 59% pCEP4- 1NT10- 11CT20 0.6118 58% pCEP4- 1NT8- 15CT20 0.6279 58% pCEP4- 1NT4- 15CT20 0.2061 58% pCEP 4-lNT9-13 CT20 0.1663 56% pCEP4- 1NT7-15CT20 0.6393 56% pCEP 4-lNT9-19 CT20 0.2166 49% pCEP4- 1NT13- 14CT20 0.7765 45% pCEP4- 1NT4- 8CT20
  • Example 7 Determination of the protection activity of lysis of red blood cells of sheep by modified Sanchez-C orrai test.
  • This test makes it possible to measure the functional activity of the C-terminal portion of the purified human recombinant H factor during the development of therapeutic batches by evaluating its ability to protect sheep red blood cells from lysis induced by a depleted or factor-deficient serum. H functional.
  • This test is adapted from the "Sanchez-Corral” method to measure the anti-hemolytic activity of factor H present in the plasma of patients with hemolytic uremic syndrome. (P. Sanchez-Corral, C. Gonzalez-Rubio, S. Rodriguez of Cordoba and M. Lopez-Trascasa, Molecular Immunology 41 (2004) 81-84).
  • H factor depleted serum and a human plasma pool is produced in equal proportion to create the conditions for a specific lysis.
  • the addition of purified human recombinant H factor ensures the protection of sheep red blood cells (lack of cell lysis) against complement-induced lysis.
  • reaction buffer 10 mM Hepes, 144 mM NaCl, 7 mM MgCl 2, 10 mM EGTA, pH 7.2.
  • variable volume of FH fragment or whole FH (0-30 ⁇ 1) corresponding to concentrations of 0 to 44.74pM, then 9 ⁇ of a pool of human plasma followed by 9 ⁇ of human plasma depleted in FH.
  • the reaction volume is completed with PBS buffer to obtain a final volume of 1 ⁇ .
  • HBS-EDTA buffer (10 mM Hepes, 144 mM NaCl, 2 mM EDTA, pH 7.2) were used to stop the reaction. After centrifugation for 5 min at 1730 g, 200 ⁇ l of supernatant are removed and deposited in a microtiter plate in order to measure the absorbance at 414 nm.
  • the percentage of lysis is determined according to the formula:
  • the "100% lysis" control corresponds to the maximum lysis of sheep red blood cells observed in the presence of water.
  • the blank control comprises the + 50mM EDTA reaction buffer and corresponds to the spontaneous lysis of sheep red blood cells.
  • the various fragments of factor H according to the invention are very active with an inhibition of specific lysis greater than the entire rFH from the lowest concentration tested.
  • 1NT9-16CT20 and 1NT7-16CT20 a profile closer to the plasma H factor LP03 is very interestingly observed.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Environmental Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Animal Husbandry (AREA)
  • Biodiversity & Conservation Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

L'invention concerne une protéine recombinante possédant une activité de facteur H.

