WO2014183071A2 - In vitro production of red blood cells with sortaggable proteins - Google Patents

In vitro production of red blood cells with sortaggable proteins Download PDF

Info

Publication number
WO2014183071A2
WO2014183071A2 PCT/US2014/037554 US2014037554W WO2014183071A2 WO 2014183071 A2 WO2014183071 A2 WO 2014183071A2 US 2014037554 W US2014037554 W US 2014037554W WO 2014183071 A2 WO2014183071 A2 WO 2014183071A2
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
protein
sortase
blood cell
interest
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2014/037554
Other languages
English (en)
French (fr)
Other versions
WO2014183071A3 (en
Inventor
Harvey Lodish
Hidde L. Ploegh
Hsiang-Ying LEE
Jiahai SHI
Lenka KUNDRAT
Novalia PISHESHA
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Whitehead Institute for Biomedical Research
Original Assignee
Whitehead Institute for Biomedical Research
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP19219550.1A priority Critical patent/EP3693398A1/en
Priority to JP2016513129A priority patent/JP6599848B2/ja
Priority to EP14795167.7A priority patent/EP2994491A4/en
Priority to EP19171188.6A priority patent/EP3546484B1/en
Priority to US14/890,241 priority patent/US10471099B2/en
Priority to HK16110752.9A priority patent/HK1222662A1/zh
Priority to AU2014262474A priority patent/AU2014262474B2/en
Application filed by Whitehead Institute for Biomedical Research filed Critical Whitehead Institute for Biomedical Research
Priority to EP19171190.2A priority patent/EP3546485A1/en
Publication of WO2014183071A2 publication Critical patent/WO2014183071A2/en
Publication of WO2014183071A3 publication Critical patent/WO2014183071A3/en
Anticipated expiration legal-status Critical
Priority to US15/934,177 priority patent/US11266695B2/en
Priority to US16/572,425 priority patent/US11992505B2/en
Priority to AU2019283766A priority patent/AU2019283766B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/18Erythrocytes
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • A01K67/0275Genetically modified vertebrates, e.g. transgenic
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70582CD71
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0641Erythrocytes
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/07Animals genetically altered by homologous recombination
    • A01K2217/072Animals genetically altered by homologous recombination maintaining or altering function, i.e. knock in
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/10Growth factors
    • C12N2501/125Stem cell factor [SCF], c-kit ligand [KL]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/10Growth factors
    • C12N2501/14Erythropoietin [EPO]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/23Interleukins [IL]
    • C12N2501/2303Interleukin-3 (IL-3)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/23Interleukins [IL]
    • C12N2501/2306Interleukin-6 (IL-6)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/26Flt-3 ligand (CD135L, flk-2 ligand)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/999Small molecules not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2506/00Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells
    • C12N2506/11Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells from blood or immune system cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • C12N2510/02Cells for production

Definitions

  • Cell surfaces can be modified in order to modulate surface function or to confer new functions to such surfaces.
  • Surface functionalization may, for example, include an addition of a detectable label, a binding moiety, or a therapeutic agent to a surface protein, allowing for the detection or isolation of the surface-modified cells, for the generation of new cell-cell interactions that do not naturally occur, or for the conjugation of a therapeutic or diagnostic agent to the cell surface.
  • Cell surface modification can be achieved by genetic engineering or by chemical modifications of cell surface proteins. Both approaches are, however, limited in their capabilities, for example, in that many surface proteins do not tolerate insertions above a certain size without suffering impairments in their function or expression, and in that many chemical modifications require non-physiological reaction conditions.
  • the present disclosure is based on the development of an in vitro multi-phase culturing process for differentiating human CD34 + peripheral blood cells into enucleated red blood cells. This in vitro culturing process unexpectedly synchronized erythroid expansion, terminal differentiation, and enucleation of mobilized human CD34 + peripheral blood cells.
  • the present disclosure is also based on the development of a sortagging system for surface modification of red blood cells, in which an agent of interest is conjugated to the surface of the enucleated red blood cells.
  • the enucleated red blood cells can be produced by the in vitro multi-phase culturing system described herein. Such surface modified enucleated red blood cells can be used for diagnostic and therapeutic purposes.
  • one aspect of the present disclosure features a method for producing human enucleated red blood cells, the method comprising: (i) providing a population of human CD34 + progenitor cells (e.g., human CD34 + peripheral blood cells); (ii) expanding the population of human CD34 + progenitor cells in a first medium for 0-6 days (e.g., 4 days), wherein the first medium comprises Flt-3 ligand, stem cell factor (SCF), interleukin 3 (IL-3), and interleukin 6 (IL-6); (iii) differentiating the expanded human CD34 + progenitor cells obtained from step (ii) in a second medium for 4-7 days (e.g., 5 days), wherein the second medium comprises dexamethasone, ⁇ -estradiol, IL-3, SCF, and erythropoietin (EPO); (iv) differentiating the cells obtained from step (iii) in a third medium for 3-5 days (e.g., 4
  • the total time period for steps (ii)-(v) of the method described above ranges from 11-25 days (e.g., 21 days).
  • Step (v) may be performed in a culturing container coated with a component from the extracellular matrix, such as fibronectin.
  • one or more of the second, third, and fourth media can further comprise holo human transferrin and insulin.
  • all of the second, third, and fourth media further comprise these two cytokines.
  • the second, third, and/or fourth media may be free of certain cytokines, for example, thrombopoietin (TPO), granulocyte macrophage colony-stimulating factor (GM-CSF), or both.
  • the second medium used in any of the in vitro production methods described herein can comprise 250-1500 ⁇ g/ml (e.g., 500 ⁇ g/ml) holo human transferrin, 5-20 ⁇ g ml insulin (e.g., 10 ⁇ g ml), 100nM ⁇ 5 ⁇ (e.g., 2 ⁇ ) dexamethasone, 0.5-5 ⁇ (e.g. , 1 ⁇ ) ⁇ -estradiol, 1-10 ng/ml (e.g., 5 ng) IL-3, 10-500 ng/ml (e.g., 100 ng/ml) SCF, and/or 2-10 U (e.g., 6 U) EPO.
  • ⁇ g/ml e.g., 500 ⁇ g/ml
  • holo human transferrin e.g., 5-20 ⁇ g ml insulin (e.g., 10 ⁇ g ml)
  • 100nM ⁇ 5 ⁇ e.g
  • the second medium can be free of certain cytokines, for example, Flt-3, IL-6, or both.
  • the third medium used in any of the in vitro production methods described herein can comprise 250-1500 ⁇ g/ml (e.g., 500 ⁇ g/ml) holo human transferrin, 5-20 ⁇ (e.g., 10 ⁇ g/ml) insulin, 10-100 ng/ml (e.g., 50 ng/ml) SCF, and/or 2-10 U (e.g., 6 U) EPO.
  • the third medium may be may be free of certain cytokines, for example, Flt-3, IL-6, dexamethasone, ⁇ -estradiol, or any combination thereof..
  • the fourth medium used in any of the in vitro production methods described herein can comprise 250-1500 ⁇ g/ml (e.g., 500 ⁇ g/ml) holo human transferrin, 5-20 ⁇ g ml (e.g. , 10 ⁇ g/ml) insulin, and/or 0.5-3 U (e.g., 2 U) EPO.
  • the fourth medium may be free of certain cytokines, for example, Flt-3, IL-6, dexamethasone, ⁇ - estradiol, SCF, or any combination thereof.
  • the human CD34 + progenitor cells can be any of the genetically engineered enucleated blood cells (which are not naturally occurring) as described herein, for example, a human CD34 + expressing a fusion protein comprising a red blood cell membrane protein and a peptide of interest.
  • the fusion protein comprises a type I red blood cell transmembrane protein (e.g. , glycophorin A) fused to an acceptor peptide at the N-terminus of the type I red blood cell transmembrane protein.
  • the acceptor peptide may include an oligoglycine moiety, e.g.
  • the fusion protein comprises a type II red blood cell transmembrane protein (e.g. , Kell or CD71) fused to a peptide comprising a sequence recognized by a sortase (e.g. , a sortase A) at the C-terminus of the type II red blood cell transmembrane protein.
  • the sequence recognizable by the sortase can be LPXTG (SEQ ID NO: 1), in which X is any amino acid residue.
  • the membrane protein is a type III red blood cell transmembrane protein, such as glucose transporter 1 (GLUT1).
  • the present disclosure provides a genetically engineered enucleated blood cell which expresses on the surface a first fusion protein comprising a first peptide of interest and a first red blood cell membrane protein.
  • the first red blood cell membrane protein is a type I red blood cell transmembrane protein (e.g., glycophorin A such as human glycophorin A), and the first peptide of interest is fused to the N-terminus of the type I red blood cell transmembrane protein.
  • the first red blood cell membrane protein is a type II transmembrane protein (e.g., Kell or CD71), and the first peptide of interest is fused to the C-terminus of the type II transmembrane protein.
  • the first peptide of interest may comprise a sequence recognizable by a sortase, such as sortase A.
  • the sequence recognizable by the sortase is LPXTG (SEQ ID NO: 1), in which X is any amino acid residue.
  • the first red blood cell membrane protein is a type III red blood cell transmembrane protein, such as GLUT1.
  • the first fusion protein further comprises a protein of interest (e.g., a cytoplasmic protein, which can be a diagnostic agent or a therapeutic agent).
  • a protein of interest e.g., a cytoplasmic protein, which can be a diagnostic agent or a therapeutic agent.