Description

PROTEINES RECOMBINANTES POSSEDANT UNE ACTIVITE DE FACTEUR H L'invention concerne une protéine recombinante possédant une activité de facteur H. Arrière plan de l'invention:
Le facteur H est une protéine plasmatique de 155 kDa dont la fonction principale est la régulation de l'activité du complément induite par la voie alterne. Le facteur H est constitué de 20 domaines répétés SCR (Short Consensus Repeats) (également appelés CCP ou SHUSHI) d'environ 60 acides aminés liés entre eux par une courte séquence linker de 3 à 8 acides aminés. Les domaines SCR1-4 portent l'activité d'accélération de la dissociation des C3 et C5 convertases et l'activité de régulation du facteur I qui permet l'inactivation de la protéine C3b. Ces domaines N-terminaux sont suffisants pour réguler l'activité de la C3 convertase en phase liquide, mais les domaines SCR19-20 sont nécessaires à l'activité du facteur H à la surface des cellules. Les autres domaines SCR du Facteur H peuvent également contribuer plus ou moins directement à l'activité du facteur H, certains contenants des sites de liaisons pour d'autres molécules telles que les héparanes sulfates et les glycosaminoglycannes, les pentraxines (CRP, PTX3), la fibromoduline ou le malondialdéhyde. Certains de ces domaines contiennent également des sites de glycosylations qui peuvent contribuer à la demi- vie de la molécule et à l'efficacité de sa production sous forme recombinante, d'autres pourraient avoir un rôle important pour la conformation tridimensionnelle du facteur H, comme par exemple les domaines SCR12, SCR13, SCR14 qui confèrent au facteur H un repliement particulier en forme d'épingle à cheveux (hairpin) (Schmidt et al, J Mol Biol. 2010 January 08; 395(1): 105-122).
Le facteur H est un facteur thérapeutique prometteur pour le traitement de nombreuses maladies liées à des dépôts dense de C3 ou à une activation du complément ou une inflammation incontrôlée. Cependant, dans certaines indications telles que la DMLA (Dégénérescence Maculaire Liée à l'Age), la GNMP de type 2 (GloméruloNéphrite Membrano -Proliférât ive), le SHU atypique (Syndrome Hémorragique Urémique) ou certaines maladies auto-immunes, l'utilisation du facteur H pourrait être limitée en raison de certains inconvénients: biodisponibilité, pharmacocinétique et pharmacodynamie, pouvoir immunogène, liaison aux héparanes sulfates, liaison à des ligands non identifiés, liaisons à des pathogènes permettant leur échappement immunitaire (S.pneumoniae, N.meningitidis,...) et auto-association du facteur H. Ces inconvénients sont liés aux propriétés moléculaires du facteur H et donc à l'organisation des domaines SCR du facteur H.
Un dérivé du facteur H combinant les domaines S CRI à SCR4 aux domaines S CRI 9 et SCR20 du facteur H (Hebecker et al, Journal of Immunology 2013, June 10, publié en ligne) a été proposé. Dans ce dérivé du facteur H construit pour diriger l'activité du facteur H à la surface des cellules, les deux domaines de régulation du complément et de reconnaissance de surfaces sont liés entre eux par les 6 acides aminés naturels trouvés entre la quatrième cystéine du domaine SCR4 et la première cystéine du domaine SCR19.
Cependant d'autres domaines du facteur H pourraient être également nécessaire pour obtenir une efficacité thérapeutique supérieure à celle du facteur H, tel par exemple pour obtenir une meilleure liaison aux cellules, pour préserver ou augmenter la demi-vie du FH ou pour conserver ou favoriser le repliement caractéristique du FH en épingle à cheveu. Il existe donc un besoin de molécules dérivées du facteur H, lesdites molécules dérivées du facteur H présentant une activité de facteur H, présentant un avantage par rapport au facteur H ou ne présentant pas les inconvénients du facteur H, et dont l'activité serait de préférence conservée ou améliorée par rapport à celle du facteur H.
Résumé de l'invention:
La demanderesse répond ici à ce besoin en proposant des protéines recombinantes dérivées du facteur H présentant un réarrangement du nombre et de l'organisation des domaines SCR du facteur H qui conservent une activité de facteur H. Les protéines recombinantes selon l'invention comprennent à minima les domaines SCR1-4 (SCR1, SCR2, SCR3 et SCR4, dans cet ordre), SCR19 et SCR20 du facteur H.
Un objet de l'invention concerne donc une protéine recombinante possédant une activité de facteur H, comprenant, de l'extrémité N-terminale à l'extrémité C-terminale, une première séquence d'acides aminés comprenant au moins les domaines SCR1 à SCR4 du facteur H, et une deuxième séquence d'acides aminés comprenant au moins les domaines SCR19 et SCR20 du facteur H, ladite protéine recombinante n'étant pas un facteur H naturel, et sous réserve que si la première séquence est constituée des domaines SCR1 à SCR4 et la deuxième séquence est constituée des domaines SCR19 et SCR20, le linker soit un linker synthétique.
L'invention a également pour objet un acide nucléique codant une protéine recombinante selon l'invention, un vecteur comprenant un tel acide nucléique, une cellule hôte comprenant un tel acide nucléique ou un tel vecteur et un animal transgénique dont le génome comprend un tel acide nucléique.
L'invention a également pour objet une protéine recombinante selon l'invention, pour le traitement de maladies dues à une inflammation incontrôlée ou un dépôt de C3 convertase incontrôlé. Plus généralement la protéine recombinante selon l'invention peut-être utile pour le traitement de toute maladie pour laquelle une activité anti-complément du facteur H est bénéfique.
Description détaillée de l'invention:
Dans un mode de réalisation, la présente invention concerne une protéine recombinante dérivée du facteur H présentant un réarrangement des domaines SCR, tant sur le plan de leur nombre que de leur organisation, ladite protéine recombinante comprenant, dans cet ordre, une première séquence en acides aminés comprenant les domaines SCRl-4 du facteur H et une deuxième séquence en acides aminés comprenant les domaines SCR19 et SCR20 du facteur H. La première et/ou la deuxième séquence en acides aminés peuvent en outre comprendre un ou plusieurs autres domaines SCR de facteur H réarrangés
Dans un mode de réalisation, un ou plusieurs domaines SCR du facteur H peut être présent en plusieurs exemplaires. Par exemple, une protéine recombinante selon l'invention peut inclure un, deux, trois, ou plus de trois exemplaires d'un même SCR, par exemple un, deux, trois ou plus de trois exemplaires du domaine SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7, SCR8, SCR9, SCR10, SCR11, SCR12, SCR13, SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 et/SCR20 du facteur H. Selon un mode particulier de réalisation, la protéine recombinante selon l'invention comprend un, deux, trois ou plus de trois exemplaires du domaine SCR7 du facteur H, en particulier du domaine SCR7 du variant Y402 du facteur H. Une autre variante inclut une protéine recombinante comprenant de multiples exemplaires d'un ensemble de domaines SCR. Par exemple, la protéine recombinante selon l'invention peut comprendre un, deux, trois ou plus de trois répétitions des domaines SCR1 à SCR4, c'est-à-dire que la protéine comprend le motif (SCRl-SCR4)n, n étant un entier égal à 1, 2, 3 ou supérieur à 3, en particulier n étant égal à 1, 2 ou 3. Dans un autre mode de réalisation, le domaine ou l'ensemble de domaines présents en plusieurs exemplaires ne sont pas des répétitions des domaines ou ensemble de domaines, mais peuvent être présents dans la protéine recombinante séparés par d'autres domaines SCR. En d'autres termes, l'invention concerne notamment des protéines recombinantes comprenant, dans cet ordre, les domaines SCR1-SCR4, SCR7, SCR7 et SCR19-SCR20, ou encore les domaines SCR1-SCR4, SCR7, SCR1-SCR4, et SCR19-20, ou toute autre combinaison possible de ces domaines.
Le facteur H dont est dérivée la protéine selon l'invention peut être tout facteur H dont l'activité est celle du facteur H naturel. En particulier, par "facteur H" on entend ici toute protéine ayant la séquence en acides aminés du facteur H natif humain ou provenant d'une autre espèce (par exemple bovin, porcin, canin, murin). Préférentiellement, la protéine recombinante est dérivée du facteur H humain. Le terme comprend également tout recombinant, dérivé ou mutant ayant une séquence substantiellement homologue au facteur H natif. L'expression "séquence substantiellement homologue" comprend toute séquence soumise à une ou plusieurs substitutions, additions et/ou délétions, de préférence conservati ves. Les expressions "substitutions, additions et/ou délétions conservatives" expriment tout remplacement, ajout ou suppression de résidu acide aminé par un autre, sans altération majeure de la conformation générale et/ou de l'activité biologique du facteur H. La substitution conservative inclut, sans s'y limiter, le remplacement par un acide aminé ayant des propriétés similaires (comme par exemple la forme, la polarité, le potentiel de liaison hydrogène, l'acidité, la basicité, l'hydrophobicité et autres). Les acides aminés ayant des propriétés similaires sont bien connus dans l'art. Le terme "facteur H" comprend en outre les variations alléliques naturelles et/ou les isoformes du facteur H trouvées naturellement chez les individus d'une même espèce, et toute forme ou degré de glycosylation ou autre modification post-traductionnelle. Sont aussi compris dans le terme "facteur H" les homologues ou dérivés du facteur H qui présentent la même activité, ou une activité biologique supérieure par rapport a l'activité de la forme sauvage et/ou qui présentent une identité de séquence d'au moins 80 %, de préférence au moins 85 %, de préférence encore d'au moins 90 %, de préférence encore au moins 95 %, de préférence encore au moins 98 %, de préférence encore au moins 99 %.
Le variant du facteur H utilisé pour concevoir la protéine recombinante de la présente invention peut notamment être un variant mentionné dans le site internet http ://www.uniprot.org/uniprot/P08603.
L'activité anti-complément du facteur H se traduit par la régulation de la voie alterne du complément en maintenant un niveau basai de molécule C3b. Le facteur H compète avec le facteur B pour la liaison au C3b et accélère la dissociation de la C3 convertase (C3bBb) alterne déjà formée. Il agit comme cofacteur du Facteur I dans la protéolyse du C3b, libre ou lié à la surface des cellules, qui conduit à la forme inactive C3bi. Ainsi, les complexes immuns composés d'un complexe antigène-anticorps associé au composant du complément C3b ou les facteurs activateurs de la voie alterne du complément (surfaces bactériennes, cellules infectées, levures, parasites, lipopolysaccharides, endotoxines) ne peuvent plus activer la cascade subséquente du complément (composants C5-C9). Le terme "activité biologique" du facteur H inclut donc ici la capacité à inhiber la C3 convertase et/ou à servir de co-facteur du Facteur I, résultant en l'inhibition de l'activation de la cascade du complément. Dans un mode de réalisation particulier, la protéine recombinante conserve l'activité biologique d'un facteur H humain plasmatique.
L'activité biologique du facteur H humain plasmatique comprend la régulation de l'activité du facteur I, l'inhibition de la formation de la C3 convertase alterne et l'accélération de la dissociation de la C3 convertase.
Les méthodes pour déterminer les activités biologiques ci-dessus sont connues de l'homme du métier.
Dans un mode de réalisation plus particulier, ladite protéine recombinante conserve l'activité biologique d'un facteur H humain plasmatique pour accélérer la dissociation de la C3 convertase. La quantité de C3 convertase dissociée peut être déterminée en fonction de la concentration de protéine recombinante ajoutée. L'IC50 est déterminée à partir de l'équation calculée pour une sigmoïde à pente variable.
Dans un autre mode de réalisation plus particulier, ladite protéine recombinante conserve l'activité biologique d'un facteur H plasmatique pour réguler l'activité du facteur I.
Par ailleurs, l'activité biologique de facteur H peut être évaluée en mesurant l'activité de protection des globules rouges contre la lyse par le complément selon des procédures bien connues dans l'état de la technique.
La séquence SEQ ID NO: l représente la séquence en acides aminés du variant Y402 du facteur H humain dans lequel l'acide aminé en position 402 est une tyrosine. Cette séquence ne comprend pas de peptide signal. La séquence SEQ ID NO:2 représente la séquence en acides aminés du variant H402 du facteur H humain dans lequel l'acide aminé en position 402 est une histidine. Cette séquence ne comprend pas de peptide signal. Dans un mode de réalisation, un ou plusieurs domaines SCR de la protéine recombinante selon l'invention sont dérivés de l'un ou l'autre de ces deux variants. Selon un mode particulier de réalisation, la protéine recombinante comprend le domaine SCR7 du variant Y402 du facteur H. Selon des variantes de ce mode de réalisation, la première séquence de la protéine recombinante comprend les domaines S CRI à SCR7, les domaines S CRI à SCR8 ou les domaines S CRI à SCR9 du facteur H, le domaine SCR7 dans cette première séquence étant le domaine SCR7 du variant Y402 du facteur H. Dans ces variantes de réalisation, les autres domaines SCR peuvent être dérivés du variant Y402 du facteur H ou d'un autre variant du facteur H. Par ailleurs, la première séquence peut notamment être combinée à une deuxième séquence en acides aminés comprenant les domaines SCR19 et SCR20, SCR18 à SCR20, SCR17 à SCR20 ou SCR16 à SCR20 du facteur H, la seconde séquence en acides aminés étant en particulier dérivée du variant Y402 ou du variant H402 du facteur H. Ces protéines recombinantes incluent le polymorphisme Y402 présent dans le SCR7.
Dans un mode de réalisation, la protéine recombinante selon l'invention comprend, dans cet ordre, les domaines SCR1, SCR2, SCR3, SCR4, SCR19 et SCR20 du facteur H. Dans ce mode de réalisation, les domaines SCR4 et SCR19 sont liés entre eux par un linker non naturel (ou synthétique) constitué d'une séquence comprenant entre 2 et 20 acides aminés. Par « linker non naturel (ou synthétique) » on désigne notamment un linker qui ne correspond pas à la séquence trouvée entre la quatrième cystéine du domaine SCR4 et la première cystéine du domaine SCR19. En particulier, la séquence en acide aminés du linker est choisie de telle manière qu'elle soit codée par un acide nucléique qui, lorsqu'il est introduit dans un vecteur de clonage et/ou d'expression, comprend un site unique de restriction (voir ci-dessous). Par exemple, le linker peut être de séquence GASG (SEQ ID NO:3).
Selon un mode de réalisation, la première ou la deuxième séquence en acides aminés de la protéine recombinante selon l'invention comprend un ou plusieurs domaines SCR du facteur H supplémentaires choisi(s) parmi les domaines SCR5, SCR6, SCR7, SCR8, SCR9, SCR10, SCR11, SCR12, SCR13, SCR14, SCR15, SCR16, SCR17 et SCR18. L'ordre de ces domaines dans la protéine recombinante peut correspondre à l'ordre des mêmes domaines dans le facteur H naturel. Alternativement, l'ordre des domaines peut être différent de celui du facteur H naturel.
La séquence en acides aminés du domaine SCR1 (acides aminés 21 à 80) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 4 (CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPL R C). La séquence du domaine SCR1 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO:4. Dans un mode de réalisation, la séquence du domaine SCR1 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 4.
La séquence en acides aminés du domaine SCR2 (acides aminés 85 à 141) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 5 (CGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPIC ). La séquence du domaine SCR2 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO:5. Dans un mode de réalisation, la séquence du domaine SCR2 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 5.
La séquence en acides aminés du domaine SCR3 (acides aminés 146 à 205) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 6 (CLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKE KPKC). La séquence du domaine SCR3 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO:6. Dans un mode de réalisation, la séquence du domaine SCR3 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 6.
La séquence en acides aminés du domaine SCR4 (acides aminés 210 à 262) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 7 (CKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSC). La séquence du domaine SCR4 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO:7. Dans un mode de réalisation, la séquence du domaine SCR4 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 7.
La séquence en acides aminés du domaine SCR5 (acides aminés 266 à 320) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 8 (CDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRC). La séquence du domaine SCR5 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO:8. Dans un mode de réalisation, la séquence du domaine SCR5 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 8.
La séquence en acides aminés du domaine SCR6 (acides aminés 325 à 385) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 9 (CDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGW SPAVPC). La séquence du domaine SCR6 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID N0:9. Dans un mode de réalisation, la séquence du domaine SCR6 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 9.
La séquence en acides aminés du domaine SCR7 (acides aminés 389 à 442) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 10 (CYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRC). La séquence du domaine SCR7 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO: 10. Dans un mode de réalisation, la séquence du domaine SCR7 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 10.
La séquence en acides aminés du domaine SCR8 (acides aminés 448 à 505) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 11 (CSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTC ). La séquence du domaine SCR8 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO: l 1. Dans un mode de réalisation, la séquence du domaine SCR8 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 11.
La séquence en acides aminés du domaine SCR9 (acides aminés 509 à 564) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 12 (CDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPIC) . La séquence du domaine SCR9 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO: 12. Dans un mode de réalisation, la séquence du domaine SCR9 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 12.
La séquence en acides aminés du domaine SCR10 (acides aminés 569 à 623) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 13 (CELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPIC). La séquence du domaine SCR10 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO: 13. Dans un mode de réalisation, la séquence du domaine SCR10 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 13.
La séquence en acides aminés du domaine SCR11 (acides aminés 630 à 674) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 14 (CGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVC). La séquence du domaine SCR11 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO: 14. Dans un mode de réalisation, la séquence du domaine SCR11 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 14.
La séquence en acides aminés du domaine SCR12 (acides aminés 691 à 744) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 15 (CGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQC). La séquence du domaine SCR12 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO: 15. Dans un mode de réalisation, la séquence du domaine SCR12 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 15.
La séquence en acides aminés du domaine SCR13 (acides aminés 753 à 803) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 16 (CKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNC). La séquence du domaine SCR13 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO: 16. Dans un mode de réalisation, la séquence du domaine SCR13 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 16.
La séquence en acides aminés du domaine SCR14 (acides aminés 811 à 864) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 17 (CPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLC). La séquence du domaine SCR14 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO: 17. Dans un mode de réalisation, la séquence du domaine SCR14 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 17. La séquence en acides aminés du domaine SCR15 (acides aminés 869 à 926) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 18 (CSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQC). La séquence du domaine SCR15 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO: 18. Dans un mode de réalisation, la séquence du domaine SCR15 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 18.
La séquence en acides aminés du domaine SCR16 (acides aminés 931 à 984) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 19 (CKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSC). La séquence du domaine SCR16 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO: 19. Dans un mode de réalisation, la séquence du domaine SCR16 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 19.
La séquence en acides aminés du domaine SCR17 (acides aminés 989 à 1043) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 20 (CLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTC). La séquence du domaine SCR17 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO:20. Dans un mode de réalisation, la séquence du domaine SCR17 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 20.
La séquence en acides aminés du domaine SCR18 (acides aminés 1048 à 1102) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 21 (CVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQC) . La séquence du domaine SCR18 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO:21. Dans un mode de réalisation, la séquence du domaine SCR18 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 21.
La séquence en acides aminés du domaine SCR19 (acides aminés 1109 à 1163) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 22 (CGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCR GQWSEPPKC). La séquence du domaine SCR19 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO:22. Dans un mode de réalisation, la séquence du domaine SCR18 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 22.
La séquence en acides aminés du domaine SCR20 (acides aminés 1167 à 1231) du variant Y402 du facteur H humain est représentée par la séquence SEQ ID NO: 23 (CVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKL EYPTCAKR). La séquence du domaine SCR18 introduit dans la protéine selon l'invention a au moins 85 %, notamment au moins 90 %, notamment au moins 95 %, notamment au moins 99 % d'identité avec la séquence SEQ ID NO:23. Dans un mode de réalisation, la séquence du domaine SCR20 introduit dans la protéine selon l'invention est celle représentée dans la séquence SEQ ID NO: 23.
Dans un mode de réalisation, la première ou la deuxième séquence en acides aminés comprend au moins les domaines SCR12, SCR13 et SCR14 du facteur H. Dans un autre mode de réalisation, aucun des domaines SCR12, S CRI 3 et S CRI 4 n'est présent dans la protéine recombinante selon l'invention. Une variante de réalisation de la présente invention concerne une protéine recombinante dont les domaines SCR sont constitués, dans cet ordre, des domaines SCR1, SCR2, SCR3, SCR4, SCR12, SCR13, SCR14, SCR19 et SCR20. Une telle protéine est représentée dans la séquence SEQ ID NO : 142.
Chaque domaine SCR inclus dans la première ou la deuxième séquence en acides aminés peut être lié au(x) SCR contigu(s) au moyen du linker naturel trouvé entre lesdits domaines SCR, le cas échéant. Alternativement, le linker entre chaque domaine SCR de la protéine recombinante peut être un linker non naturel. Le linker non naturel peut être constitué d'une séquence comprenant entre 2 et 20 acides aminés, notamment entre 3 et 8 acides aminés. Par ailleurs, la liaison entre la première et la deuxième séquence en acides aminés peut être réalisée au moyen d'un linker naturel ou synthétique présent en position C-terminale de la première séquence en acides aminées ou en position N-terminale de la deuxième séquence en acides aminés. Par exemple, le premier et le deuxième polypeptide peuvent être liés par un linker de séquence GASG (SEQ ID NO:3). Par ailleurs, la première et la deuxième séquences en acides aminés peuvent être liées entre elles par un linker combinant la séquence linker naturelle suivant le dernier domaine de la première séquence (i.e. le domaine en position C- terminale de la première séquence) et un linker synthétique tel que le linker GASG. Les linkers naturels trouvés en position C-terminale de chacun des domaines SCR du facteur H sont par exemple: QKRP (SEQ ID NO: 143) pour le domaine SCR1 ; EVVK (SEQ ID NO: 144) pour le domaine SCR2; VEIS (SEQ ID NO: 145) pour le domaine SCR3; EEKS (SEQ ID NO: 146) pour le domaine SCR4; TLKP (SEQ ID NO: 147) pour le domaine SCR5; LRK pour le domaine SCR6; IRVKT (SEQ ID NO: 148) pour le domaine SCR7; IKS pour le domaine SCR8; YERE (SEQ ID NO: 149) pour le domaine SCR9; KEQVQS (SEQ ID NO: 150) pour le domaine SCR10; IVEEST (SEQ ID NO: 151) pour le domaine SCRl l ; VAIDKLKK (SEQ ID NO: 152) pour le domaine SCR12; SMAQIQL (SEQ ID NO: 153) pour le domaine SCR13; VEKIP (SEQ ID NO: 154) pour le domaine SCR14; EGLP (SEQ ID NO: 155) pour le domaine SCR15; IKTD (SEQ ID NO: 156) pour le domaine SCR16; RDTS (SEQ ID NO: 157) pour le domaine SCR17; KDSTGK (SEQ ID NO: 158) pour le domaine SCR18; LHP pour le domaine SCR19.
Selon un mode de réalisation, la première séquence en acides aminés comprend les domaines SCR1, SCR2, SCR3 et SCR4 du facteur H.
Selon un mode de réalisation, la première séquence en acides aminés comprend les domaines SCR1, SCR2, SCR3, SCR4 et SCR5 du facteur H.
Selon un autre mode de réalisation, la première séquence en acides aminés comprend les domaines SCR1, SCR2, SCR3, SCR4, SCR5 et SCR6 du facteur H.
Selon un autre mode de réalisation, la première séquence en acides aminés comprend les domaines SCR1, SCR2, SCR3, SCR4, SCR5, SCR6 et SCR7 du facteur H.
Selon un autre mode de réalisation, la première séquence en acides aminés comprend les domaines SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7 et SCR8 du facteur H.
Selon un autre mode de réalisation, la première séquence en acides aminés comprend les domaines SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7, SCR8 et SCR9 du facteur H.
Selon un autre mode de réalisation, la première séquence en acides aminés comprend les domaines SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7, SCR8, SCR9 et SCR10 du facteur H.
Selon un autre mode de réalisation, la première séquence en acides aminés comprend les domaines SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7, SCR8, SCR9, SCR10 et SCRl l facteur H.
Selon un autre mode de réalisation, la première séquence en acides aminés comprend les domaines SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7, SCR8, SCR9, SCR10, SCRl l et SCR12 facteur H. Selon un autre mode de réalisation, la première séquence en acides aminés comprend les domaines SCR1, SCR2, SCR3, SCR4, SCR5, SCR6, SCR7, SCR8, SCR9, SCR10, SCRl l, SCR12 et SCR13 facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines SCR18, SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines SCR17, SCR18, SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines SCR16, SCR17, SCR18, SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines SCR15, SCR16, SCR17, SCR18, SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines
SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines
SCR13, SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines
SCR12, SCR13, SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines
SCRl l, SCR12, SCR13, SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines SCR10, SCRl l, SCR12, SCR13, SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines SCR9, SCR10, SCRl l, SCR12, SCR13, SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la deuxième séquence en acides aminés comprend les domaines SCR8, SCR9, SCR10, SCRl l, SCR12, SCR13, SCR14, SCR15, SCR16, SCR17, SCR18, SCR19 et SCR20 du facteur H.
Selon un autre mode de réalisation, la protéine recombinante possédant une activité de facteur H comprend les première et deuxième séquences en acides aminés listées dans le tableau 1 ci- dessous, ces séquences étant séparées par un linker, notamment un linker artificiel, en particulier le linker GASG (SEQ ID NO:3).
Tableau 1
Figure imgf000015_0001
Figure imgf000015_0002
Première séquence Deuxième séquence Première séquence Deuxième séquence
SCR1 àSCRll SCR15àSCR20 SCR1 à SCR12 SCR14 à SCR20
SCR1 àSCRll SCR14 à SCR20 SCR1 à SCR12 SCR13 à SCR20
SCR1 àSCRll SCR13 à SCR20 SCR1 àSCR13 SCR19àSCR20
SCR1 àSCRll SCR12 à SCR20 SCR1 à SCR13 SCR18 à SCR20
SCR1 à SCR12 SCR19àSCR20 SCR1 à SCR13 SCR17 à SCR20
SCR1 à SCR12 SCR18 à SCR20 SCR1 àSCR13 SCR16àSCR20
SCR1 à SCR12 SCR17 à SCR20 SCR1 àSCR13 SCR15àSCR20
SCR1 à SCR12 SCR16àSCR20 SCR1 àSCR13 SCR14 à SCR20
SCR1 à SCR12 SCR15àSCR20
Selon un mode particulier de réalisation, la protéine recombinante possédant une activité de facteur H comprend les première et deuxième séquences en acides aminés listées dans le tableau 2 ci-dessous, ces séquences étant séparées par un linker, notamment un linker artificiel, en particulier le linker G AS G (SEQ ID NO:3).
Tableau 2
Première séquence Deuxième séquence
SCR1 à SCR4 SCR19àSCR20
SCR1 à SCR4 SCR16àSCR20
SCR1 à SCR4 SCR15àSCR20
SCR1 à SCR4 SCR14 à SCR20
SCR1 à SCR4 SCR11 àSCR20
SCR1 à SCR4 SCR10àSCR20
SCR1 à SCR4 SCR9 à SCR20
SCR1 à SCR4 SCR8 à SCR20
SCR1 à SCR7 SCR16àSCR20
SCR1 à SCR7 SCR15àSCR20
SCR1 à SCR7 SCR14 à SCR20
SCR1 à SCR7 SCR11 à SCR20
SCR1 à SCR7 SCR10àSCR20
SCR1 à SCR7 SCR9 à SCR20
SCR1 à SCR7 SCR8 à SCR20
Figure imgf000016_0001
SCR1 à SCR8 SCR16àSCR20 Selon une variante préférée de l'invention, la première séquence comprend les domaines SCR1 à SCR7 du facteur H, et la deuxième séquence est choisie dans le groupe constitué : - des domaines SCR9 à SCR20,
- des domaines SCR11 à SCR20 ; et
- des domaines SCR14 à SCR20 du facteur H.
Selon une autre variante préférée, la première séquence comprend les domaines SCR1 à SCR8 et la deuxième séquence comprend les domaines SCR10 à SCR20.
Selon une autre variante préférée, la première séquence comprend les domaines SCR1 à SCR4 du facteur H et la deuxième séquence comprend les domaines SCR16 à SCR20 du facteur H, une troisième séquence comprenant le domaine SCR7 du facteur 7 étant comprise entre la première et la deuxième séquence, et étant plus particulièrement séparés de ces dernières par des linkers tels que ceux décrits ci-dessus.
Selon un mode de réalisation, la première séquence en acides aminés comprend un peptide signal (PS) en position N-terminale. Le peptide signal peut être le peptide signal naturel du facteur H (MRLLAKIICLMLWAICVA - SEQ ID NO:24), le peptide signal d'une protéine différente du facteur H, ou un peptide signal décrit dans la demande PCT/2001/050544, notamment le peptide MRWSWIFLLLLSITSANA (SEQ ID NO: 25; ou autrement appelé PS-MB7 par la suite). Le peptide signal naturel d'une protéine différente du facteur H humain peut être un peptide signal choisi parmi les peptides signaux de toutes les protéines qui sont sécrétées chez les eucaryotes et notamment chez les mammifères et plus particulièrement chez l'homme comme ceux des immunoglobulines, des facteurs de croissance comme ΓΕΡΟ, des hormones comme l'insuline, des enzymes comme le trypsinogène, des facteurs de la coagulation tel que la prothrombine. La présence d'un peptide signal permet de conférer une meilleure sécrétion de protéine recombinante dans le milieu de culture.
Selon un mode de réalisation, l'invention concerne l'un des peptides du tableau 1 dans lequel la première séquence en acides aminés comprend en N-terminal un tel peptide signal, notamment le peptide naturel du facteur H de séquence SEQ ID NO:24 ou le peptide signal PS-MB7 de séquence SEQ ID NO:25. Selon un autre mode de réalisation, la protéine recombinante selon l'invention est choisie parmi l'une des protéines du tableau 1 , les première et deuxième séquences étant séparées par un linker, notamment un linker GASG (SEQ ID NO:3).