  • the protein of interest is fused to the terminus of the first red blood cell membrane protein that is exposed to a cytoplasmic space and the first peptide of interest is fused to the terminus of the first red blood cell membrane protein that is exposed to an extracellular or luminal space.
  • the first red blood cell membrane protein can be a type I membrane protein (e.g., a GPA).
  • the protein of interest is fused to the C-terminus of the type I membrane protein and the first peptide of interest is fused to the N-terminus of the type I membrane protein.
  • the first red blood cell membrane protein is a type II membrane protein.
  • the protein of interest is fused to the N-terminus of the type II membrane protein, and the first peptide of interest is fused to the C-terminus of the type I membrane protein.
  • the genetically engineered enucleated blood cell as described herein can further express on the surface a second fusion protein comprising a second peptide of interest and a second red blood cell membrane protein.
  • the first peptide of interest in the first fusion protein comprises a recognizable site or an acceptable peptide of a first sortase and the second peptide of interest in the second fusion protein comprises a recognizable site or an acceptable peptide of a second sortase.
  • the first sortase and the second sortase use different recognizable sites and different acceptable peptides.
  • the first peptide of interest comprises the motif of LPXTA (SEQ ID NO:2), in which X is any amino acid residue, or an oligoalanine; and the second peptide of interest comprises the motif LPXTG (SEQ ID NO: 1), or an oligoglycine (e.g., consisting of 1-5 glycine residues).
  • the first fusion protein comprises Kell, the C-terminus of which is fused to a first peptide of interest comprising the motif LPXTG (SEQ ID NO: l), and the second fusion protein comprises GPA, the C-terminus of which is fused to a second peptide of interest comprising an oligoalanine (e.g., consisting of 1-5 alanine residues).
  • Kell the C-terminus of which is fused to a first peptide of interest comprising the motif LPXTG (SEQ ID NO: l)
  • GPA the C-terminus of which is fused to a second peptide of interest comprising an oligoalanine (e.g., consisting of 1-5 alanine residues).
  • either one or both of the fusion proteins can be conjugated to two different functional moieties.
  • the above described enucleated blood cell may be prepared by any of the in vitro culturing methods described herein.
  • the first peptide of interest, the second peptide of interest, or both, that are fused to the red blood cell membrane protein(s) described herein may comprise a protein drug (e.g., an antibody or an antigen-binding fragment thereof, which can be a single domain antibody), a vaccine antigen, a fluorescent protein, streptavidin, biotin, an enzyme, or a peptide capable of targeting a cell (e.g., a disease cell).
  • the peptide of interest is conjugated to a detectable label or a chemotherapeutic agent.
  • the peptide of interest may be conjugated to a lipid, a carbohydrate, a nucleic acid, a binding agent, a click-chemistry handle, a polymer, a peptide, a protein, a metal, a chelator, a radiolabel, or a small molecule.
  • the present disclosure provides methods for delivering an agent to a subject, the method comprising administering any of the enucleated blood cells described herein to the subject.
  • the enucleated blood cell being delivered is derived from the same subject the cell is being delivered to.
  • This method comprises: (i) providing a red blood cell expressing a fusion protein comprising a membrane protein and a first peptide, and (ii) contacting the red blood cell with a peptide of interest in the presence of a sortase (e.g., sortase A) under conditions suitable for the sortase to conjugate the peptide of interest to the first peptide in the fusion protein.
  • a sortase e.g., sortase A
  • the first peptide in the fusion protein or the peptide of interest comprises a sequence recognized by the sortase.
  • the sequence recognizable by the sortase is LPXTG (SEQ ID NO:l), in which X is any amino acid residue.
  • the membrane protein is a type I red blood cell transmembrane protein (e.g., glycophorin A) and the first peptide is an acceptor peptide (e.g., including an oligoglycine fragment such as a 1 -5 glycine fragment) fused to the N-terminus of the type I red blood cell transmembrane protein, wherein the peptide of interest comprises the sequence recognized by the sortase.
  • a type I red blood cell transmembrane protein e.g., glycophorin A
  • acceptor peptide e.g., including an oligoglycine fragment such as a 1 -5 glycine fragment
  • the membrane protein is a type II red blood cell transmembrane protein (e.g., Kell or CD71) and the first peptide is fused to the C- terminus of the type II red blood cell transmembrane protein, wherein the first peptide comprises the sequence recognizable by the sortase.
  • the membrane protein is a type III red blood cell transmembrane protein such as GLUT1.
  • the first fusion protein in any of the methods described herein may further comprise a protein of interest (e.g. , a cytoplasmic protein, which can be a diagnostic agent or a therapeutic agent), which is fused to the terminus of the first red blood cell membrane protein that is exposed to a cytoplasmic space.
  • a protein of interest e.g. , a cytoplasmic protein, which can be a diagnostic agent or a therapeutic agent
  • the first peptide of interest in the fusion protein is fused to the terminus of the first red blood cell membrane protein that is exposed to an extracellular or luminal space.
  • the first red blood cell membrane protein is a type I membrane protein.
  • the first protein of interest is fused to the C-terminus of the type I membrane protein, and the first peptide is rased to the N-terminus of the type I membrane protein.
  • the first red blood cell membrane protein is a type II membrane protein.
  • the protein of interest is fused to the N-terminus of the type II membrane protein, and the first peptide is fused to the C-terminus of the type I membrane protein.
  • any of the methods described herein can further comprise contacting the red blood cell in the presence of a second sortase under conditions suitable for the second sortase to conjugate a second peptide of interest to a second fusion protein expressed on the surface of the red blood cell.
  • the second fusion protein comprises a second red blood cell membrane protein and a second peptide to which the second peptide of interest conjugates.
  • either the second peptide in the fusion protein or the second peptide of interest comprises a sequence recognizable by the second sortase. The sequence recognizable by the first sortase differ from the sequence recognizable by the second sortase.
  • the first peptide in the first fusion protein comprises a sequence recognizable by the first sortase or an acceptable peptide of the first sortase; and/or the second peptide in the second fusion protein comprises a sequence recognizable by the second sortase or an acceptable peptide of the second sortase.
  • the acceptable peptide of the first sortase is different from the acceptable peptide of the second sortase.
  • the first sortase may be Sortase A from Staphylococcus arreus.
  • One of the first peptide in the first fusion protein and the first peptide of interest comprises the motif LPXTG (SEQ ID NO:l), in which X is any amino acid residue, and the other comprises an acceptable peptide, which is an oligoglycin.
  • the first fusion protein may comprise Kell, the C-terminus of which is fused to the first peptide which comprises the motif LPXTG (SEQ ID NO: l), and the first peptide of interest comprises an oligoglycine (e.g., consisting of 1-5 glycine residues).
  • the second sortase is Sortase A from Streptococcus pyogenes.
  • One of the second peptide in the second fusion protein and the second peptide of interest may comprise the motif LPXTA (SEQ ID NO:2), in which X is any amino acid residue, and the other may comprise an acceptable peptide, which can be an oligoalanine (e.g., consisting of 1 -5 alanine residues).
  • the second fusion protein may comprise GPA, the N-terminus of which is fused to the second peptide which comprises an oligoglycine.
  • the second peptide of interest may comprise the motif LPXTG (SEQ ID NO: l), in which X is any amino acid residue.
  • the first and second peptides of interest comprises or are conjugated to two different functional moieties.
  • the first peptide of interest, the second peptide of interest, or both may be a protein drug, a vaccine antigen, a fluorescent protein, streptavidin, biotin, an enzyme, or a peptide capable of targeting a cell.
  • one of the first and second peptide of interest is a peptide capable of targeting a disease cell.
  • the present disclosure provides (a) pharmaceutical compositions for diagnostic or therapeutic uses, the pharmaceutical composition comprising any of the enucleated red blood cells described herein, which carry any of the peptide of interest as described herein, and a pharmaceutically acceptable carrier, and (b) uses of the
  • compositions for manufacturing medicaments for diagnostic or therapeutic purposes are provided.
  • Figure 1 illustrates an exemplary in vitro culturing process for producing enucleated red blood cells from human CD34 + progenitor cells.
  • Figure 2 includes photographs showing morphology of cells at expansion and different differentiation stages in the in vitro culturing process described herein.
  • Figure 5 is a diagram showing the expression of cell surface markers glycophorin A (CD235) and c-kit in cells at expansion and different differentiation stages in the in vitro culturing process described herein, as determined by FACS analysis.
  • CD235 glycophorin A
  • c-kit cell surface markers glycophorin A
  • Figure is a diagram showing the expression of cell surface markers glycophorin A (CD235) and transferrin receptor (CD71) in cells at expansion and different differentiation stages in the in vitro culturing process described herein, as determined by FACS analysis.
  • CD235 glycophorin A
  • CD71 transferrin receptor
  • Figure 5 is a diagram showing the enucleation of cells at expansion and different differentiation stages in the in vitro culturing process described herein.
  • Figure 6 includes charts showing cell proliferation at different differentiation stages.
  • Figure 7 is a chart showing cell proliferation in a window of around 20 days.
  • Figure 8 include charts showing the expression of globin genes as indicated during ni ⁇ jjjt DCi ainerenuation.
  • Figure 9 includes charts showing the expression of various genes as indicated during hCD34 + cell differentiation.
  • Figure 10 is a diagram showing construction of EFl and MSCV expression vectors for producing 5Gly (SEQ ID NO: 3)-myc-human glycophorin A (hGYPA or hGPA) fusion protein.
  • Figure 11 is a diagram showing surface expression of sortaggable hGYPA on hCD34 + erythroid progenitors (at different differentiation stages) using EFl expression vectors; 5Gly: (SEQ ID NO:3).