Selon un mode particulier de réalisation, la protéine recombinante selon l'invention est choisie parmi l'une des protéines listées dans le tableau 2 ci-dessous dans lesquelles la première séquence en acides aminés comprend un peptide signal de séquence SEQ ID NO: 25 et les première et seconde séquences sont séparées par un linker de séquence GASG (SEQ ID NO:3).
Tableau 3
Figure imgf000018_0001
SEQ ID Première séquence linker Deuxième séquence
NO:
57 PS-MB7 + SCRl à SCR9 GASG SCR15 à SCR20
58 PS-MB7 + SCRl à SCR9 GASG SCRl 4 à SCR20
59 PS-MB7 + SCRl à SCR9 GASG SCRl 3 à SCR20
60 PS-MB7 + SCRl à SCR9 GASG SCRl 2 à SCR20
61 PS-MB7 + SCRl à SCR9 GASG SCRl 1 à SCR20
62 PS-MB7 + SCRl à SCR9 GASG SCR10 à SCR20
63 PS-MB7 + SCRl à SCRl 0 GASG SCR19 à SCR20
64 PS-MB7 + SCRl à SCRl 0 GASG SCR16 à SCR20
65 PS-MB7 + SCRl à SCRl 0 GASG SCR15 à SCR20
66 PS-MB7 + SCRl à SCRl 0 GASG SCRl 4 à SCR20
67 PS-MB7 + SCRl à SCRl 0 GASG SCRl 3 à SCR20
68 PS-MB7 + SCRl à SCRl 0 GASG SCRl 2 à SCR20
69 PS-MB7 + SCRl à SCRl 0 GASG SCRl 1 à SCR20
70 PS-MB7 + SCRl à SCRl 1 GASG SCR19 à SCR20
71 PS-MB7 + SCRl à SCRl 1 GASG SCR16 à SCR20
72 PS-MB7 + SCRl à SCRl 1 GASG SCR15 à SCR20
73 PS-MB7 + SCRl à SCRl 1 GASG SCRl 4 à SCR20
74 PS-MB7 + SCRl à SCRl 1 GASG SCRl 3 à SCR20
75 PS-MB7 + SCRl à SCRl 1 GASG SCRl 2 à SCR20
76 PS-MB7 + SCRl à SCR12 GASG SCR19 à SCR20
77 PS-MB7 + SCRl à SCR12 GASG SCR16 à SCR20
78 PS-MB7 + SCRl à SCR12 GASG SCR15 à SCR20
79 PS-MB7 + SCRl à SCR12 GASG SCRl 4 à SCR20
80 PS-MB7 + SCRl à SCR12 GASG SCRl 3 à SCR20
81 PS-MB7 + SCRl à SCRl 3 GASG SCR19 à SCR20
82 PS-MB7 + SCRl à SCRl 3 GASG SCR16 à SCR20
83 PS-MB7 + SCRl à SCRl 3 GASG SCR15 à SCR20
84 PS-MB7 + SCRl à SCRl 3 GASG SCRl 4 à SCR20
Selon un mode particulier de réalisation, la protéine recombinante selon l'invention contient une première séquence comprenant les domaines SCRl à SCR4 du facteur H, et une deuxième séquence choisie dans le groupe constitué :
- des domaines SCRl 6 à SCR20,
- des domaines SCRl 5 à SCR20 ;
- des domaines SCR10 à SCR20 ; et
- des domaines SCR8 à SCR20 du facteur H.
Selon un autre mode de réalisation, la protéine recombinante selon l'invention contient une première séquence comprenant les domaines SCRl à SCR7 du facteur H, et une deuxième séquence comprenant les domaines SCRl 6 à SCR20 du facteur H, ladite deuxième séquence étant de préférence choisie dans le groupe constitué :
- des domaines SCRl 5 à SCR20
- des domaines SCRl 4 à SCR20 ;
- des domaines SCRl 1 à SCR20 ;
- des domaines SCR10 à SCR20 ;
- des domaines SCR9 à SCR20; et
- des domaines SCR8 à SCR20 du facteur H. Selon une autre variante, l'invention concerne une protéine recombinante telle que décrite ci- dessus, la première séquence comprenant les domaines SCRl à SCR8 du facteur H, et la deuxième séquence comprenant les domaines SCRl 6 à SCR20 du facteur H, ladite deuxième séquence comprenant de préférence les domaines SCR10 à SCR20 du facteur H. Selon un autre mode de réalisation, la protéine recombinante selon l'invention contient une première séquence comprenant les domaines SCRl à SCR4 du facteur H et une deuxième séquence comprenant les domaines SCRl 6 à SCR20 du facteur H, une troisième séquence comprenant le domaine SCR7 du facteur H étant comprise entre la première et la deuxième séquence.
Selon une variante de l'invention, la première séquence comprend un peptide signal de séquence SEQ ID NO :25 et les domaines SCRl à SCR7 du facteur H, et la deuxième séquence est choisie dans le groupe constitué :
- des domaines SCR9 à SCR20,
- des domaines SCRl 1 à SCR20 ; et
- des domaines SCRl 4 à SCR20 du facteur H.
Dans un mode particulier de réalisation de cette variante, la première et la seconde séquences sont séparées par un linker de séquence GASG. Selon une autre variante préférée, la première séquence comprend un peptide signal de séquence SEQ ID NO :25 et les domaines SCRl à SCR8 et la deuxième séquence comprend les domaines SCR10 à SCR20. Dans un mode particulier de réalisation de cette variante, la première et la seconde séquences sont séparées par un linker de séquence GASG. Selon une autre variante préférée, la première séquence comprend un peptide signal de séquence SEQ ID NO :25 et les domaines SCR1 à SCR4 du facteur H et la deuxième séquence comprend les domaines SCR16 à SCR20 du facteur H, une troisième séquence comprenant le domaine SCR7 du facteur 7 étant comprise entre la première et la deuxième séquence, et étant séparés de ces dernières par des linkers tels que ceux décrits ci-dessus. Dans un mode particulier de réalisation de cette variante, la première et la troisième séquences, et la troisième et la seconde séquences sont séparées par un linker de séquence GASG. Une telle séquence est représentée dans SEQ ID NO: 159. La présente invention concerne également une composition pharmaceutique comprenant une protéine recombinante selon l'invention.
L'invention a également pour objet une construction d'acide nucléique codant une protéine recombinante ayant une activité de facteur H telle que décrite ci-dessus.
Avantageusement, les acides nucléiques codant les protéines recombinantes selon l'invention ont fait l'objet d'une optimisation de codons.
L'optimisation de codon a pour but de remplacer les codons naturels par des codons dont les ARN de transfert (ARNt) portant les acides aminés sont les plus fréquents dans le type cellulaire considéré. Le fait de mobiliser des ARNt fréquemment rencontrés a pour avantage majeur d'accroître la vitesse de traduction des ARN messagers (ARNm) et donc d'augmenter le titre final (Carton JM et al, Protein Expr Purif, 2007). L'optimisation de séquence joue aussi sur la prédiction des structures secondaires d'ARNm qui pourraient ralentir la lecture par le complexe ribosomal. L'optimisation de séquence a également un impact sur le pourcentage de G/C qui est directement lié à la demi- vie des ARNm et donc à leur potentiel d'être traduit (Chechetkin, J. of theoretical biology 242, 2006 922-934).
L'optimisation de codons peut être faite par substitution des codons naturels en utilisant des tables de fréquence des codons (codon Usage Table) pour mammifères et plus particulièrement pour Homo sapiens. Il existe des algorithmes présents sur internet et mis à disposition par les fournisseurs de gènes de synthèse (DNA2.0, GeneArt, MWG, Genscript) qui permettent de faire cette optimisation de séquence.
A titre illustratif, une séquence, ayant fait l'objet d'une optimisation de codon, est représentée par la séquence SEQ ID NO : 85. Cette séquence comprend le peptide signal naturel du facteur H.
Les acides nucléiques selon l'invention peuvent comprendre un site de restriction unique entre les deux séquences d'acide nucléique codant la première et la deuxième séquence en acides aminés de la protéine recombinante selon l'invention. Ce site unique de restriction peut notamment correspondre au site Nhe I présent dans la partie codant le linker GASG (séquence nucléique : GCCGCTAGCGCC (SEQ ID NO :86), la partie soulignée correspondant au site Nhel qui correspond aux acides aminés AS mentionné ci-dessus. Ce site de restriction unique permet d'envisager une amélioration des protéines recombinantes produites, notamment par introduction facilitée d'un ou plusieurs domaines SCR supplémentaires au niveau de la séquence protéique correspondant au dit site de restriction, ou par introduction d'une séquence en acides aminés différente d'un domaine SCR. Il peut notamment s'agir d'un autre domaine protéique n'appartenant pas au facteur H naturel, ou d'un linker de taille et de séquence différente (notamment un linker plus long).
Les acides nucléiques codant la protéine recombinante selon l'invention peuvent être construits selon toute méthode connue de l'homme du métier dans le domaine de la biologie moléculaire. Avantageusement toutefois, ledit acide nucléique est construit en deux temps selon un procédé propre à la présente invention. Par exemple, une banque d'acides nucléiques clonés dans des vecteurs de clonage ou d'expression peut être constituée. Chaque vecteur de la banque contient une séquence codant l'une des première ou deuxième séquences en acides aminés composant la protéine recombinante selon l'invention. Ainsi, on décrit un vecteur comprenant les séquences codant une première séquence en acides aminés comprenant à minima les séquences des domaines SCR1 à SCR4 du facteur H (ou vecteur N-Ter). De même, on décrit un vecteur comprenant les séquences codant une deuxième séquence en acides aminés comprenant à minima les séquences des domaines SCR19 et SCR20 du facteur H (ou vecteur C-Ter).
Les vecteurs N-Ter et C-Ter sont conçus de manière à comprendre des sites uniques de restriction utiles pour l'excision puis l'assemblage des fragments d'acides nucléiques codant chacune des parties de la protéine recombinante dans un seul et même vecteur. Les constructions permettant l'expression des protéines du tableau 2 ci-dessus peuvent ainsi être produites à partir de 8 vecteurs N-Ter et 10 vecteurs C-Ter. Cette stratégie est décrite dans les exemples ci-dessous.
Les acides nucléiques selon l'invention peuvent également comprendre toute séquence utile, notamment toute séquence permettant une optimisation de l'expression ou la sécrétion de la protéine recombinante ou pour faciliter le clonage et le sous clonage des acides nucléiques de l'invention. Par exemple, l'acide nucléique pourra comprendre en 5' un site unique de restriction, une séquence codante et/ou une séquence codant un peptide signal. En 3', il pourra notamment être utile d'introduire une séquence codant un motif d'acides aminés utile pour le marquage ou la purification de la protéine recombinante, par exemple une étiquette histidine, et un ou plusieurs sites de restriction.
Dans un mode de réalisation, la construction d'acide nucléique selon l'invention comprend une séquence codant un peptide signal choisi parmi:
- un acide nucléique représenté par la séquence SEQ ID NO : 87 et codant le peptide signal naturel du facteur H, ou
- un acide nucléique représenté par la séquence SEQ ID NO : 88 ou par une séquence ayant au moins 85%, notamment 90%>, particulièrement 95% d'identité de séquence avec la séquence SEQ ID NO : 88, et codant le peptide signal du facteur H, (PS naturel optimisé) ou
- un acide nucléique codant un peptide signal naturel d'une protéine différente du facteur H, ou
- un acide nucléique codant le peptide signal codé par la séquence SEQ ID NO : 89 (décrit dans la demande PCT/FR2011/050544) ou par une séquence ayant au moins 85%, notamment 90%), particulièrement 95% d'identité de séquence avec la séquence SEQ ID NO : 89.
La séquence SEQ ID NO : 88 ou une séquence ayant au moins 85%, notamment 90%>, particulièrement 95% d'identité de séquence avec la séquence SEQ ID NO : 88 est une séquence obtenue par l'optimisation de codons à partir de la séquence SEQ ID NO : 87.
L'acide nucléique représenté par la séquence SEQ ID NO : 89 ou par une séquence ayant au moins 85%, notamment 90%, particulièrement 95% d'identité de séquence avec la séquence SEQ ID NO : 89 code le peptide signal artificiel PS-MB7 décrit ci-dessus.
Dans un mode de réalisation, la construction d'acide nucléique codant la protéine recombinante selon l'invention comprend, ou est constitué par:
- un acide nucléique codant un peptide signal, notamment un acide nucléique représenté par la séquence SEQ ID NO : 87 et codant le peptide signal naturel du facteur H, ou un acide nucléique représenté par la séquence SEQ ID NO : 88 ou par une séquence ayant au moins 85%), notamment 90%, particulièrement 95% d'identité de séquence avec la séquence SEQ ID NO : 88, et codant le peptide signal du facteur H, (PS naturel optimisé) ou un acide nucléique codant un peptide signal naturel d'une protéine différente du facteur H, ou un acide nucléique codant le peptide signal codé par la séquence SEQ ID NO : 89 (décrit dans la demande PCT/FR2011/050544) ou par une séquence ayant au moins 85%, notamment 90%, particulièrement 95% d'identité de séquence avec la séquence SEQ ID NO : 89;
- un acide nucléique codant au moins les domaines SCR1, SCR2, SCR3 et SCR4 du facteur H; - un acide nucléique codant un linker, notamment un linker GASG (SEQ ID NO:3), ledit acide nucléique codant un linker comprenant un site unique de restriction, notamment un site Nhel;
- un acide nucléique codant au moins les domaines SCR19 et SCR20 du facteur H.
Selon un mode de réalisation, la construction d'acide nucléique permet l'expression d'une protéine recombinante choisie parmi l'une des séquences SEQ ID NO:26 à SEQ ID NO:84. L'invention concerne également un vecteur d'expression comprenant la construction d'acide nucléique décrite ci-dessus, liée de manière fonctionnelle à des séquences de contrôle de l'expression dudit acide nucléique. Les séquences de contrôle peuvent notamment comprendre un promoteur (notamment un promoteur CMV), un enhancer, et toute séquence connue de l'homme du métier utile pour permettre l'expression de la protéine recombinante dans une cellule eucaryote, notamment une cellule de mammifère.
A ce titre, l'invention concerne par ailleurs une cellule eucaryote recombinante, notamment une cellule de mammifère, plus particulièrement une cellule non-humaine (e.g. une cellule CHO) ou humaine, transformée au moyen de la construction d'acide nucléique ou du vecteur d'expression selon l'invention. Dans un mode de réalisation avantageux de la présente invention, la protéine recombinante telle que décrite ci-dessus est produite dans la lignée cellulaire PER.C6® ou une lignée cellulaire HEK, notamment la lignée cellulaire HEK 293F. La lignée cellulaire PER.C6® est issue de cellules rétinales primaires humaines dans lesquelles un fragment d'ADN adénoviral Ad5 qui contient à la fois le gène E1A et le gène ElB est inséré dans les cellules par un vecteur. Ce fragment d'ADN adénoviral permet de conférer l'immortalité aux cellules dans lesquelles il est inséré, par l'intermédiaire de la protéine ElB qui inhibe la protéine p53. La protéine El A quant à elle a un tropisme pour le promoteur viral hCMV et permet sa transactivation et la potentialisation de la séquence génique qui sera insérée en 3' de ce dernier et qui pourra être la protéine recombinante selon l'invention.
La présente invention concerne particulièrement l'utilisation de la lignée cellulaire PER.C6® pour la mise œuvre d'un procédé de préparation d'une protéine recombinante ayant une activité de facteur H, notamment l'une des protéines de séquence SEQ ID NO: 26 à SEQ ID NO:84.
La présente invention concerne aussi particulièrement l'utilisation de la lignée cellulaire HEK 293F pour la mise œuvre d'un procédé de préparation d'une protéine recombinante selon l'invention, notamment l'une des protéines recombinantes représentées par l'une des séquences SEQ ID NO: 26 à SEQ ID NO: 84. L'invention concerne également un procédé pour la production d'une protéine recombinante possédant une activité de facteur H. Le procédé selon l'invention, notamment l'une des protéines représentées par les séquences SEQ ID NO:26 à 84, ledit procédé comprenant la culture d'une cellule recombinante selon l'invention transformée par un vecteur comprenant la construction d'acide nucléique selon l'invention codant ladite protéine recombinante.
Le vecteur comprenant un tel acide nucléique peut être un quelconque vecteur d'expression pour les lignées cellulaires eucaryotes connues de l'homme du métier.
La transformation de la lignée cellulaire peut être mise en œuvre par des techniques d'électroporation, de nucléofection type AMAXA, un "pistolet à gène" (gène gun) ou encore à l'aide d'un agent de transfection connu de l'homme de métier, tel que des agents cationiques, des liposomes ou des polymères tel que la fectine ou l'agent PEI.
Dans un mode de réalisation particulier, le procédé selon la présente invention comprend les étapes suivantes :
(i) la transfection d'une cellule eucaryote par un vecteur d'expression comprenant une construction d'acide nucléique codant la protéine recombinante, pour obtenir une cellule transfectée,
(ii) la culture de ladite cellule transfectée, pour obtenir l'expression de la protéine recombinante dans le milieu de culture.
Ledit vecteur d'expression peut contenir un gène de résistance aux antibiotiques pour permettre la sélection des cellules transfectées lors de l'établissement de cellules produisant de façon stable la protéine d'intérêt.
Dans un mode de réalisation, la protéine recombinante selon l'invention est produite à une concentration supérieure ou égale à 10 mg/L telle que détectée par dosage ELIS A de surnageant de culture, après 7 jours de production en mode batch.
La purification de la protéine recombinante peut être mise en œuvre par des techniques de chromatographie en une, deux ou plusieurs étapes. La purification en une étape peut-être une colonne échangeuse d'ions ou une colonne d'affinité (héparine, ligand du facteur H ou anticorps anti-facteur H). La purification en deux étapes peut-être une étape de chromatographie sur colonne échangeuse de cations suivi d'une étape de chromatographie sur colonne échangeuse d'anions ou une étape de chromatographie sur colonne échangeuse d'anions suivi d'une étape de chromatographie sur colonne échangeuse de cations ou une étape de chromatographie sur colonne échangeuse d'ions suivi d'une étape de chromatographie sur colonne d'affinité ou une étape de chromatographie sur colonne d'affinité suivi d'une étape de chromatographie sur colonne échangeuse d'ions. La purification en plus de deux étapes peut être réalisée par une combinaison de ces différentes chromatographies. Une étape de diafiltration, d'ultrafiltration ou de gel filtration peut-être réalisée en complément. La pureté d'un produit après une telle purification peut atteindre 99% de produit purifié.
Les protéines selon l'invention peuvent également être produites dans le lait d'animaux transgéniques non humains, tels qu'une chèvre, un lapin, la brebis, la vache ou un porc. Dans ce cas, la sécrétion des protéines par les glandes mammaires, permettant sa sécrétion dans le lait du mammifère transgénique, implique le contrôle de l'expression des protéines selon l'invention de manière tissu-dépendante. De telles méthodes de contrôle sont bien connues de l'homme du métier. Le contrôle de l'expression est effectué grâce à des séquences permettant l'expression de la protéine vers un tissu particulier de l'animal. Il s'agit notamment des séquences promotrices WAP, bêta-caséine, bêta-lactoglobuline et des séquences peptides signal. Le procédé d'extraction de protéines d'intérêt à partir du lait d'animaux transgéniques est décrit dans le brevet EP 0 264 166.
Un autre aspect de l'invention concerne également l'utilisation d'une protéine recombinante selon l'invention en tant que médicament.
L'invention concerne également l'utilisation d'une protéine recombinante selon l'invention pour la fabrication d'un médicament destiné au traitement d'une maladie impliquant une activité indésirable ou inappropriée du complément, notamment pour le traitement de maladies dues à une inflammation incontrôlée ou un dépôt de C3b incontrôlé. L'invention concerne aussi une méthode de traitement d'une maladie impliquant une activité indésirable ou inappropriée du complément, comprenant l'administration d'une protéine recombinante selon l'invention à un patient nécessitant un tel traitement. Le terme « traitement » comprend aussi bien un traitement curatif qu'un traitement prophylactique de la maladie. Un traitement curatif est défini par un traitement aboutissant à une guérison ou un traitement allégeant, améliorant et/ou éliminant, réduisant et/ou stabilisant les symptômes d'une maladie ou la souffrance qu'elle provoque. Un traitement prophylactique comprend aussi bien un traitement aboutissant à la prévention d'une maladie qu'un traitement réduisant et/ou retardant l'incidence d'une maladie ou le risque qu'elle survienne. L'invention vise notamment le traitement d'une maladie choisie dans le groupe constitué d'une dégénérescence maculaire liée à l'âge (DMLA), une périodontite, un lupus érythémateux, une néphrite lupique, une dermatomyosite, une myasthénie grave, une glomérulonéphrite membrano-proliférative (GNMP), un psoriasis, une sclérose en plaques et les lésions d'une ischémie/ reperfusion rénale. La présente invention est illustrée par les figures et les exemples ci-après. Ces figures et exemples ne visent en aucun cas la limitation de la portée de la présente invention.
Figures:
La figure 1 est un schéma représentant la stratégie de construction des fragments N-terminaux des protéines recombinantes selon l'invention.
La figure 2 est un schéma représentant la stratégie de construction des fragments C-terminaux des protéines recombinantes selon l'invention.
Les figures 3A, 3B et 3C sont des graphes montrant l'activité d'accélération de la dissociation de la C3 convertase pour les fragments de facteur H ayant la plus forte productivité.
Exemples: Exemple 1: construction des fragments N-ter et C-ter du Facteur H dans le plasmide pCEP4
Le but est de sous cloner sous différentes formes les fragments N-terminal et C-terminal du variant Y402 du facteur H dans une version optimisée dans le vecteur d'expression pCEP4. Les fragments seront complétés tous deux en 5' d'un site Notl, de la séquence de kozak et d'un peptide signal, et en 3' d'un His-TAG suivi du site BamHI, la différence se fera par un site Nhel situé en 3 ' pour les fragments N-ter et en 5 ' pour les fragments C-ter. Des schémas explicatifs seront décrits dans le protocole ci-dessous. 1/ Construction des vecteurs pCEP4-N-ter
1/ Construction des fragments N-ter
Les fragments N-ter sont construits par PCR à partir du vecteur pCDNA2001neo-MD3Y. Ce vecteur correspond au vecteur pCDNA2001neo contenant l'acide nucléique représenté par la séquence SEQ ID NO: 90 qui est une séquence optimisée codant le variant Y402 du facteur H comprenant un peptide signal artificiel PS-MB7. La stratégie de construction est représentée sur la figure 1.
Les amorces utilisées sont les suivantes:
amorce sens: Pl-NT-FCTH 5*-CTCTAGCGGCCGCGCGCCACC-3* (SEQ ID NO:91)
(les nucléotides 6 à 13 de cette séquence définissent un site de restriction Notl)
amorces antisens (ou amorces P2-NT-X):
Chacune de ces amorces contient, dans cet ordre de 5' vers 3': un site BamHI, 2 codons stop, une étiquette hexahistidine, un linker (GS), un site Nhel et une séquence spécifique au facteur H. Ces éléments sont représentés sur la figure 1.
P2-NT-4 (SEQ ID NO:92)
CTCTAGGATCCTTATCAATGGTGGTGATGGTGGTGGCTGCCGCTAGCGCCAGATT TTTCCTCGCAGGAAGGCAG 75pb
P2-NT-7 (SEQ ID NO:93)
CTCTAGGATCCTTATCAATGGTGGTGATGGTGGTGGCTGCCGCTAGCGCCAGTTTT CACGCGGATGCACCTTG 74pb
P2-NT-8 (SEQ ID NO:94)
CTCTAGGATCCTTATCAATGGTGGTGATGGTGGTGGCTGCCGCTAGCGCCAGACT TGATGCAGGTAGGCTGG 73pb
P2-NT-9 (SEQ ID NO:95)
CTCTAGGATCCTTATCAATGGTGGTGATGGTGGTGGCTGCCGCTAGCGCCTTCCC GCTCATAGCAGATGGGCAG 75pb
P2-NT-10 (SEQ ID NO:96)
CTCTAGGATCCTTATCAATGGTGGTGATGGTGGTGGCTGCCGCTAGCGCCGCTCT GCACCTGCTCCTTGCAAATAG 77pb
P2-NT-11 (SEQ ID NO:97)
CTCTAGGATCCTTATCAATGGTGGTGATGGTGGTGGCTGCCGCTAGCGCCGGTGG ATTCCTCGACGATGCAC 73pb
P2-NT-12 (SEQ ID NO:98)
CTCTAGGATCCTTATCAATGGTGGTGATGGTGGTGGCTGCCGCTAGCGCCTTTCTT CAGTTTGTCAATGGCGAC 75pb
P2-NT-13 (SEQ ID NO:99)
CTCTAGGATCCTTATCAATGGTGGTGATGGTGGTGGCTGCCGCTAGCGCCCAGCT GGATCTGTGCCATAGAGCAG 76pb
Cette série d'amorce P2-NT-X (X, variable) est obtenue par PCR d'assemblage. • PCR d'assemblage entre l'amorce P2NT et les amorces P2-X (X, variable) ci- dessous :
Elle est réalisée au moyen des amorces suivantes:
1- P2NT (SEQ ID NO: 100)
CTCTAGGATCCTTATCAATGGTGGTGATGGTGGTGGCTGCCGCTAGC
2- P2-4 (SEQ ID NO: 101)
CTGCCTTCCTGCGAGGAAAAATCTGGCGCTAGCGGCAGCCAC
2-P2-7 (SEQ ID NO: 102)
CAAGGTGCATCCGCGTGAAAACTGGCGCTAGCGGCAGCCAC
2-P2-8 (SEQ ID NO: 103)
CCAGCCTACCTGCATCAAGTCTGGCGCTAGCGGCAGCCAC
2-P2-9 (SEQ ID NO: 104)
CTGCCCATCTGCTATGAGCGGGAAGGCGCTAGCGGCAGCCAC
2-P2-10 (SEQ ID NO: 105)
TATTTGCAAGGAGCAGGTGCAGAGCGGCGCTAGCGGCAGCC AC
2-P2-11 (SEQ ID NO: 106)
GTGCATCGTCGAGGAATCCACCGGCGCTAGCGGCAGCCAC
2-P2-12 (SEQ ID NO: 107)
GTCGCCATTGACAAACTGAAGAAAGGCGCTAGCGGCAGCCAC
2-P2-13 (SEQ ID NO: 108)
CTGCTCTATGGCACAGATCCAGCTGGGCGCTAGCGGCAGCCAC
Amplification des fragments d'intérêt
Figure imgf000029_0001
Pl-NT-FCTH P2-NT-13 Nter 1 -13 pCDNA2001neo-MD3Y 2473
21 Construction des vecteurs
• Digestion Notl/BamHI des Inserts :
Figure imgf000030_0001
• Digestion Notl/BamHI du vecteur pCEP4 :
→ Obtention de 2 fragments 24 et 10162pb
Nucléospin extract II (Clontech)
• Ligation et transformation de bactéries TOP 10
• Screening par PCR : CMVl/MD2-lRev → Obtention d'un amplicon de 594pb
amorces CMVl - SEQ ID NO : 109: 5*-CCATTGACGTCAATGGGAGTTTG-3* MD2-lrev - SEQ ID NO : 1 10: 5'-tgtcacactcgcggtagttg-3'
3/ Séquençage
On utilise les amorces CMVl et SV40-3 'UTR pour le séquençage de tous les vecteurs. Seul les vecteurs pCEP4-lNTerl l , pCEP4-lNTerl2 et pCEP4-lNTerl3 ont un séquençage supplémentaire avec l'amorce MD2-3.
Amorce SV40-3 'UTR - SEQ ID NO : 1 1 1 : 5 '-TTCACTGCATTCTAGTTGTGGT-3 ' II/ Construction des vecteurs pCEP4-C-ter
1/ Construction des fragments C-ter Les fragments C-ter sont construits par PCR à partir du vecteur pCDNA2001neo-MD3Y. Ce vecteur correspond au vecteur pCDNA2001neo contenant l'acide nucléique représenté par la séquence SEQ ID NO:90. La stratégie de construction est représentée sur la figure 2.
Les amorces utilisées sont les suivantes:
amorces sens (ou amorces Pl-CT-X):
Chacune de ces amorces contient, dans cet ordre de 5' vers 3': un site Notl, une séquence de Kozack (SK), un peptide signal (PS), un site Nhel et une séquence spécifique au facteur H. Ces éléments sont représentés sur la figure 2.
P1-CT-19 (SEQ ID NO: 112)
CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACGCTGCTAGCGGCTGTGGACCCCCTCCACCCATC
P1-CT-16 (SEQ ID NO: 113)
CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACGCTGCTAGCGGCTGTAAGAGTCCTCCAGAGATTTCACA
Pl-CT-15 (SEQ ID NO: 114)
CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACGCTGCTAGCGGCTGTAGCCAGCCCCCTCAGATC
P1_CT-14 (SEQ ID NO: 115)
CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACGCTGCTAGCGGCTGCCCACCACCTCCACAGATTC
Pl-CT-13 (SEQ ID NO: 116)
CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACGCTGCTAGCGGCTGCAAGTCCTCTAATCTGATCATTC
P1-CT-12 (SEQ ID NO: 117)
CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACGCTGCTAGCGGCTGTGGCGATATTCCAGAACTGG
Pl-CT-11 (SEQ ID NO: 118)
CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACGCTGCTAGCGGCTGTGGACCACCTCCAGAACTGC
P1-CT-10 (SEQ ID NO: 119)
CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACGCTGCTAGCGGCTGTGAGCTGCCAAAAATTGATG
Pl-CT-9 (SEQ ID NO: 120) CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACGCTGCTAGCGGCTGTGACATTCCAGTGTTTATGAACG
Pl-CT-8 (SEQ ID NO: 121)
CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACGCTGCTAGCGGCTGTTCTAAGAGCAGCATCGACATTG
amorce antisens (P2-CT-FCTH)
Cette amorce contient, dans l'orientation 5' vers 3': un site BamHI, 2 codons stop, une étiquette hexahistidine, un linker (GGSG) et une séquence spécifique du Facteur H
P2-CT-FCTH (SEQ ID NO: 122)
GAGTAGGATCCTTATCAATGGTGGTGATGGTGGTGGCCGCTTCCGCCTCTCTTAG CACAAGTAGGGTATTCCAG 74pb
La série d'amorce Pl-CT-X (X, variable) et l'amorce P2-CT-FCTH sont obtenues par PCR d'assemblage.
• PCR d'assemblage pour l'obtention des amorces:
amorces utilisées pour l'obtention de l'amorce P2-CT-FCTH
l-P2-CT-FCTH-for (SEQ ID NO: 123)
GAGTAGGATCCTTATCAATGGTGGTGATGGTGGTGGCCGCTTCCG
2-P2-CT-FCTH-rev (SEQ ID NO : 124)
CTGGAATACCCTACTTGTGCTAAGAGAGGCGGAAGCGGCCACCAC
amorces utilisées pour l'obtention des amorces Pl-CT-X
PCR1 : 1 -P 1 -CT-FCTH 1 (SEQ ID NO : 125)
CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTG
1-P1-CT-FCTH2 (SEQ ID NO: 126)
CGTTAGCAGAAGTGATAGACAGCAGCAGCAGAAAAATCCAAGACCATCGCATG
Fragment PCR1 : P1-CT-FCTH-PCR1 (SEQ ID NO: 127)
CTCTAGCGGCCGCGCGCCACCATGCGATGGTCTTGGATTTTTCTGCTGCTGCTGTC TATCACTTCTGCTAACG 73PB amorce amorce Taille des dimères sens anti-sens Dimère crée (Pb)
1 -Pl -CT-FCTHl 1 -P1 -CT-FCTH2 Pl -CT-FCTH-Pcrl 73
PCR2 :
2-P1-CT-19 (SEQ ID NO: 128)
GATGGGTGGAGGGGGTCCACAGCCGCTAGCAGCGTTAGCAGAAGTGA
2-P 1 -CT- 16 (SEQ ID NO : 129)
TGTGAAATCTCTGGAGGACTCTTACAGCCGCTAGCAGCGTTAGCAGAAGTGA
2-P1-CT-15 (SEQ ID NO: 130)
GATCTGAGGGGGCTGGCTACAGCCGCTAGCAGCGTTAGCAGAAGTGA
2-P1-CT-14 (SEQ ID NO: 131)
GAATCTGTGGAGGTGGTGGGC AGCCGCTAGC AGCGTTAGC AGAAGTGA
2-P1-CT-13 (SEQ ID NO: 132)
GAATGATCAGATTAGAGGACTTGCAGCCGCTAGCAGCGTTAGCAGAAGTGA
2-P1-CT-12 (SEQ ID NO: 133)
CCAGTTCTGGAATATCGCCACAGCCGCTAGCAGCGTTAGCAGAAGTGA
2-P 1 -CT- 11 (SEQ ID NO : 134)
GCAGTTCTGGAGGTGGTCCACAGCCGCTAGCAGCGTTAGCAGAAGTGA
2-P1-CT-10 (SEQ ID NO: 135)
CATCAATTTTTGGCAGCTCACAGCCGCTAGCAGCGTTAGCAGAAGTGA
2-P1-CT-9 (SEQ ID NO: 136)
CGTTCATAAACACTGGAATGTCACAGCCGCTAGCAGCGTTAGCAGAAGTGA
2-P1-CT-8 (SEQ ID NO: 137)
CAATGTCGATGCTGCTCTTAGAACAGCCGCTAGCAGCGTTAGCAGAAGTGA
Figure imgf000033_0001
Pl-CT-FCTH-Pcrl 2-P1-CT-9 Pl-CT-9 1 10
Pl-CT-FCTH-Pcrl 2-P1-CT-8 Pl-CT-8 1 10
• Amplification des fragments d'intérêt :
Figure imgf000034_0001
21 Construction des vecteurs
• Digestion Notl/BamHI des Inserts :
Figure imgf000034_0002
Digestion Notl/BamHI du vecteur pCEP4 :
→ Obtention de 2 fragments 24 et 10162pb Nucléospin extract II
• Ligation et transformation de bactéries TOP 10
• Screening par PCR : CMV1/P2-MB7 → Obtention d'un amplicon de 259pb
Seq P2-MB7 - SEQ ID NO : 138 : 5'-
TGGTGATGCTCAGCAGCAGCAGGAAGATCCAGCTCCATCG-3'
3/ Séquençage On utilise les amorces CMV1 et SV40-3'UTR pour le séquençage de tous les vecteurs. Seul les vecteurs pCEP4-9Cter20 et pCEP4-8Cter20 auront un séquençage supplémentaire avec l'amorce MD2-5.
Seq MD2-5 - SEQ ID NO : 139: 5'- GGATTCACACCGTGTGCATTAATG-3' Exemple 2: Construction des vecteurs Facteur H combinant les domaines N-ter et C-ter
A partir des 8 vecteurs pCEP4-lNTX et des 10 vecteurs pCEP4-XCT20 nous réalisons la construction de 59 vecteurs combinant les fragments N-ter et C-ter, contenant à minima obligatoirement les domaines SCR1-4 N-terminaux et les domaines SCR19-20 C-terminaux auxquels sont ajoutés un nombre variable des domaines SCRs dans la partie centrale de la molécule.
Dans un premier temps, nous introduisons les fragments 1NTX, présent dans le plasmide pCEP4 dans le vecteur pCDNA2001neo (par digestion Notl/BamHI).
Dans un second temps, nous introduisons dans les vecteurs pCDNA2001neo-lNTX les fragments XCT20 (par digestion Nhel/BamHI).
Nous obtenons ainsi 59 constructions plasmidiques qui correspondent aux 59 combinaisons 1NTX-XCT20 des fragments FH. Ces séquences sont présentes dans le vecteur pCDNA2001neo qui permet une expression stable de ces molécules dans la lignée cellulaire PERC6. Pour faciliter le travail de criblage et de production, les 59 fragments FH 1NTX- XCT20 sont extraits du vecteur pCDNA2001neo par digestion Notl/BamHI et clonés dans le vecteur pCEP4 qui permet une expression transitoire dans les cellules HEK293F.
1/ Construction des vecteurs pCDNA2001neo-N-Ter à partir des vecteurs pCEP4-N-ter • Digestion des vecteurs pCEP4-lNT X par Not I/BamHI :
Purification sur gel du fragment d'intérêt suivi d'un Nucléospin extract II.
• Digestion du vecteur pCDNA200 lneo par Not I/BamHI.
Nucléospin extract II.
· Ligation et transformation TOP 10.
• Criblage par PCR : CMV1/MD2-1REV Obtention d'un fragment à 706 pb.
• Contrôle par digestion Notl/BamHI : vérification de la présence de l'insert.
II/ Construction des vecteurs pCDNA2001neo-lNTX / XCT20 pour une production dans la lignée cellulaire PERC6:
Figure imgf000036_0001
Figure imgf000036_0002
8CT20 13CT20
19CT20 12CT20
16CT20 19CT20
15CT20 16CT20
14CT20 1NT12 15CT20
1NT8 13CT20 14CT20
12CT20 13CT20
11CT20 19CT20
10CT20 16CT20
1NT13
9CT20 15CT20
14CT20
• Digestion des vecteurs pCEP4-XCT20 par Nhel / BamHI :
pCEP4-19CT20 414 pb pCEP4-16CT20 948 pb pCEP4-15CT20 1131 pb pCEP4-14CT20 1308 pb pCEP4-13CT20 1482 pb pCEP4-12CT20 1668 pb pCEP4-HCT20 1851 pb pCEP4-10CT20 2034 pb pCEP4-9CT20 2214 pb pCEP4-8CT20 2397 pb
Purification sur gel du fragment d'intérêt suivi d'un Nucléospin extract II.
• Digestion du vecteur pCDNA200 lneo- 1NTX par Nhe I/BamHI. Nucléospin extract II.
• Ligation et transformation TOP 10.
• Criblage par PCR : MD2-6 / 2BGHPA Obtention d'un fragment à 373 pb.
Digestion de contrôle Notl/BamHI et Nhel/BamHI.
Seq MD2-6 - SEQ ID NO : 140 : 5 '-AGGGAAACAAGCGCATCACCT-3 '
Seq 2BGHPA - SEQ ID NO : 141 : 5 '-CAGATGGCTGGCAACTAGAA-3 '
Les fragments 1NTX/XCT20 sont ensuite extraits par digestion Notl / BamHl et réintroduits dans le vecteur pCEP4.
III/ Construction des vecteurs pCEP4-lNTX / XCT20 pour une production dans la lignée cellulaire HE 293 Freestyle :
• Digestion du vecteur pCEP4 par Notl / BamHl ( 10162 et 24pb)
Nucléospin extract II.
• Digestion des vecteurs pCDNA200 lneo- 1NTX/XCT20 par Notl / BamHl (Taille des fragments dans le tableau ci-dessous.)
Purification sur gel
Nucléospin extract II.
Taille Taille
Vecteur digéré (Notl/BamHI) insert Vecteur digéré (Notl/BamHI) insert