  • Figure 12 is a diagram showing surface expression of sortaggable hGYPA on hCD34 + erythroid progenitors (at different differentiation stages) using MSCV expression vectors; 5Gly: (SEQ ID NO:3).
  • Figure 13 is a photograph showing conjugation of biotin to hGYPA on hCD34 + erythroid progenitor cells by sortagging as determined by Western blotting; 5G: (SEQ ID NO:3).
  • Figure 14 is a diagram showing conjugation of biotin to the surface of human CD34 + cells at the terminal differentiation stage via sortagging; 5Gly: (SEQ ID NO:3).
  • Figure 15 is a diagram showing conjugation of biotin to the surface of human CD34 + cells at the terminal differentiation stage via sortagging; 5Gly: (SEQ ID NO:3).
  • Figure 16 is a diagram showing the expression and sortase-mediated N-terminal labeling of glycophorin A on the surface of mature mouse red blood cells.
  • A Schematic for glycophorin A N-terminal sortase labeling.
  • GPA was extended at the N-terminus to include 3 glycine residues and a myc tag.
  • the probe can be a peptide, protein, lipid, carbohydrate, small molecule, etc.
  • the probe is K(biotin)LPRTGG (SEQ ID NO:45); LPXTGG: (SEQ ID NO:46).
  • E RBCs conjugated with biotin were sorted by flow cytometry. Immunofluorescence images show biotin (labeled with red) at the N-terminus of hGPA on mature RBCs (labeled with Terl 19 antibody, purple).
  • F HEK293T cells were transfected with 3A-myc-hGPA, hKell-LPETG (SEQ ID NO:44)-HA, or both. Cells were incubated with S. pyogenes sortase and a biotin probe followed by S. aureus sortase and TAMRA-containing probe incubation. Specific conjugation of biotin to GPA and of TAMRA to Kell is demonstrated by immunoblotting and fluorescence imaging.
  • Figure 17 is a diagram showing the overexpression of modified human GPA and mouse GPA containing myctag at N-termini do not affect in vitro differentiation of mouse erythroid progenitor.
  • A Flow cytometry analysis of the differentiation capacity of in vitro differentiated murine fetal-liver derived progenitor cells infected with retroviral constructs containing modified human (h) or mouse (m) GP A constructs extended at their N-terminus with myc-tag: myc-hGPA and myc-mGPA. Differentiation capacity in these cells is assessed based on the expressions of Terl 19 and enucleation, i.e. nuclei expulsion, resulting in Terl 19 + reticulocytes.
  • the percentages of reticulocytes produced by erythroid progenitor cells infected with myc-hGPA or myc-mGPA are comparable to cells infected with empty (control) vector, indicating that these constructs do not disturb erythroid terminal differentiation. Quantification of enucleation rate represents 3 independent experiments and graphed as mean values +/- standard deviation. (5) Evaluation of murine terminally differentiated erythroblasts, i.e. nucleated erythroblasts and reticulocytes, for the surface expression of myc-hGPA or myc-mGPA. More than 60% of these terminally differentiated cells expressed the desired modified GPA proteins as measured by flow cytometry using a- myc tag antibodies.
  • Figure 18 is a diagram showing the overexpression of engineered human GPA and mouse GPA containing myc-tag with multiple (3 or 5) glycines (SEQ ID NO:3) at their N- termini do not affect in vitro differentiation of mouse erythroid progenitors. Only cells expressing engineered human GPA with myc-tag and 3 glycines at the N-terminus can be efficiently biotin-labeled by sortagging.
  • A Flow cytometry analysis on the differentiation capacity of in vitro differentiated murine fetal-liver derived progenitor cells infected with retroviral constructs containing modified human (h) or mouse (m) GPA constructs extended at their N-terminus with myc-tag and multiple (3 or 5) glycines (SEQ ID NO:3) (G): 5G (SEQ ID NO:3)-myc-hGPA, 5G (SEQ ID NO:3)-mycmGPA, and 3G-myc-hGPA.
  • Differentiation capacity in these cells is assessed based on the expressions of Terl 19 and enucleation, i.e. nuclei expulsion, resulting in Terl 19 + reticulocytes. See upper panel.
  • the percentages of reticulocytes produced by erythroid progenitor cells infected with 5G (SEQ ID NO:3)-myc-hGPA, 5G-myc-mGPA, and 3G-myc-hGPA (-17.5%) are comparable to cells infected with empty (control) vector, indicating that these constructs do not disturb erythroid terminal differentiation. Quantification of enucleation rate represents 3 independent experiments and graphed as mean values +/" standard deviation. See lower panel.
  • Q HEK 293T cells were transfected to express 5G (SEQ ID NO:3)-myc-hGPA, 5G (SEQ ID NO:3)-myc-mGPA, 3G-myc-mGPA, and 3G-myc-hGPA. These cells were then incubated with a biotin probe with or without sortase, and total cell protein was immunoblotted for the myc-tag and biotin.
  • Immunoblot stained for biotin shows successful biotin conjugation only to human GPA constructs 3G-myc-hGPA (strong band) and 5G (SEQ ID NO:3)-myc-hGPA (weak band) with a much higher efficiency for 3Gmyc (strong band) and 5G (SEQ ID NO:3)-myc-hGPA (weak band) with a much higher efficiency for 3Gmyc-hGPA.
  • a-myc-tag immunoblotting further confirms biotin probe conjugation as indicated by a shift in hGPA molecular weight upon biotin conjugation.
  • Figure 19 is a diagram showing the expression and sortase-mediated N-terminal labeling of glycophorin A on the surface of in vitro differentiated erythroblasts.
  • A Flow cytometry analysis of in vitro differentiated erythroblasts for the presence of 3G-myc-hGPA and for sortase-labelled biotin-3G-myc-hGPA on the cell surface by staining with a-myc and a-biotin tag antibodies. See upper panel. Percentage of erythroblasts and reticulocytes with myc-tag on cell surface and percentage of myc-tag positive cells sortagged with a biotin probe was determined from 3 independent experiments, graphed as mean value +/" standard deviation; ** indicates p ⁇ 0.01.
  • FIG. 20 is a schematic illustration of engineered RBC production by mouse bone marrow/fetal liver cell transplantation. Isolated murine bone marrow cells or fetal liver cells were transduced with a retrovirus carrying hKell-LPETG (SEQ ID NO:44)-HA or 3G-myc- hGPA. Lethally irradiated mice were reconstituted with transduced bone marrow or fetal liver cells. After 1 month and onward, a significant percentage of mature RBCs are derived from transduced donor progenitors.
  • Figure 21 is a diagram showing expression and sortase-mediated C-terminal labeling of Kell on the surface of mature mouse red blood cells.
  • A Schematic for Kell C-terminal sortase labeling. Kell was extended at the C-terminus to include the sortase recognition motif LPETG (SEQ ID NO: 44) followed by an HA epitope tag. Incubation of sortase with cells containing Kell-LPETG (SEQ ID NO:44)-HA on the surface leads to peptide cleavage between T and G in the recognition motif and the formation of an acyl-enzyme intermediate between Cys on sortase and the sortase motif on Kell.
  • nucleophilic probe with N-terminal glycine residues (GGG-K(biotin); SEQ ID NO: 47; for biotin conjugation) resolves the intermediate, thus iigaiing the probe to the C-terminus of Kell.
  • the probe can be a peptide, protein, lipid, carbohydrate, small molecule, etc; LPXTG (SEQ ID NO:l).
  • Figure 22 is a diagram showing expression and sortase-mediated C-terminal labeling of Kell on the surface of in vitro differentiated erythroblasts.
  • A Flow cytometry of in vitro differentiated erythroblasts for the presence of hKell-LPETG (SEQ ID NO: 44)-HA and for sortase-labelled hKell-LPETG (SEQ ID NO: 44)-biotin on the cell surface by staining with ⁇ - ⁇ and ⁇ -biotin tag antibodies. See upper panel.
  • Figure 23 is a diagram showing sortase-mediated dual labeling at the N-terminus of hGPA and C-terminus of hKell on the surface of mature RBCs.
  • Mature RBCs expressing hKell-LPETG (SEQ ID NO: 44)-HA and 3A-myc-hGPA were incubated with sortase A from S. pyogenes and K(biotin)LPETAA (SEQ ID NO: 45) probe for N-terminal GPA labeling (second panel), or with sortase A from S.
  • Figure 24 is a number of charts showing survival of engineered red blood cells in vivo.
  • B mKell-LPETG(SEQ ID NO: 44) RBCs were obtained from mice genetically engineered to have endogenous Kell extended at is C- terminus with an
  • C CFSE-stained wild-type RBCs
  • Internal control RBCs are cells that originate from 3G-myc-hGPA transplanted mice, were subjected to the sortagging reaction and CFSE-staining, but are wild- type. Error bars represent standard deviation; * denotes p ⁇ 0.01.
  • Figure 25 is a diagram showing conjugation of single domain antibody to engineered red blood cells and cell type-specific targeting.
  • A Mouse mature red blood engineered to contain 3G-myc-GPA on the cell surface were incubated with Sortase with or without VHH7- LPETG (SEQ ID NO: 44), a single domain antibody with binding specificity for mouse MHC class II molecules and sortase motif complementary to 3G.
  • An immunoblot against myc epitope tag on glycophorin A reveals fusion of VHH7 to GPA, as an increase in GPA molecular weight.
  • B Either wild type mouse B cells (expressing MHC class II) or B cells derived from MHC class II knock-out mice were immobilized on magnetic streptavidin beads via biotinyiated a-CDI9 antibody, incubated with 3G-rnyc-GPA red blood cells or red ceils that contained sortase-labeled VHH7-LPETG (SEQ ID NO: 44)-myc GPA on their surface, and washed. Immobilization of B cells in all experimental set-ups was tested by presence of CD 19 in a-CD19 immunoblot and binding between B cells and red blood cells was evaluated by the presence of hemoglobin in the a-hemoglobin immunoblot. (Q Schematic for experiment shown in (B); LPETG: (SEQ ID NO: 44).
  • Figure 26 is a diagram showing expression and sortase-mediated labeling of glycophorin A on the surface of human in vitro differentiated reticulocytes.
  • Human granulocyte - colony stimulating factor- mobilized peripheral blood CD34+ stem cells were virus transduced either with empty vector or a vector containing 3G-myc-GPA-GFP and differentiated for 18 days.
  • Flow cytometry analysis of reticulocytes reveals the percentage of transduced cells(GFP + ) and percentage of enucleated cells (lower panel with Hoechst staining).
  • Reticulocytes either control or 3G-myc-GPA-GFP (3G-myc-hGPA-GFP-IRES-
  • GFP GFP transduced
  • 3G-myc-GPA-GFP transduced and in vitro differentiated reticulocytes were incubated with a biotin probe with or without sortase, and total cell protein immunoblotted for the myc tag and biotin. Both monomers as well as dimers (higher molecular weight) of 3G-myc- GPA-GFP are visible in both immunoblots. A shift in GPA-GFP molecular weight upon biotin conjugation in a-myc tag immunoblot indicates complete modification.
  • Red blood cells are the most numerous cell type in blood and account for a quarter of the total number of cells in the human body. RBCs possesses many unique characteristics that make them an attractive tool in therapeutics and diagnostics for various purposes, e.g., for in vivo delivery of natural or synthetic payloads. Yoo et al., 2011, Nature Reviews. Drug Delivery 10(7):521-535. For example, mature red blood cells do not have nuclei (i.e., enucleated) and thus there will be no risk of delivering remnants of foreign genes into a host. Thus, the possibility of tumorigenicity a key risk of stem cell-based therapies (Gruen et al., 2006 Stem cells 24( 10) :2162-2169) is thereby eliminated.
  • red blood cells have a long lifespan in vivo, e.g. , about 120 days in the human blood stream, and about 50 days in mice, and presence throughout the macro- and micro-circulation. Modification of red cells with bioavailable therapeutics might thus lead to prolonged efficacy and coverage of all areas perfused by the circulation in vivo.
  • RBCs have large cell surface areas of about 140 ⁇ ⁇ ⁇ with a favorable surface to volume ratio. Also, red blood cells have good biocompability when used as carriers for delivery of therapeutic or diagnostic agents.
  • old or damaged RBCs can be removed by cells of the reticuloendothelial system.
  • any modification made to the DNA of RBC precursors is eliminated upon their enucleation and cannot lead to abnormal growth or tumorigenicity after their transfusion into a recipient.
  • enucleated red blood cells that carry an agent of interest, such as diagnostic or therapeutic agents.
  • agent of interest such as diagnostic or therapeutic agents.
  • Such enucleated red blood cells can be used for, e.g., delivering the agent of interest into a subject.
  • Engineered RBCs have been generated using encapsulation (Biagiotti et al., 2011, IUBMB life 63(8):621-631; Godfrin et al., 2012, Expert Opinion on Biological Therapy 12(1): 127-133; and Muzykantov, 2010, Expert Opinion on Drug Delivery 7(4):403-427), by non-covalent attachment of foreign peptides, or through installation of proteins by fusion to a monoclonal antibody specific for a RBC surface protein(Murciano, 2003, Nature
  • Modified RBCs face limitations if intended for application in vivo. Encapsulation allows entrapment of sizable quantities of material, but at the expense of disrupting plasma membrane integrity, with a concomitant reduction in circulatory half-life of the modified red blood cells.
  • RBCs for targeted delivery
  • nanoparticles enveloped by an RBC-mimicking membrane as well as RBC-shaped polymers.
  • the short in vivo survival rate of these RBC- inspired carriers ( ⁇ 7 days maximum) may limit their therapeutic utility.
  • modified red blood cells were developed to serve as carriers for systemic delivery of a wide array of payloads.
  • These RBCs contain modified proteins on their plasma membrane, which can be labeled in a sortase-catalyzed reaction under native conditions without inflicting damage on the target membrane or cell. Sortase accommodates a wide range of natural and synthetic payloads that allow modification of RBCs with substituents that cannot be encoded genetically.
  • the present studies demonstrate the successful site-specific conjugation of biotin to in vitro differentiated mouse erythroblasts as well as to mature mouse RBCs. Unexpectedly, these modified red cells remain in the bloodstream for up to 28 days, which is far in excess of red blood cells engineered by methods known in the art.
  • RBCs enables them to bind specifically to target cells that express the antibody target. This study was extended to human red cells and demonstrate unexpected efficient sortase- mediated labeling of in vitro differentiated human reticulocytes.
  • the engineering and labeling processes described herein do not damage the cells or affect their survival in vivo.
  • the engineered red blood cells can be labeled with a wide array of functional probes, including small molecules, peptides, and proteins and thus have the potential to be carriers of a variety of therapeutic substances into the bloodstream.
  • the methods described herein offer advantages over the osmosis-driven encapsulation methods known in the art.
  • Sortase-mediated cell surface labeling has been exploited previously, for example to explore trafficking of flu glycoproteins. Popp et al, 2012 PLos Pathogens 8(3):ei002604; and Sanyal et al., 2013 Cell Host & Microbe 14(5):510-521. This methodology was modified and applied to primary cells as a platform for diagnostic or therapeutic purposes.
  • a sortase A variant from S. aureus active at 0 °C Chen et al, 2011 PNAS 108(28): 11399- 1 1404) to reduce the risk of inflicting cellular damage in the course of labeling.
  • engineered red cells loaded in the cytosol with a therapeutic agent and modified on the surface with a cell-type specific recognition module could be used to deliver payloads to a precise tissue/location in the body. It has been demonstrated herein attachment of two different functional probes to the surface of red blood cells, exploiting the subtly different recognition specificities of two distinct sortases. It should therefore be possible to attach both a therapeutic moiety as well as a targeting module to the red cell surface, to direct the engineered red cells to tumors or other diseased cells. Conjugation of an imaging probe, i.e., a radioisotope, together with such a targeting moiety could also be used for diagnostic purposes.
  • an imaging probe i.e., a radioisotope
  • enucleated red blood cells from mobilized CD34 + progenitor cells (e.g., human mobilized CD34 + peripheral blood cells).
  • enucleated red blood cells can be genetically engineered such that they express proteins of interest, e.g., sortaggable surface proteins.
  • Described herein is an in vitro culturing process for producing mature enucleated red blood cells from CD34 + progenitor cells (e.g., from a human subject).
  • This culturing process involves multiple differentiation stages (e.g., 2, 3, or more) and optionally an expansion stage prior to the differentiation phases.
  • the total time period for the in vitro culturing process described herein can range from 11-25 days (e.g., 15-25 days, 15-20 days, or 18-21 days). In one example, the total time period is 21 days. a.
  • CD34 + progenitor cells e.g., from a human subject.
  • This culturing process involves multiple differentiation stages (e.g., 2, 3, or more) and optionally an expansion stage prior to the differentiation phases.
  • the total time period for the in vitro culturing process described herein can range from 11-25 days (e.g., 15-25 days, 15-20 days, or 18-21 days). In one example, the total time period is 21 days. a
  • CD34 is a cell surface glycoprotein and functions as a cell-cell adhesion factor. Many human progenitor cells express this cell surface marker. Novershtern et al., Cell 144:296-
  • a progenitor cell like a stem cell, has a tendency to differentiate into a specific type of cell. Progenitor cells are usually more specific than stem cells and are often pushed to differentiate into the target cells. Any type of CD34+ progenitor cells that possess the tendency of differentiating into red blood cells can be used in the in vitro culturing process described herein. Such progenitor cells are well known in the art. See, e.g. , Novershtern et al., Cell 144:296-309, 201 1. In some examples, the in vitro culturing process described herein utilizes mobilized CD34+ peripheral blood cells as the progenitor cells for
  • CD34+ progenitor cells can also be derived from other sources (e.g., bone marrow).
  • Various techniques can be used to separate or isolate the CD34 + cell population from a suitable source such as peripheral blood cells.
  • antibodies such as monoclonal antibodies binding to CD34 can be used to enrich or isolate CD34 + cells.
  • the anti-CD34 antibodies can be attached to a solid support such that cells expressing these surface markers are immobilized, thereby allowing for the separation of CD34 + cells from cells that do not express this surface marker.
  • the separation techniques used should maximize the retention of viable cells to be collected. Such separation techniques can result in sub-populations of cells where up to 10%, usually not more than about 5%, preferably not more than about 1%, of the selected cells do not express CD34.
  • the particular technique employed will depend upon the efficiency of separation, associated cytotoxicity, ease and speed of performance, and necessity for sophisticated equipment and/or technical skill.
  • An “isolated” or “purified” population of CD34 + cells for use in the in vitro culturing process described herein is substantially free of cells and materials with which it is associated in nature, in particular, free of cells that lack the desired phenotype, e.g., expressing CD34.
  • Substantially free or substantially purified includes at least 50% CD34 + cells, preferably at least 70%, more preferably at least 80%, and even more preferably at least 90% CD34 + cells.