(pb) (pb) pCDNA200 lneo- 1NT4/19CT20 1216 pCDNA200 lneo- 1NT9/19CT20 2134 pCDNA200 lneo- 1NT4/16CT20 1762 pCDNA200 lneo- 1NT9/16CT20 2668 pCDNA200 lneo- 1NT4/15CT20 1945 pCDNA200 lneo- 1NT9/15CT20 2851 pCDNA200 lneo- 1NT4/14CT20 2122 pCDNA200 lneo- 1NT9/14CT20 3028 pCDNA200 lneo- 1NT4/13CT20 2296 pCDNA200 lneo- 1NT9/13CT20 3202 pCDNA200 lneo- 1NT4/12CT20 2482 pCDNA200 lneo- 1NT9/12CT20 3388 pCDNA2001neo-lNT4/l 1CT20 2665 pCDNA2001neo-lNT9/l 1CT20 3571 pCDNA200 lneo- 1NT4/10CT20 2848 pCDNA200 lneo- 1NT9/10CT20 3754 pCDNA2001neo-lNT4/ 9CT20 3028 pCDNA200 lneo- INT 10/19CT20 2317 pCDNA2001neo-lNT4/ 8CT20 3211 pCDNA200 lneo- INT 10/16CT20 2851 pCDNA200 lneo- 1NT7/19CT20 1771 pCDNA200 lneo- INT 10/15CT20 3034 pCDNA200 lneo- 1NT7/16CT20 2305 pCDNA200 lneo- INT 10/14CT20 3211 pCDNA200 lneo- 1NT7/15CT20 2488 pCDNA200 lneo- INT 10/13CT20 3385 pCDNA200 lneo- 1NT7/14CT20 2665 pCDNA200 lneo- INT 10/12CT20 3571 pCDNA200 lneo- 1NT7/13CT20 2839 pCDNA200 lneo- INT 10/11CT20 3754 pCDNA200 lneo- 1NT7/12CT20 3025 pCDNA200 lneo- INT 11/19CT20 2500 pCDNA2001neo-lNT7/l 1CT20 3208 pCDNA200 lneo- INT 11/16CT20 3034 pCDNA200 lneo- 1NT7/10CT20 3391 pCDNA200 lneo- INT 11/15CT20 3217 pCDNA2001neo-lNT7/ 9CT20 3571 pCDNA200 lneo- INT 11/14CT20 3394 pCDNA2001neo-lNT7/ 8CT20 3754 pCDNA200 lneo- INT 11/13CT20 3568 pCDNA200 lneo- 1NT8/19CT20 1954 pCDNA200 lneo- INT 11/12CT20 3754 pCDNA200 lneo- 1NT8/16CT20 2488 pCDNA200 lneo- INT 12/19CT20 2686 pCDNA200 lneo- 1NT8/15CT20 2671 pCDNA200 lneo- INT 12/16CT20 3220 pCDNA200 lneo- 1NT8/14CT20 2848 pCDNA2001neo-lNT12/15CT20 3403 pCDNA200 lneo- 1NT8/13CT20 3022 pCDNA200 lneo- INT 12/14CT20 3580 pCDNA200 lneo- 1NT8/12CT20 3208 pCDNA2001 neo- INT 12/13CT20 3754 pCDNA2001neo-lNT8/l 1CT20 3391 pCDNA200 lneo- INT 13/19CT20 2860 pCDNA200 lneo- 1NT8/10CT20 3574 pCDNA200 lneo- INT 13/16CT20 3394 pCDNA2001neo-lNT8/ 9CT20 3754 pCDNA200 lneo- INT 13/15CT20 3577 pCDNA200 lneo- INT 13/14CT20 3754 • Ligation et transformation TOP 10.
• Criblage par PCR : CMV1 / MD2-1REV Obtention d'un fragment à 594 pb.
• Séquençage des jonctions par CMV 1 et S V40-3 'UTR. Exemple 3: Détermination de la concentration et de la masse moléculaire des fragments FH présents dans les surnageants des cellules HEK 293F après 7 jours de production en mode batch.
3.1: Transfection transitoire dans les cellules HEK 293F pour production transitoire des fragments FH recombinant.
1 - Transfection transitoire :
La veille de la transfection transitoire, les cellules HEK 293F sont repiquées à une concentration cellulaire de 7E5 vc/ml. La densité cellulaire et la viabilité des cellules HEK 293F sont déterminées le jour de la transfection. Le volume de culture correspondant à 30E6 cv/ml est centrifugé. Le surnageant est éliminé et le culot de cellules est repris dans 28 ml de milieu de culture F17 (Invitrogen), transféré dans un erlen de 250 ml et incubé à 37 °C.
2- Formation du complexe agent de transfection / ADN en rapport 2: 1 :
L'agent de transfection et l'ADN correspondant au vecteur pCEP4 contenant une des séquences des fragments FH sont préparés dans du milieu OptiMEM (Invitrogen) de la façon suivante:
- Ajout de 30μg dADN dans 1 ml d'OptiMEM
- Ajout de 60 μΐ de Fectine ou 60 μΐ de PEI dans 1 ml d'OptiMEM.
Ces deux préparations sont incubées séparément pendant 5 minutes à température ambiante puis la solution contenant l'agent de transfection est ajoutée délicatement à celle contenant l'ADN. Le mélange est incubé pendant 25 minutes à température ambiante avant d'être ajouté au 28 ml de cellules HEK 293F préalablement préparées. Les cellules sont alors incubées à 37°C sous agitation à 125 rpm. 3 -Production transitoire de facteur H:
Les cellules sont maintenues en culture durant 7 jours sans ajout ou renouvellement de milieu de culture. Le 7eme jour, les cellules sont centrifugées à 3000g pendant 15 minutes. Les culots cellulaires sont éliminés et les surnageant cellulaires contenant les fragments FH recombinants sont filtrés en 0.22 μι ρυίβ congelés à -20°C. 3.2 : Dosage des fragments FH humain dans le milieu de culture par ELISA
Anticorps de coating : immunoglobuline de mouton anti-Facteur H humain (The Binding Site) diluée extemporanément dans un tampon PBS pH 7,4 pour obtenir une concentration comprise entre 3,5 et 5,5 μg/ml.
Tampon de saturation: PBS - BSA 1 % (p/vol)
Tampon de lavage: PBS - Tween-20 0,1 % (vol/vol)
Tampon de dilution: Tampon PBS - Tween-20 0,1 % (vol/vol) - BSA 0,1 % (p/vol)
Solution standard: Calibrateur Facteur H humain NL (The Binding Site)
Echantillons : les échantillons sont prédilués de façon à obtenir une concentration proche de celle du premier point de gamme. Puis diluer de ½ en ½.
Anticorps monoclonal anti Facteur H: Immunoglobulmes monoclonales de souris purifiées anti-Facteur H humain (SEROTEC)
Anticorps de révélation: Immunoglobulmes de chèvre anti-IgG de souris marquées à la peroxydase (Jackson Immuno Research Laboratories).
Solution de révélation: TMB Kit (Pierce)
Solution d'arrêt: Acide sulfurique 4 N ou 2 M (Fisher Scientifïc).
MODE OPERATOIRE
Sensibilisation de la phase solide :
Dans une plaque de microtitration, on distribue 100 μΐ par puits d'anticorps de coating dilué. La plaque est ensuite recouverte d'une feuille adhésive puis incubée une nuit à + 4° C. La plaque est ensuite vidée par retournement. Saturation de la phase solide :
On distribue 120 μΐ par puits de solution de saturation. La plaque est ensuite recouverte d'une feuille adhésive puis incubée 1 heure à 20° C. On procède ensuite à 3 lavages avec du tampon de lavage. Capture de l'antigène :
On distribue 100 μΐ par puits de tampon de dilution (blanc), de chaque dilution du standard et des échantillons. La plaque est ensuite recouverte d'une feuille adhésive puis incubée 1 heure 30 minutes à 20° C. On lave ensuite 5 fois en tampon de lavage. Reconnaissance de l'antigène par l'anticorps monoclonal :
100 μΐ de l'anticorps monoclonal sont distribués dans chaque puits. La plaque est recouverte d'une feuille adhésive puis incubée incubée 1 heure 30 minutes à 20° C. On lave ensuite 5 fois en tampon de lavage.
Marquage par le conjugué HRP (HorseRadish Peroxidase en anglais, ou peroxydase de raifort) :
100 μΐ de l'anticorps de révélation sont distribués, la plaque est recouverte d'une feuille adhésive, puis incubée 1 heure à 20°C. Les puits sont lavés 5 fois en tampon de lavage.
Réaction enzymatique :
On distribue 100 μΐ par puits de TMB contenant le substrat à intervalle de temps régulier et loin de toute lumière intense. Puis on incube à température ambiante entre 5 - 15 minutes. Ce temps doit être identique pour tous les points de dosage.
Arrêt de la réaction :
On distribue 100 μΐ d'H2S04 4N par puits à intervalle de temps régulier. Les résultats sont rapportés dans le tableau suivant.
Figure imgf000042_0001
1NT7- 12CT20 42 111244.2
1NT7- 11CT20 154 118127.1
1NT7- 10CT20 157 124969.1
1NT7- 9CT20 161 131845.6
1NT7- 8CT20 224 138405.9
1NT8- 19CT20 7 70758.5
1NT8- 16CT20 47 90603.9
1NT8- 15CT20 124 97299.2
1NT8- 14 CT20 339 103969.8
1NT8- 13 CT20 48 110808.6
1NT8- 12 CT20 13 117804.6
1NT8- 11 CT20 115 124687.4
1NT8- 10 CT20 128 131529.4
1NT8- 9 CT20 80 138405.9
1NT9-19 CT20 5 77635.1
1NT9-16 CT20 8 97480.4
1NT9-15 CT20 43 104175.7
1NT9-14 CT20 91 110872.3
1NT9-13 CT20 25 117711.2
1NT9-12 CT20 25 124655.0
1NT9-11 CT20 45 131537.9
1NT9-10 CT20 156 138405.9
1NT10- 19CT20 5 84451.0
1NT10- 15CT20 13 110991.7
1NT10- 14CT20 21 117688.3
1NT10- 11CT20 128 138379.9
1NT11- 19CT20 9 91333.8
1NT11- 16CT20 22 111179.2
1NT11- 15CT20 16 117874.5
1NT11- 14CT20 36 124571.1
1NT13- 14CT20 13 138379.9
Exemple 4 : Caractérisation par SDS-PAGE des fragments FH recombinants présents dans le surnageant de culture (figures 6A, 6B et 7).
A partir de la valeur de la concentration des fragments FH recombinants déterminée par ELISA, un volume correspondant à ^g de facteur H recombinant est dilué au ½ dans du tampon Laemmli 2x, chauffé à 95°C pendant 5 minutes puis déposé sur un gel linéaire de 10% polyacrylamide. Après migration, les protéines contenues dans le gel sont colorées au bleu de Coomassie. L'analyse des gels de polyacrylamide montrent que les fragments FH recombinants migrent selon les masses moléculaires apparentes attendues.
Exemple 5 : Détermination de l'activité d'accélération de la dissociation de la C3 convertase des fragments FH recombinants présents dans le surnageant de culture et ayant la plus forte productivité :
A partir de la concentration de facteur H recombinant déterminée par ELISA, les fragments FH recombinants sont dilués à une concentration finale de 20 μg/ml. A partir de ce tube une gamme est réalisée par les dilutions successives suivantes: 1/2; 1/10; 1/4; 1/4; 1/4; 1/4; 1/40. Cette gamme de concentration décroissante de fragments FH est ajoutée au complexe C3 convertase formé dans les puits d'une plaque 96 puits qui est alors incubée 32 à 34 minutes à +34°C. Après plusieurs lavages, le facteur B restant complexé avec la molécule C3 immobilisée au fond du puits est alors dosé par une réaction immuno-enzymatique de type ELISA. Les valeurs d'absorbances obtenues en fonction de la concentration de fragments FH ajoutée sont alors traitées dans un système modélisé non linéaire (sigmoïde à pente variable) afin de déterminer la valeur de l'IC50 de chaque échantillon. L'équation de calcul de ce modèle est la suivante :
Y : Bottom + ( Top -Bottom)/(l+10A((Log IC50-X)* Hillslope)
X est le logarithme de la concentration ^g/ml).
Y est la réponse (D.O).
Y débute à la ligne de base (Bottom) et va au sommet (Top) selon une forme sigmoïdale. Hillslope est la pente.
L'activité déterminée dans le surnageant cellulaire est montré dans les figures 3A, 3B et 3C pour les fragments ayant la plus forte productivité.
Exemple 6 : Détermination de l'activité d'accélération de la dissociation de la C3 convertase des fragments FH recombinants purifiés
Les fragments FH ont été purifies par l'intermédiaire de l'étiquette hexahistidine qui a été ajoutée à l'extrémité c-terminale des protéines. La purification a été réalisée en une étape de chromatographie d'affinité en utilisant les colonnes HisTALON (Clontech) qui contiennent une résine ayant une forte affinité et spécificité pour les polyshistidines. La purification a été réalisée selon les recommandations du fournisseur (HisTALON Gravity Column Purification Kit User Manual). Après purification les échantillons sont dialysées contre du tampon PBS et conservés à
4°C.
La concentration des fragments FH recombinants purifiés est déterminée par mesure de la DO à 280nm. Les fragments FH recombinants purifiés sont dilués à une concentration finale de 150 nM puis à partir de ce tube une gamme est réalisée par les dilutions successives suivantes: 1/2; 1/10; 1/4; 1/4; 1/4; 1/4; 1/40. Cette gamme de concentration décroissante de fragments FH est ajoutée au complexe C3 convertase formé dans les puits d'une plaque 96 puits qui est alors incubée 32 à 34 minutes à +34°C. Après plusieurs lavages, le facteur B restant complexé avec la molécule C3 immobilisée au fond du puits est alors dosé par une réaction immuno- enzymatique de type ELISA, utilisant le TMB (3,3',5,5'-tétraméthylbenzidine) ou l'OPD (ortho-phénylène diamine) comme substrat de la réaction. Les valeurs d'absorbances obtenues en fonction de la concentration de fragments FH ajoutée sont alors traitées dans un système modélisé non linéaire (sigmoïde à pente variable) afin de déterminer la valeur de l'IC50 de chaque échantillon. L'équation de calcul de ce modèle est la suivante :
Y : Bottom + ( Top -Bottom)/(l+10A((Log IC50-X)* Hillslope)
X est le logarithme de la concentration ^g/ml).
Y est la réponse (D.O).
Y débute à la ligne de base (Bottom) et va au sommet (Top) selon une forme sigmoïdale. Hillslope est la pente.
Les valeurs d'IC5o obtenues sont indiquées dans le tableau ci-dessous.
Figure imgf000045_0001
pCEP4- 1NT4-19CT20 0,0916 73% pCEP4- 1NT7- 8CT20 0,5419 72% pCEP 4-lNT9-l l CT20 0,1716 69% pCEP 4-lNT9-10CT20 0,5517 64% pCEP 4-lNT9-14 CT20 0,5698 64% pCEP4- 1NT8-14CT20 0,6454 61% pCEP4- 1NT7-10CT20 0,6015 59% pCEP4- 1NT10- 11CT20 0,6118 58% pCEP4- 1NT8- 15CT20 0,6279 58% pCEP4- 1NT4- 15CT20 0,2061 58% pCEP 4-lNT9-13 CT20 0,1663 56% pCEP4- 1NT7-15CT20 0,6393 56% pCEP 4-lNT9-19 CT20 0,2166 49% pCEP4- 1NT13- 14CT20 0,7765 45% pCEP4- 1NT4- 8CT20 0,2276 42% pCEP4- 1NT4- 10CT20 0,2439 38% pCEP 4-lNT9-12 CT20 0,3070 30% pCEP4- 1NT8- 13 CT20 0,4022 30% pCEP4- 1NT8- 9 CT20 0,4886 27% pCEP 4-lNT9-16 CT20 0,4177 25% pCEP4- 1NT8- 16CT20 0,4264 25% pCEP4- 1NT4- 9CT20 0,5360 18% pCEP4- 1NT4- 11CT20 0,5458 17% pCEP4- 1NT4- 14CT20 0,6179 15% pCEP4- 1NT7- 16CT20 0,4418 15% pCEP4- 1NT10- 14CT20 0,6714 14% pCEP4- 1NT7- 19CT20 1,0900 12% pCEP4- INTl l- 15CT20 0,7395 10% pCEP4- INTl l- 16CT20 1,2120 8% pCEP4- 1NT7- 13CT20 1,9260 7% pCEP4- 1NT7- 12CT20 2,0350 7% pCEP4- 1NT10- 15CT20 1,1680 6% pCEP4- INTl l- 14CT20 1,9900 6% pCEP4- INTl l- 19CT20 1,7800 5% pCEP 4-lNT9-15 CT20 2,1880 5% pCEP4- 1NT8- 12 CT20 1,8700 4% pCEP4- 1NT10- 19CT20 6,0520 1% pCEP4- 1NT8- 19CT20 493,0000 0% L'activité d'un facteur H recombinant entier produit dans des cellules PerC6 ou HEK et purifié a été utilisée comme contrôle d'activité. L'activité C3 du facteur H entier produit dans les cellules PerC6 est équivalente à celle du facteur H entier produit dans des cellules HEK.
Exemple 7 : Détermination de l'activité de protection de la lyse de globules rouges de mouton par test de Sanchez-C orrai modifié.
Ce test permet de mesurer l'activité fonctionnelle de la partie C-terminale du facteur H recombinant humain purifié lors du développement de lots thérapeutiques en évaluant sa capacité à protéger des globules rouges de mouton de la lyse induite par un sérum dépiété ou déficient en facteur H fonctionnel. Ce test est adapté de la méthode « Sanchez-Corral » permettant de mesurer l'activité anti-hémolytique du facteur H présent dans le plasma de patients atteints du syndrome hémolytique urémique. (P. Sanchez-Corral, C. Gonzàlez-Rubio, S. Rodriguez de Cordoba and M. Lopez-Trascasa. Molecular Immunology 41 (2004) 81-84).
Dans ce cadre, un mélange de sérum dépiété en facteur H et d'un pool plasma humain est réalisé en proportion égale afin de créer les conditions d'une lyse spécifique. L'ajout de facteur H recombinant humain purifié assure la protection des globules rouges de mouton (absence de lyse cellulaire) vis-à-vis d'une lyse induite par le complément.
Ce test a été utilisé ici pour déterminer l'activité de protection de la lyse des globules rouges des fragments de facteur H selon l'invention.
Détermination du pourcentage de lyse :
A 40 μΐ d'une suspension d'hématies de mouton (lxlO8 hématies/ml) sont ajoutés successivement 20 μΐ du tampon de réaction (Hepes 10 mM, NaCl 144 mM, MgC12 7 mM, EGTA 10 mM, pH 7.2), un volume variable de fragment FH ou de FH entier (0-30μ1) correspondant à des concentrations de 0 à 44,74pM, puis 9 μΐ d'un pool de plasma humain suivi de 9 μΐ de plasma humain dépiété en FH. Le volume réactionnel est complété avec du tampon PBS pour obtenir un volume final de 1 ΙΟμΙ. Après incubation 30 min à 37°C, 400 μΐ de tampon HBS-EDTA (Hepes 10 mM, NaCl 144 mM, EDTA 2 mM, pH 7.2) froid pour arrêter la réaction. Après centrifugation 5 min à 1730 g, 200 μΐ de surnageant sont prélevés, déposés dans une plaque de microtitration afin de mesurer l'absorbance à 414 nm.
Le pourcentage de lyse est déterminé selon la formule :
Figure imgf000048_0001
Le témoin « 100% lyse » correspond à la lyse maximale des globules rouges de mouton observée en présence d'eau.
Le témoin blanc comprend le tampon de réaction + 50mM EDTA et correspond à la lyse spontanée des globules rouges de mouton.
Sans CFH, la lyse spontanée des hématies est d'environ 30%.
Dans les tableaux qui suivent, l'analyse est faite en normalisant la valeur obtenue avec le facteur H plasmatique (FH LP03 0 pm) à 100 %. Les valeurs négatives obtenues sont normalisées à la valeur de 0 %.
Figure imgf000048_0002
44,74 2,5 3,7 1,1 0
Figure imgf000049_0001
Figure imgf000049_0002
Les essais montrent des résultats proches pour les échantillons rFH PERC6 (14-
HFACEX- 1446-042) et rFH HEK (12-HFACEX- 1446-072) et cohérents avec le FH plasmatique (témoin LP03) : effet-dose avec protection totale de l'hémolyse à la plus forte concentration de facteur H.
Les différents fragments de facteur H selon l'invention ressortent très actifs avec une inhibition de la lyse spécifique supérieure au rFH entier dès la plus faible concentration testée. Pour deux fragments 1NT9-16CT20 et 1NT7-16CT20 on observe de manière fort intéressante un profil plus proche du facteur H plasmatique LP03.