  • Procedures for separating the CD34 + population of cells can include, but are not limited to, physical separation, magnetic separation, antibody-coated magnetic beads, affinity chromatography, cytotoxic agents joined to a monoclonal antibody or used in conjunction with a monoclonal antibody, including, but not limited to, complement and cytotoxins, and "panning" with antibody attached to a solid matrix, e.g., plate, elutriation or any other convenient technique.
  • the use of physical separation techniques also include those based on differences in physical (density gradient centrifugation and counter-flow centrifugal elutriation), cell surface (lectin and antibody affinity), and vital staining properties (mitochondria-binding dye rhol23 and DNA-binding dye Hoechst 33342). These procedures are well known to those of skill in this art.
  • Techniques providing accurate separation of CD34 + cells further include flow cytometry, which can have varying degrees of sophistication, e.g., a plurality of color channels, low angle and obtuse light scattering detecting channels, impedance channels.
  • CD34 + cells also can be selected by flow cytometry based on light scatter characteristics, where the target cells are selected based on low side scatter and low to medium forward scatter profiles.
  • the in vitro culturing process described herein includes an expansion stage, in which the CD34 + progenitor cells are allowed to proliferate.
  • expansion or proliferation includes any increase in cell number. Expansion includes, for example, an increase in the number of CD34+ cells over the number of CD34+ cells present in the cell population used to initiate the culture. Expansion can also include increased survival of existing CD34+ cells. The term survival refers to the ability of a cell to continue to remain alive or function.
  • a population of CD34 + progenitor cells can be placed in a suitable container for expanding the CD34+ cells.
  • suitable containers for culturing the population of cells include flasks, tubes, or plates.
  • the flask can be T-flask such as a 12.5 cm 2 , or a 75 cm 2 T-flask.
  • the plate can be a 10 cm plate, a 3.5 cm plate, or a multi-welled plate such as a 12, 24, or 96 well plate.
  • the wells can be flat, v-bottom, or u-bottom wells.
  • the containers can be treated with any suitable treatment for tissue culture to promote cell adhesion or to inhibit cell adhesion to the surface of the container.
  • tissue culture to promote cell adhesion or to inhibit cell adhesion to the surface of the container.
  • Such containers are commercially available from Falcon, Corning and Costar.
  • expansion container also is intended to include any chamber or container for expanding cells whether or not free standing or incorporated into an expansion apparatus.
  • the cell density of the cultured population of CD34 + cells can be at least from about
  • the cell density can be from about 1x10 to about lxlO 6 cells/mL.
  • the cells can be cultured at an oxygen concentration of from about 2 to 20%.
  • Various media can be used to expand the population of CD34 + progenitor cells, including, but not limited to, Dulbecco's MEM, IMDM, X-Vivo 15 (serum-depleted) and RPMI-1640.
  • Such culture media can be serum free.
  • the medium is serum free StemSpan (Stem Cell Technologies), which can be supplemented with 10 ⁇ g/ml heparin.
  • the culture medium for use in the expansion stage can contain one or more cytokines.
  • cytokines are factors that exert a variety of effects on cells, for example, growth or proliferation.
  • Non-limiting examples of the cytokines that may be used in one or more stages of the in vitro culturing process e.g.
  • interleukin-2 in the expansion stage or any of the differentiation stages described below
  • interleukin 3 interleukin-3
  • interleukin 6 interleukin 6
  • IL-12 interleukin 12
  • G-CSF granulocyte-macrophage colony stimulating factor
  • GM-CSF granulocyte-macrophage colony stimulating factor
  • IL-1 interleukin 1 alpha
  • IL-11 interleukin 11
  • MIP-loc leukemia inhibitory factor
  • LIF leukemia inhibitory factor
  • c-kit ligand in the expansion stage or any of the differentiation stages described below
  • fit3 ligand in the in vitro culturing process described herein, or any stages thereof, can include culture conditions, in which one or more cytokine is specifically excluded from the culture medium.
  • Cytokines are commercially available from several vendors such as, for example, Amgen (Thousand Oaks, Calif), R & D Systems and Immunex (Seattle, Wash.). Cytokine can also include fibroblast growth factor (FGF) (e.g., FGF-1 or FGF-2), insulin-like growth factor (e.g., IGF-2, or IGF-1), thrombopoietin (TPO), and stem cell factor (SCF), or analogs and equivalents thereof. Equivalents thereof include molecules having similar biological activity to these factors (e.g., FGF, TPO, IGF, and SCF) in wild- type or purified form (e.g., recombinantly produced).
  • FGF fibroblast growth factor
  • IGF-2 insulin-like growth factor
  • TPO thrombopoietin
  • SCF stem cell factor
  • Analogs include fragments retaining the desired activity and related molecules.
  • TPO is a ligand of the mpl receptor, thus molecules capable of binding the mpl receptor and initiating one or more biological actions associated with TPO binding to mpl are also within the scope of the invention.
  • An example of a TPO mimetic is found in Cwirla et. al. (1997) Science 276:1696.
  • the expansion stage of the in vitro culturing process described herein can be performed as follows.
  • a population of human mobilized CD34 + peripheral blood cells is placed in an expansion container at a cell density of 10xl0 -10xl0 6 (e.g., lxlO 5 ) cells/mL.
  • the CD34 + cells are cultured in an expansion medium (e.g., StemSpan serum-free medium) supplemented with a cytokine mixture of Flt-3 ligand, SCF, IL-3, and IL-6 and 2% penicillin and streptomycin under suitable conditions (e.g., 37 °C) for 1-6 days (e.g., 2-5 days, 3-4 days, or 4 days).
  • the expanded CD34+ cells can be collected and subjected to further in vitro culturing under conditions allowing for differentiation toward mature enucleated red blood cells.
  • the in vitro culturing process described herein involves multiple differentiation stages (2, 3, 4, or more), in which CD34+ progenitor cells differentiate into mature enucleated red blood cells.
  • CD34+ progenitor cells either obtained from the expansion stage or collected from the original source
  • cells obtained from the preceding differentiation stage can be cultured in a medium comprising one or more suitable cytokines (e.g. , those described herein) under suitable conditions for a suitable period of time.
  • Biological properties of the cells may be monitored during the course or at the end of each differentiation stage to evaluate the status of erythropoiesis. Whenever necessary, cytokines can be timely supplied and/or withdrawn at each differentiation stage to achieve optimal erythroid differentiation and/or synchronizing the cell population in culture.
  • CD34 + progenitor cells either obtained from the expansion stage described herein or isolated from an original source (e.g., human peripheral blood), or cells obtained from the preceding differentiation stage can be cultured in a suitable medium, such as those described above, supplemented with one or more cytokines under suitable culturing conditions for a suitable period of time.
  • a suitable medium such as those described above
  • the culture medium e.g., IMDM
  • holo human transferrin and insulin at suitable concentrations.
  • concentration of insulin can range from 5-20 ⁇ g/ml (e.g., 5-15 ⁇ g/ml, 5-10 ⁇ g/ml, or 10-20 ⁇ g/ml).
  • the culture medium may also be supplemented with other components commonly used in cell culture, e.g., fetal bovine serum, glutamine, bovine serum albumin, one or more antibiotics (e.g., penicillin and streptomycin), or any combination thereof.
  • the in vitro culturing process described herein includes three differentiation stages, Differentiation stage I ('Dif. I), Differentiation stage II (“Dif. II”), and Differentiation stage III (“Dif. III").
  • the cells may be cultured in the presence of a mixture of cytokines including a glucocorticoid (e.g., dexamethasone), ⁇ -estradiol, IL-3, SCF, and EPO (including human EPO, EPO from other species, or EPO analogs such as Epoetin alfa, Epoetin beta, or
  • the concentration of dexamethasone may range from 100 nM to 5 ⁇ (e.g., 100 nM to 2 ⁇ , 500 nM to 5 ⁇ , 1 ⁇ to 3 ⁇ , 1 ⁇ to 2 ⁇ , or 2 ⁇ to 5 ⁇ ).
  • the concentration of ⁇ -estradiol may range from 0.5-5 ⁇ (e.g. , 0.5-4 ⁇ , 1-5 ⁇ , 0.5-3 ⁇ , 0.5-2 ⁇ , 0.5-1 ⁇ , 1-2 ⁇ , 1-3 ⁇ , or 3-5 ⁇ ).
  • the concentration of IL-3 may range from 1-10 ng/ml (e.g., 1-8 ng/ml, 1-5 ng/ml, 3-6 ng/ml, 4-8 ng/ml, or 5-10 ng/ml).
  • the concentration of SCF may range from 10-500 ng/ml (e.g., 10-300 ng/ml, 50-500 ng/ml, 50-200 ng/ml, 50-100 ng/ml, 100-200 ng/ml, or 100-400 ng/ml).
  • the amount of EPO may range from 2-10 U (e.g., 2-8 U, 2-6 U, 5-10 U, or 6-10 U).
  • one EPO unit elicits the same erythropoiesis stimulating response in rodents (historically: fasted rats) as five micromoles of cobaltous chloride. See, e.g., Jelkmann, Nephrol Dial. Transplant, 2009.
  • the medium used in Dif. I contains holo human transferrin, insulin, dexamethasone, ⁇ -estradiol, IL-3, SCF, and EPO. This medium may be substantially free of certain other cytokines, such as Flt-3 ligand or IL-6, or substantially free of other cytokines.
  • the cells obtained from Dif. I may be cultured in the presence of a mixture of cytokines including SCF and EPO at suitable concentrations for a suitable period of time (e.g., 3-5 days, 3-4 days, or 4-5 days).
  • a suitable period of time e.g., 3-5 days, 3-4 days, or 4-5 days.
  • the concentration of SCF can range from 10-100 ng/ml (e.g., 10-80 ng/ml, 20-80 ng/ml, 20-50 ng/ml, 30-50 ng/ml, 40-50 ng/ml, 50-80 ng/ml, or 50-60 ng/ml).
  • the amount of EPO can range from 2-10 U (e.g., 2-8 U, 2-6 U, 5-10 U, or 6-10 U).
  • the medium used in Dif. II contains holo human transferrin, insulin, SCF, and EPO.
  • This medium may be substantially free of certain cytokines, such as Flt-3, IL-6, dexamethasone, ⁇ -estradiol, IL-3, or any combination thereof, or may be substantially free of other cytokines.
  • the cells obtained from Dif. II may be cultured in the presence of EPO at a suitable concentration for a suitable period of time (e.g., 4-12 days, 5-10 days, 8-12 days, or 8-10 days).
  • the amount of EPO may range from 0.5-3 U (e.g., 1-3 U, 0.5- 2 U, 1-2 U, or 2-3 U).
  • the medium used in Dif. Ill contains holo human transferrin, insulin, and EPO. This medium may be substantially free of certain cytokines, for example, Flt-3, IL-6, dexamethasone, ⁇ -estradiol, IL-3, SCF, or any combination thereof, or substantially free of other cytokines.
  • the in vitro culturing process described herein may include one or any combination of the differentiation stages described herein, for example, Dif. I and Dif. Ill, Dif. II and Dif. Ill, or Dif. I and Dif. II.
  • the CD34 + progenitor cells may be genetically modified such that they express surface proteins of interest, for example, sortaggable surface proteins, which are discussed in detail below.
  • surface proteins of interest such as sortaggable surface proteins, fluorescent proteins such as green fluorescent protein (GFP), or protein drugs (e.g., antibodies or antigen-binding fragments thereof).
  • fluorescent proteins such as green fluorescent protein (GFP)
  • protein drugs e.g., antibodies or antigen-binding fragments thereof.
  • Expression vectors for producing the surface protein of interest may be introduced into CD34 + progenitor cells, which can be isolated from an original source or obtained from the expansion stage described above via routine recombinant technology.
  • the expression vectors can be designed such that they can incorporate into the genome of cells by homologous or non-homologous recombination by methods known in the art.
  • Methods for transferring expression vectors into CD34 + progenitor cells include, but are not limited to, viral mediated gene transfer, liposome mediated transfer, transformation, transfection and transduction, e.g., viral mediated gene transfer such as the use of vectors based on DNA viruses such as adenovirus, adeno-associated virus and herpes virus, as well as retroviral based vectors.
  • viral mediated gene transfer such as the use of vectors based on DNA viruses such as adenovirus, adeno-associated virus and herpes virus, as well as retroviral based vectors.
  • modes of gene transfer include e.g., naked DNA, CaP0 4 precipitation, DEAE dextran, electroporation, protoplast fusion, lipofection, cell microinjection, and viral vectors, adjuvant-assisted DNA, gene gun, catheters.
  • a viral vector is used.
  • nucleic acid or protein can be conjugated to antibodies or binding fragments thereof which bind cell surface antigens, e.g., CD34.
  • liposomes that also include a targeting antibody or fragment thereof can be used in the methods described herein.
  • a "viral vector” as described herein refers to a recombinantly produced virus or viral particle that comprises a polynucleotide to be delivered into a host cell, either in vivo, ex vivo or in vitro.
  • viral vectors include retroviral vectors such as lentiviral vectors, adenovirus vectors, adeno-associated virus vectors and the like.
  • a vector construct refers to the polynucleotide comprising the retroviral genome or part thereof, and a therapeutic gene.
  • a gene encoding the surface protein of interest can be inserted into a suitable vector (e.g., a retroviral vector) using methods well known in the art. Sambrook et al., Molecular Cloning, A Laboratory Mannual, 3 rd Ed., Cold Spring Harbor Laboratory Press.
  • a suitable vector e.g., a retroviral vector
  • the gene and vector can be contacted, under suitable conditions, with a restriction enzyme to create complementary ends on each molecule that can pair with each other and be joined together with a ligase.
  • synthetic nucleic acid linkers can be ligated to the termini of a gene. These synthetic linkers contain nucleic acid sequences that correspond to a particular restriction site in the vector.
  • the vector can contain, for example, some or all of the following: a selectable marker gene, such as the neomycin gene for selection of stable or transient transfectants in mammalian cells; enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription; transcription termination and RNA processing signals from SV40 for mRNA stability; SV40 polyoma origins of replication and ColEl for proper episomal replication; versatile multiple cloning sites; and T7 and SP6 RNA promoters for in vitro transcription of sense and antisense RNA.
  • a selectable marker gene such as the neomycin gene for selection of stable or transient transfectants in mammalian cells
  • enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription
  • transcription termination and RNA processing signals from SV40 for mRNA stability transcription termination and RNA processing signals from SV40 for mRNA stability
  • SV40 polyoma origins of replication and ColEl for proper episomal
  • Modification of CD34 + progenitor cells can comprise the use of an expression cassette created for either constitutive or inducible expression of the introduced gene.
  • Such an expression cassette can include regulatory elements such as a promoter, an initiation codon, a stop codon, and a polyadenylation signal.
  • the elements are preferably operable in the progenitor cells or in cells that arise from the progenitor cells (e.g., enucleated red blood cells) after administration (e.g., infusion) into an individual.
  • the elements can be operably linked to the gene encoding the surface protein of interest such that the gene is operational (e.g., is expressed) in the progenitor cells or red blood cells derived therefrom.
  • promoters can be used for expression of the surface protein of interest. Promoters that can be used to express the protein are well known in the art. Promoters include cytomegalovirus (CMV) intermediate early promoter, a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR, the simian virus 40 (SV40) early promoter, E. coli lac UV5 promoter and the herpes simplex tk virus promoter.
  • CMV cytomegalovirus
  • a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR
  • SV40 simian virus 40
  • E. coli lac UV5 promoter E. coli lac UV5 promoter
  • herpes simplex tk virus promoter the herpes simplex tk virus promoter.
  • Regulatable promoters can also be used.
  • Such regulatable promoters include those using the lac repressor from E. coli as a transcription modulator to regulate transcription from lac operator-bearing mammalian cell promoters [Brown, M. et al., Cell, 49:603-612 (1987)], those using the tetracycline repressor (tetR) [Gossen, M., and Bujard, H., Proc. Natl. Acad. Sci. USA 89:5547-5551 (1992); Yao, F. et al., Human Gene Therapy, 9: 1939-1950 (1998); Shockelt, P., et al., Proc. Natl. Acad. Sci.
  • Regulatable promoters that include a repressor with the operon can be used.
  • the lac repressor from E. coli can function as a transcriptional modulator to regulate transcription from lac operator-bearing mammalian cell promoters [M. Brown et al.,
  • tetR tetracycline repressor
  • VP 16 transcription activator
  • cytomegalovirus (hCMV) major immediate-early promoter to create a tetR-tet operator system to control gene expression in mammalian cells.
  • a tetracycline inducible switch is used.
  • the tetracycline repressor (tetR) alone, rather than the tetR- mammalian cell transcription factor fusion derivatives can function as potent trans-modulator to regulate gene expression in mammalian cells when the tetracycline operator is properly positioned downstream for the TATA element of the CMVIE promoter [F. Yao et al., Human
  • tetracycline inducible switch does not require the use of a tetracycline repressor-mammalian cells transactivator or repressor fusion protein, which in some instances can be toxic to cells [M. Gossen et al., Natl.
  • the effectiveness of some inducible promoters can be increased over time. In such cases one can enhance the effectiveness of such systems by inserting multiple repressors in tandem, e.g., TetR linked to a TetR by an internal ribosome entry site (IRES). Alternatively, one can wait at least 3 days before screening for the desired function. While some silencing may occur, it can be minimized by using a suitable number of cells, preferably at least lxlO 4 , more preferably at least lxlO 5 , still more preferably at least lxlO 6 , and even more preferably at least lxl 0 7 .
  • One can enhance expression of desired proteins by known means to enhance the effectiveness of this system. For example, using the Woodchuck Hepatitis Virus
  • WPRE Posttranscriptional Regulatory Element
  • polyadenylation signals useful to practice the methods described herein include, but are not limited to, human collagen I polyadenylation signal, human collagen II polyadenylation signal, and SV40 polyadenylation signal.
  • exogenous genetic material that includes the surface protein-encoding gene operably linked to the regulatory elements may remain present in the cell as a functioning cytoplasmic molecule, a functioning episomal molecule or it may integrate into the cell's chromosomal DNA.
  • Exogenous genetic material may be introduced into cells where it remains as separate genetic material in the form of a plasmid.
  • linear DNA which can integrate into the chromosome, may be introduced into the cell.
  • reagents, which promote DNA integration into chromosomes may be added.
  • DNA sequences, which are useful to promote integration may also be included in the DNA molecule.
  • RNA may be introduced into the cell.
  • Selectable markers can be used to monitor uptake of the desired transgene into the progenitor ceils described herein.
  • These marker genes can be under the control of any promoter or an inducible promoter. These are known in the art and include genes that change the sensitivity of a cell to a stimulus such as a nutrient, an antibiotic, etc. Genes include those for neo, puro, tk, multiple drug resistance (MDR), etc. Other genes express proteins that can readily be screened for such as green fluorescent protein (GFP), blue fluorescent protein (BFP), luciferase, and LacZ.