Claims

REVENDICATIONS
1. Protéine recombinante possédant une activité de facteur H, comprenant, de l'extrémité N- terminale à l'extrémité C-terminale, une première séquence d'acides aminés comprenant au moins les domaines SCR1 à SCR4 du facteur H, et une deuxième séquence d'acides aminés comprenant au moins les domaines SCR19 et SCR20 du facteur H, ladite protéine recombinante n'étant pas un facteur H naturel, et sous réserve que si la première séquence est constituée des domaines SCR1 à SCR4 et la deuxième séquence est constituée des domaines SCR19 et SCR20, le linker soit un linker synthétique.
2. Protéine recombinante selon la revendication 1, première et/ou la deuxième séquence en acides aminés comprenant en outre un ou plusieurs autres domaines SCR de facteur H réarrangés.
3. Protéine recombinante selon la revendication 1 ou 2, la première et la deuxième séquence en acides aminés étant liées entre elles par un linker non naturel, notamment un linker G-A-S- G.
4. Protéine recombinante selon l'une quelconque des revendications précédentes, la première ou la deuxième séquence en acides aminés comprenant au moins les domaines SCR12, SCR13 et SCR14 du facteur H, ou la première et la second séquence en acides aminés ne comprenant aucun des domaines SCR12, SCR13 et SCR14.
5. Protéine recombinante selon l'une quelconque des revendications précédentes, la première séquence comprenant les domaines SCR1 à SCR4 du facteur H, et la deuxième séquence est choisie dans le groupe constitué :
- des domaines SCR16 à SCR20,
- des domaines SCR15 à SCR20 ;
- des domaines SCR10 à SCR20 ; et
- des domaines SCR8 à SCR20 du facteur H.
6. Protéine recombinante selon l'une quelconque des revendications précédentes, la première séquence comprenant les domaines SCRl à SCR7 du facteur H, et la deuxième séquence comprenant les domaines SCRl 6 à SCR20 du facteur H, ladite deuxième séquence étant de préférence choisie dans le groupe constitué :
- des domaines SCRl 5 à SCR20
- des domaines SCRl 4 à SCR20 ;
- des domaines SCRl 1 à SCR20 ;
- des domaines SCR10 à SCR20 ;
- des domaines SCR9 à SCR20; et
- des domaines SCR8 à SCR20 du facteur H.
7. Protéine recombinante selon l'une quelconque des revendications précédentes, la première séquence comprenant les domaines SCRl à SCR8 du facteur H, et la deuxième séquence comprenant les domaines SCRl 6 à SCR20 du facteur H, ladite deuxième séquence comprenant de préférence les domaines SCR10 à SCR20 du facteur H.
8. Protéine recombinante selon l'une quelconque des revendications précédentes, la première séquence comprend les domaines SCRl à SCR4 du facteur H et la deuxième séquence comprend les domaines SCRl 6 à SCR20 du facteur H, une troisième séquence comprenant le domaine SCR7 du facteur H étant comprise entre la première et la deuxième séquence.
9. Protéine recombinante selon l'une quelconque des revendications précédentes, la première séquence en acides aminés comprenant un peptide signal en position N-terminale, notamment le peptide signal naturel du facteur H (SEQ ID NO:24), le peptide signal d'une protéine différente du facteur H, ou le peptide signal PS-MB7 représenté dans la séquence SEQ ID NO: 25.
10. Protéine recombinante selon l'une quelconque des revendications précédentes, de séquence choisie parmi les séquences représentées dans SEQ ID NO:26 à 84 et 159.
11. Construction d'acide nucléique codant une protéine recombinante selon l'une quelconque des revendications 1 à 10.
12. Construction d'acide nucléique selon la revendication 11, comprenant un site de restriction unique entre les deux séquences d'acide nucléique codant la première et la deuxième séquence en acides aminés de la protéine recombinante, notamment un site Nhe I présent dans la partie codant un linker G-A-S-G.
13. Vecteur comprenant une construction d'acide nucléique selon la revendication 11 ou 12.
14. Cellule hôte comprenant la construction d'acide nucléique selon la revendication 11 ou 12, ou le vecteur selon la revendication 13.
15. Animal transgénique non humain comprenant la construction d'acide nucléique selon la revendication 11 ou 12, ou le vecteur selon la revendication 13.
PCT/FR2014/053484 2013-12-20 2014-12-19 Proteines recombinantes possedant une activite de facteur h WO2015092335A2 (fr)