  • GFP green fluorescent protein
  • BFP blue fluorescent protein
  • luciferase and LacZ.
  • the CD34 + progenitor cells can be genetically modified using any of the methods described herein or known in the art such that they are capable of expressing a sortaggable surface protein, such as a fusion protein comprising a red blood cell membrane protein and a peptide (e.g., a peptide heterologous to the membrane protein).
  • a sortaggable surface protein can be conjugated to another peptide via a sortase-mediated transpeptidation reaction. Strijbis et al., Traffic 13(6):780-789, 2012.
  • the transduction of the CD34 + progenitor cells with a gene encoding a sortaggable surface protein is via a viral vector such as a retroviral vector (as described in for example, in WO 94/29438, WO 97/21824 and WO 97/21825).
  • a viral vector such as a retroviral vector (as described in for example, in WO 94/29438, WO 97/21824 and WO 97/21825).
  • a sortaggable surface protein can be a fusion protein comprising a membrane protein and at least one heterologous protein.
  • a membrane protein for use in the methods described herein which may present on mature RBCs, inhibit neither erythroid differentiation nor be targeted for degradation during the extensive membrane remodeling that occurs during enucleation and at the later reticulocyte stage.
  • membrane proteins are known in the art. See, e.g., Liu et al., 2010, Blood, 1 15(10):2021-2027.
  • red blood cell precursors express high levels of the transferrin receptor (Tfr), a type II membrane protein, but since it is no longer present on mature RBCs, Tfr may not be a suitable target for use in preparing a sortaggable surface protein.
  • Tfr transferrin receptor
  • Any membrane proteins present in mature RBCs can be used for constructing the sortaggable surface protein as described herein.
  • the membrane protein can be fused to a heterologous peptide at the terminus that is exposed to the extracellular or luminal space.
  • the terminus of the membrane protein that is exposed to cytoplasm may also be fused to a second heterologous protein of interest, which can be a cytoplasmic protein.
  • the heterologous protein may comprise an acceptor peptide to which another peptide can conjugate via a sortase-catalyzed
  • the acceptor peptide is an oligoglycine or oligoalanine, such as a 1-5 glycine fragment or a 1-5 alanine fragment.
  • the oligoglycine consists of 3 or 5 glycine (SEQ ID NO: 3) residues.
  • the oligoalanine consists of 3 or 5 alanine residues (SEQ ID NO: 79).
  • the sortaggable surface protein is a fusion protein comprising a type I red blood cell transmembrane protein, such as glycophorin A, intercellular adhesion molecule
  • ICM-4 Lutheran glycoprotein
  • CD329 Lutheran glycoprotein
  • Basigin CD 147
  • a peptide that comprises an acceptor peptide e.g., a peptide that includes an oligoglycine moiety, such as a 1-5 glycine fragment.
  • acceptor peptide e.g., a peptide that includes an oligoglycine moiety, such as a 1-5 glycine fragment.
  • acceptor peptide e.g., a peptide that includes an oligoglycine moiety, such as a 1-5 glycine fragment.
  • acceptor peptide e.g., a peptide that includes an oligoglycine moiety, such as a 1-5 glycine fragment.
  • Type I transmembrane proteins are single-pass transmembrane proteins which have their N-termini exposed to the extracellular or luminal space.
  • the sortaggable surface protein is a fusion protein comprising a type II red blood cell transmembrane protein, e.g., Kell, or CD71, and a peptide that comprises a sequence recognizable by a sortase (e.g., sortase A).
  • Type II transmembrane proteins are single-pass transmembrane proteins which have their C-termini exposed to the extracellular or luminal space.
  • Motifs recognizable by a sortase are well known in the art.
  • One exemplary motif recognizable by a sortase, particularly sortase A is LPXTG (SEQ ID NO: 1), in which X can be any amino acid residue (naturally-occurring or non-naturally occurring), e.g., any of the 20 standard amino acids found most commonly in proteins found in living organisms.
  • the recognition motif is LPXTG (SEQ ID NO: 1) or LPXT (SEQ ID NO: 50), in which X is D, E, A, N, Q, K, or R.
  • X is selected from K, E, N, Q, A in an LPXTG (SEQ ID NO: 1) or LPXT (SEQ ID NO: 50)motif, which are recognizable by a sortase A.
  • X is selected from K, S, E, L, A, N in an LPXTG (SEQ ID NO: 1) or LPXT (SEQ ID NO: 50) motif, which are recognizable by a class C sortase.
  • Exemplary sortase recognition motifs include, but are not limited to, LPKTG (SEQ ID NO: 51), LPITG (SEQ ID NO: 52), LPDTA (SEQ ID NO: 53), SP TG (SEQ ID NO: 54) , LAETG (SEQ ID NO: 55), LAATG (SEQ ID NO: 56), LAHTG (SEQ ID NO: 57), LASTG (SEQ ID NO: 58), LPLTG (SEQ ID NO: 59), LSRTG (SEQ ID NO: 60), LPETG (SEQ ID NO: 44), VPDTG (SEQ ID NO: 61), IPQTG (SEQ ID NO: 62), YPRRG (SEQ ID NO: 63), LPMTG (SEQ ID NO: 64), LAFTG (SEQ ID NO: 65), LPQTS (SEQ ID NO: 66), LPXT (SEQ ID NO: 50), LAXT (SEQ ID NO: 67), LPXA (SEQ ID NO: 68), LGX
  • the sortaggable surface protein described herein can also be a fusion protein comprising a type III red cell transmembrane protein and a heterologous peptide.
  • Type III membrane proteins are multi-pass structures, which usually have their N-termini exposed to the extracellular or luminal space.
  • Examples of type III red cell transmembrane proteins include GLUT1, Aquaporin 1, and Band 3.
  • a type III transmembrane protein can be fused with an acceptor peptide at the N-terminus of the transmembrane protein.
  • a sortase recognition sequence as described above can further comprises one or more additional amino acids, e.g., at the N or C terminus.
  • additional amino acids e.g., at the N or C terminus.
  • amino acids e.g., up to 5 amino acids
  • Such additional amino acids may provide context that improves the recognition of the recognition motif.
  • a sortase recognition motif can be masked.
  • a masked sortase recognition motif is a motif that is not recognized by a sortase but that can be readily modified (“unmasked") such that the resulting motif is recognized by the sortase.
  • at least one amino acid of a masked sortase recognition motif comprises a side chain comprising a moiety that inhibits, e.g., prevents, recognition of the sequence by a sortase of interest, e.g., SrtAaureus.
  • Removal of the inhibiting moiety allows recognition of the motif by the sortase.
  • Masking may, for example, reduce recognition by at least 80%, 90%, 95%, or more (e.g., to undetectable levels) in certain embodiments.
  • a threonine residue in a sortase recognition motif such as LPXTG (SEQ ID NO: 1) may be phosphorylated, thereby rendering it refractory to recognition and cleavage by SrtA.
  • the masked recognition sequence can be unmasked by treatment with a phosphatase, thus allowing it to be used in a SrtA-catalyzed transamidation reaction.
  • the genetically modified membrane protein of a CD34+ progenitor cell can further include additional suitable tags, which include, but are not limited to, amino acids, nucleic acids, polynucleotides, sugars, carbohydrates, polymers, lipids, fatty acids, and small molecules.
  • suitable tags include, but are not limited to, amino acids, nucleic acids, polynucleotides, sugars, carbohydrates, polymers, lipids, fatty acids, and small molecules.
  • suitable tags will be apparent to those of skill in the art and the invention is not limited in this aspect.
  • such a tag comprises a sequence useful for purifying, expressing, solubilizing, and/or detecting a polypeptide.
  • a tag can serve multiple functions.
  • the tag is relatively small, e.g., ranging from a few amino acids up to about 100 amino acids long.
  • a tag is more than 100 amino acids long, e.g., up to about 500 amino acids long, or more.
  • a tag comprises an HA, TAP, Myc, 6xHis, Flag, streptavidin, biotin, or GST tag, to name a few examples.
  • a tag comprises a solubility-enhancing tag (e.g., a SUMO tag, NUS A tag, SNUT tag, or a monomeric mutant of the Ocr protein of bacteriophage T7). See, e.g., Esposito D and Chatterjee DK. Curr Opin Biotechnol.;
  • a tag is cleavable, so that it can be removed, e.g. , by a protease. In some embodiments, this is achieved by including a protease cleavage site in the tag, e.g., adjacent or linked to a functional portion of the tag.
  • exemplary proteases include, e.g., thrombin, TEV protease, Factor Xa, PreScission protease, etc.
  • a "self-cleaving" tag is used. See, e.g., Wood et al, International PCT
  • the genetically modified red blood cells may express a fusion protein on the surface, the fusion protein comprising a red blood cell membrane protein as described herein, a first heterologous peptide fused to the terminus of the membrane protein that is exposed to the extracellular or luminal space, and a second heterologous protein fused to the terminus of the membrane protein that is exposed to the cytoplasmic space.
  • the first heterologous peptide may comprise an acceptor peptide of a sortase (any acceptor peptides as described herein), if it is fused to the N-terminus of the membrane protein (e.g., a Type I membrane protein).
  • the first heterologous peptide may comprise a sequence recognizable by a sortase (e.g., LPXTG (SEQ ID NO: 1) or LPXT (SEQ ID NO: 50)), if it is fused to the C-terminus of the membrane protein (e.g., a Type II membrane protein).
  • a sortase e.g., LPXTG (SEQ ID NO: 1) or LPXT (SEQ ID NO: 50)
  • the second heterologous protein is fused to the C-terminus of the membrane protein.