Priority Applications (4)

Application Number Priority Date Filing Date Title
JP2016541495A JP2017500049A (ja) 2013-12-20 2014-12-19 Ｈ因子活性を有する組換えタンパク質
US15/105,829 US20170190753A1 (en) 2013-12-20 2014-12-19 Recombinant proteins having factor h activity
EP14830995.8A EP3083664A2 (fr) 2013-12-20 2014-12-19 Proteines recombinantes possedant une activite de facteur h
CA2934558A CA2934558A1 (fr) 2013-12-20 2014-12-19 Proteines recombinantes possedant une activite de facteur h

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR1363351 2013-12-20
FR1363351A FR3015484A1 (fr) 2013-12-20 2013-12-20 Proteines recombinantes possedant une activite de facteur h

Publications (2)

Publication Number Publication Date
WO2015092335A2 true WO2015092335A2 (fr) 2015-06-25
WO2015092335A3 WO2015092335A3 (fr) 2015-12-03

Family

ID=50489269

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/FR2014/053484 WO2015092335A2 (fr) 2013-12-20 2014-12-19 Proteines recombinantes possedant une activite de facteur h

Country Status (6)

Country Link
US (1) US20170190753A1 (fr)
EP (1) EP3083664A2 (fr)
JP (2) JP2017500049A (fr)
CA (1) CA2934558A1 (fr)
FR (1) FR3015484A1 (fr)
WO (1) WO2015092335A2 (fr)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180055872A (ko) * 2015-09-24 2018-05-25 더 트러스티스 오브 더 유니버시티 오브 펜실바니아 보체 매개 질환 치료용 조성물 및 방법
CN108699121A (zh) * 2015-12-23 2018-10-23 格林诺瓦森生物技术股份有限公司 用于抑制补体激活的多肽
WO2019243586A1 (fr) * 2018-06-22 2019-12-26 Universität Ulm Inhibiteurs du complément et utilisations de ceux-ci
WO2020128516A3 (fr) * 2018-12-21 2020-08-06 Gyroscope Therapeutics Limited Facteur i de complément optimisé en termes de codons
RU2824048C2 (ru) * 2018-12-21 2024-08-01 Джайроскоуп Терапьютикс Лимитед Кодон-оптимизированный фактор комплемента i

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2811526T3 (es) 2010-12-30 2021-03-12 Lab Francais Du Fractionnement Glicoles como agentes de inactivación de patógenos
AR094778A1 (es) 2013-02-13 2015-08-26 Laboratoire Français Du Fractionnement Et Des Biotechnologies Proteínas con glicosilación modificada y métodos para producirlas
EP3594230A1 (fr) 2013-02-13 2020-01-15 Laboratoire Français du Fractionnement et des Biotechnologies Anticorps anti-tnf alpha hautement galactosylés et leurs utilisations
CN105358228A (zh) 2013-07-05 2016-02-24 法国血液分割暨生化制品实验室 亲和层析基质
FR3038517B1 (fr) 2015-07-06 2020-02-28 Laboratoire Francais Du Fractionnement Et Des Biotechnologies Utilisation de fragments fc modifies en immunotherapie
GB201800620D0 (en) * 2018-01-15 2018-02-28 Univ Manchester C3b Binding Polypeptide
WO2021081395A1 (fr) * 2019-10-23 2021-04-29 Gemini Therapeutics Inc. Méthodes de traitement de patients présentant des mutations de cfh avec des protéines de cfh de recombinaison

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2044111B1 (fr) * 2006-06-21 2014-08-13 MUSC Foundation For Research Development Ciblage du facteur h du système complémentaire destiné au traitement de maladies
GB0922659D0 (en) * 2009-12-24 2010-02-10 Univ Edinburgh Factor H
US9540626B2 (en) * 2012-03-19 2017-01-10 The Trustees Of The University Of Pennsylvania Regulator of complement activation and uses thereof

Cited By (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102773865B1 (ko) * 2015-09-24 2025-03-04 더 트러스티스 오브 더 유니버시티 오브 펜실베니아 보체 매개 질환 치료용 조성물 및 방법
US10988519B2 (en) 2015-09-24 2021-04-27 The Trustees Of The University Of Pennsylvania Composition and method for treating complement-mediated disease
JP2018527941A (ja) * 2015-09-24 2018-09-27 ザ・トラステイーズ・オブ・ザ・ユニバーシテイ・オブ・ペンシルベニア 補体媒介性疾患を処置するための組成物及び方法
JP7324253B2 (ja) 2015-09-24 2023-08-09 ザ・トラステイーズ・オブ・ザ・ユニバーシテイ・オブ・ペンシルベニア 補体媒介性疾患を処置するための組成物及び方法
JP7261583B2 (ja) 2015-09-24 2023-04-20 ザ・トラステイーズ・オブ・ザ・ユニバーシテイ・オブ・ペンシルベニア 補体媒介性疾患を処置するための組成物及び方法
EP3359663A4 (fr) * 2015-09-24 2019-08-14 The Trustees of The University of Pennsylvania Composition et méthode de traitement d'une maladie à médiation par le complément
KR20180055872A (ko) * 2015-09-24 2018-05-25 더 트러스티스 오브 더 유니버시티 오브 펜실바니아 보체 매개 질환 치료용 조성물 및 방법
IL296929B2 (en) * 2015-09-24 2025-07-01 Univ Pennsylvania Composition and method for treating complement-mediated disease
CN115976105A (zh) * 2015-09-24 2023-04-18 宾夕法尼亚州大学信托人 用于治疗补体介导的疾病的组合物和方法
IL296929B1 (en) * 2015-09-24 2025-03-01 Univ Pennsylvania Composition and method for treating complement-mediated disease
CN108291216A (zh) * 2015-09-24 2018-07-17 宾夕法尼亚州大学信托人 用于治疗补体介导的疾病的组合物和方法
US12180254B1 (en) 2015-09-24 2024-12-31 The Trustees Of The University Of Pennsylvania Factor H variants for treatment of disease
RU2727411C2 (ru) * 2015-09-24 2020-07-21 Дзе Трастиз Оф Дзе Юниверсити Оф Пенсильвания Композиция и способ для лечения заболевания, опосредованного комплементом
JP2022000017A (ja) * 2015-09-24 2022-01-04 ザ・トラステイーズ・オブ・ザ・ユニバーシテイ・オブ・ペンシルベニア 補体媒介性疾患を処置するための組成物及び方法
IL258024B (en) * 2015-09-24 2022-11-01 Univ Pennsylvania Composition and method for treating complement-mediated disease
AU2016326627B2 (en) * 2015-09-24 2022-12-15 The Trustees Of The University Of Pennsylvania Composition and method for treating complement-mediated disease
IL258024B2 (en) * 2015-09-24 2023-03-01 Univ Pennsylvania A preparation and method for the treatment of a complement-mediated disease
US11591378B2 (en) 2015-12-23 2023-02-28 eleva GmbH Polypeptides for inhibiting complement activation
US10640540B2 (en) 2015-12-23 2020-05-05 Greenovation Biotech Gmbh Polypeptides for inhibiting complement activation
JP2019508022A (ja) * 2015-12-23 2019-03-28 グリーンオヴェイション・バイオテック・ゲゼルシャフト・ミット・ベシュレンクテル・ハフツングＧｒｅｅｎｏｖａｔｉｏｎ Ｂｉｏｔｅｃｈ Ｇｍｂｈ 補体活性化を抑制するポリペプチド
CN108699121B (zh) * 2015-12-23 2023-07-04 艾丽法有限责任公司 用于抑制补体激活的多肽
CN108699121A (zh) * 2015-12-23 2018-10-23 格林诺瓦森生物技术股份有限公司 用于抑制补体激活的多肽
WO2019243586A1 (fr) * 2018-06-22 2019-12-26 Universität Ulm Inhibiteurs du complément et utilisations de ceux-ci
CN113365648A (zh) * 2018-06-22 2021-09-07 乌尔姆大学 补体抑制因子及其用途
EP3586860A1 (fr) * 2018-06-22 2020-01-01 Universität Ulm Inhibiteurs de complément et leurs utilisations
RU2824048C2 (ru) * 2018-12-21 2024-08-01 Джайроскоуп Терапьютикс Лимитед Кодон-оптимизированный фактор комплемента i
WO2020128516A3 (fr) * 2018-12-21 2020-08-06 Gyroscope Therapeutics Limited Facteur i de complément optimisé en termes de codons

Also Published As

Publication number Publication date
US20170190753A1 (en) 2017-07-06
CA2934558A1 (fr) 2015-06-25
JP2017500049A (ja) 2017-01-05
WO2015092335A3 (fr) 2015-12-03
EP3083664A2 (fr) 2016-10-26
JP2020014468A (ja) 2020-01-30
FR3015484A1 (fr) 2015-06-26

Similar Documents

Publication Publication Date Title
WO2015092335A2 (fr) Proteines recombinantes possedant une activite de facteur h
Cheng et al. Identification and characterization of VPO1, a new animal heme-containing peroxidase
Ulucan et al. Developmental changes in gene expression of Epac and its upregulation in myocardial hypertrophy
Knudsen et al. The function of acyl-CoA-binding protein (ACBP)/diazepam binding inhibitor (DBI)
Hansen et al. CL-46, a novel collectin highly expressed in bovine thymus and liver
EP2611833B1 (fr) Anticorps se liant a l'adrenomedulline et aux recepteurs de l'adrenomedulline et leurs utilisations comme medicament
EP0637334B1 (fr) Peptides ayant une activite de facteur d'echange du gdp, sequences d'acides nucleiques codant pour ces peptides, preparation et utilisation
BRPI0913577A2 (pt) polipeptídeos cd83 solúveis, formulações e métodos de uso
EP0652952A1 (fr) Peptides inhibant l'activite des proteines ras, preparation et utilisation
EP0980427B1 (fr) Utilisation des proteines ulip dans le diagnostic et la therapie des cancers et des syndromes neurologiques paraneoplasiques
EP0793721A1 (fr) Peptides capables de se lier au domaine sh3 de la proteine gap, sequences nucleotidiques codant pour ces peptides, leur preparation et utilisation
CA2169938A1 (fr) Gene grb3-3, ses variants et leurs utilisations
RU2409590C2 (ru) Новый пептид, участвующий в энергетическом гомеостазе
EP2780457B1 (fr) Utilisation de la fibromoduline et du lumican pour augmenter la masse musculaire
CN117180404A (zh) Cholesin在调节胆固醇稳态中的用途
Ueki et al. Isolation of cDNAs encoding subunits A and B of the vacuolar-type ATPase from the vanadium-rich ascidian, Ascidia sydneiensis samea
EP3655014B1 (fr) Clusterine pour son utilisation dans le traitement des micro-angiopathies thrombotiques
CZ178396A3 (en) Novel tumor-suppressor gene
WO2002000878A2 (fr) Dynamine mitochondriale humaine msp1, ses isoformes msp1-x, et leur utilisation en therapeutique
EP2771354A1 (fr) Procede de preparation du facteur h humain
Furutani et al. Androgen-dependent expression, gene structure, and molecular evolution of guinea pig caltrin II, a WAP-motif protein
EP0686194A1 (fr) Facteurs de croissance de la famille de l'harp, procede d'obtention et applications
EP1257642A1 (fr) Partenaires du domaine ptb1 de fe65, preparation et utilisations
CN114787361A (zh) 微生物胆固醇催化基因的靶向表达降低过量脂质
EP1194552A1 (fr) Acides nucleiques codant pour des peptides possedant l'activite biologique de la sorbine

Legal Events

Date Code Title Description
REEP Request for entry into the european phase

Ref document number: 2014830995

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2014830995

Country of ref document: EP

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14830995

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase in:

Ref document number: 2934558

Country of ref document: CA

Ref document number: 2016541495

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase in:

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 15105829

Country of ref document: US