  • the expression cassette for producing such a fusion protein may contain two copies of sequences encoding the second heterologous protein, one being fused in-frame with the membrane protein while the other being located 3' downstream to an IRES site located between the two copies. This design would allow for production of the second heterologous protein in free form and in fusion form with the membrane protein. See, e.g., Examples below.
  • the second heterologous protein is fused to the N-terminus of the membrane protein.
  • the expression cassette for producing such a fusion protein may contain two copies of the sequence encoding the second heterologous protein, which are separated by an IRES site, so as to produce the second heterologous protein in both free and fusion form.
  • the second heterologous protein can be a cytoplasmic protein.
  • the heterologous protein is a diagnostic protein, e.g., a protein such as a fluorescent protein (e.g., GFP) which can release a detectable signal under suitable conditions.
  • the heterologous protein is a therapeutic protein, e.g., a protein drug.
  • a targeting agent may be conjugated to the first heterologous peptide as described above via a sortase reaction.
  • a target agent e.g., an antibody such as a single domain antibody
  • a specific type of cells e.g., disease cells such as cancer cells.
  • the resultant genetically modified red blood cells are useful in delivering the cytoplasmically deposed protein of interest (the second heterologous protein) to intended target cells recognizable by the target agent.
  • the present disclosure provides genetically engineered red blood cells that express two sortaggable surface proteins, which can be conjugated to different functional moieties via reactions catalyzed by sortase enzymes having different substrate specificity. See below discussions.
  • both of the two sortaggable surface proteins comprise a Type I membrane protein (e.g., GPA).
  • the N-terminus of the Type I membrane protein is fused to an oligoglycine (e.g., G 3 or G 5 (SEQ ID NO: 3)); in the other sortaggable surface protein, the N-terminus of the Type I membrane protein is fused to an oligoalanine (e.g., A 3 or A 5 (SEQ ID NO: 79)).
  • both of the two sortaggable surface proteins comprise a Type II membrane protein (e.g., Keil or CD71).
  • the C-terminus of the Type II membrane protein is fused to the motif LPXTG (SEQ ID NO: 1); in the other sortaggable surface protein, the C-terminus of the Type II membrane protein is fused to the motif LPXTA (SEQ ID NO: 2).
  • one of the sortaggable surface protein comprises a Type I membrane protein (e.g., GPA), the N-terminus of which is fused to an acceptor peptide
  • the other sortaggable surface protein comprises a Type II membrane protein (e.g., Kell or CD71), the C-terminus of which is fused to a sequence recognizable by a sortase.
  • the sequence recognizable by a sortase may be the motif of LPXTA (SEQ ID NO: 2).
  • the sequence recognizable by a sortase may be the motif of LPXTG (SEQ ID NO: 1).
  • any of the genetically modified CD34 + progenitor cells described herein can be cultured under suitable conditions allowing for differentiation into mature enucleated red blood cells, e.g., the in vitro culturing process described herein.
  • the resultant enucleated red blood cells are capable of expressing the surface protein of interest, such as a sortaggable surface protein as described herein, which can be evaluated and confirmed by routine methodology (e.g. , Western blotting or FACS analysis).
  • sortagging refers to the process of adding a tag, e.g., a moiety or molecule (e.g., a protein, polypeptide, detectable label, binding agent, or click chemistry handle, onto a target molecule, for example, a target protein on the surface of a red blood cell via a sortase-mediated transpeptidation reaction.
  • a tag e.g., a moiety or molecule (e.g., a protein, polypeptide, detectable label, binding agent, or click chemistry handle
  • Sortase is a family of enzymes capable of carrying out a transpeptidation reaction conjugating the C-terminus of a protein to the N-terminus of another protein via
  • Sortases are also referred to as transamidases, and typically exhibit both a protease and a transpeptidation activity.
  • Various sortases from prokaryotic organisms have been identified. For example, some sortases from Gram-positive bacteria cleave and translocate proteins to proteoglycan moieties in intact cell walls.
  • sortases that have been isolated from Staphylococcus aureus are sortase A (Sit A) and sortase B (Srt B).
  • a transamidase used in accordance with the conjugation methods described herein is sortase A, e.g., that from S.
  • a transamidase is a sortase B, e.g., from S. aureus, also referred to herein as SrtB aure us-
  • Sortases have been classified into four classes, designated A , B, C, and D (i.e., sortase A, sortase B, sortase C, and sortase D, respectively) based on sequence alignment and phylogenetic analysis of 61 sortases from Gram-positive bacterial genomes (Dramsi et al., Res Microbiol.156(3):289-97, 2005; the entire contents of which are incorporated herein by reference).
  • sortase A is used herein to refer to a class A sortase, usually named SrtA in any particular bacterial species, e.g., SrtA from & aureus.
  • sortase B is used herein to refer to a class B sortase, usually named SrtB in any particular bacterial species, e.g., SrtB from S. aureus.
  • the present disclosure encompasses embodiments relating to any of the sortase classes known in the art (e.g., a sortase A from any bacterial species or strain, a sortase B from any bacterial species or strain, a class C sortase from any bacterial species or strain, and a class D sortase from any bacterial species or strain).
  • a sortase A from any bacterial species or strain e.g., a sortase A from any bacterial species or strain, a sortase B from any bacterial species or strain, a class C sortase from any bacterial species or strain, and a class D sortase from any bacterial species or strain.
  • amino acid sequences of Srt A and Srt B and the nucleotide sequences that encode them are known to those of skill in the art and are disclosed in a number of references cited herein, the entire contents of all of which are incorporated herein by reference.
  • the amino acid sequences of S. aureus SrtA and SrtB are homologous, sharing, for example, 22% sequence identity and 37% sequence similarity.
  • the amino acid sequence of a sortase- transamidase from Staphylococcus aureus also has substantial homology with sequences of enzymes from other Gram-positive bacteria, and such transamidases can be utilized in the ligation processes described herein.
  • naeslundii, S. mutans, E. faecalis or B. subtilis open reading frame encoding a sortase can be screened, and enzymes having transamidase activity comparable to Srt A or Srt B from S. aureas can be utilized ⁇ e.g., comparable activity sometimes is 10% of Srt A or Srt B activity or more).
  • the conjugation methods described herein use a sortase A (SrtA).
  • SrtA recognizes the motif LPXTX (SEQ ID NO: 80; wherein each occurrence of X represents independently any amino acid residue), with common recognition motifs being, e.g., LPKTG (SEQ ID NO: 81), LP ATG (SEQ ID NO: 82), LPNTG (SEQ ID NO: 83).
  • LPKTG SEQ ID NO: 81
  • LP ATG SEQ ID NO: 82
  • LPNTG SEQ ID NO: 83
  • LPETG SEQ ID NO: 44
  • the motif comprises an 'A' rather than a ' at position 4, e.g., LPXAG (SEQ ID NO: 84), e.g., LPNAG (SEQ ID NO: 85).
  • the motif comprises an 'A' rather than a 'G 5 at position 5, e.g., LPXTA (SEQ ID NO: 2), e.g., LPNTA (SEQ ID NO: 86).
  • the motif comprises a 'G' rather than 'P' at position 2, e.g., LGXTG (SEQ ID NO: 87), e.g., LGATG (SEQ ID NO: 88).
  • the motif comprises an T rather than 'L' at position 1, e.g. , IPXTG (SEQ ID NO: 89), e.g., IPNTG (SEQ ID NO: 90) or IPETG (SEQ ID NO: 91).
  • IPXTG SEQ ID NO: 89
  • IPNTG SEQ ID NO: 90
  • IPETG SEQ ID NO: 91
  • sortase recognition sequence with respect to sequences recognized by a transamidase or sortase, are used interchangeably.
  • sortase recognition motifs can be used for constructing the sortaggable surface proteins described herein.
  • the sortase is a sortase B (SrtB), e.g. , a sortase
  • NP[Q/K]-[T/s]-[N/G/s] SEQ ID NO: 93
  • NPQTN SEQ ID NO: 94
  • NPKTG NPKTG
  • sortase B of S. aureus or B. anthracis cleaves the NPQTN
  • NPKTG SEQ ID NO: 95 motif of IsdC in the respective bacteria (see, e.g., Marraffini et al., Journal of Bacteriology, 189(17): 6425-6436, 2007).
  • Other recognition motifs found in putative substrates of class B sortases are NSKTA (SEQ ID NO: 96), NPQTG (SEQ ID NO: 97), NAKTN (SEQ ID NO: 98), and NPQSS (SEQ ID NO: 99).
  • SrtB from L.
  • monocytogenes recognizes certain motifs lacking P at position 2 and/or lacking Q or K at position 3, such as NAKTN (SEQ ID NO: 98) and NPQSS (SEQ ID NO: 99) (Mariscotti et al., J Biol Chem. 2009 Jan 7).
  • sortase recognition motifs can also be used for constructing the sortaggable surface proteins described herein.
  • Sortases with distinct substrate specificity, it is possible to combine N-terminal and C-terminal labeling strategies (Antos et al., 2009, J Am. Chem. Soc, 131(31):10800- 10801) to generate multi-labeled RBCs.
  • Sortase A derived from Staphylococcus aureus
  • Sortase A derived from Streptococcus pyogenes recognizes LPXTA (SEQ ID NO: 2) motifs and accepts oligo-alanine probes as nucleophiles. Therefore, the sortase reactions of both enzymes can be performed as orthogonal reactions. Utilization of such sortase reactions with suitable sortase(s) is also within the scope of the present disclosure.
  • the sortase is a sortase C (Srt C).
  • Sortase C may utilize LPXTX (SEQ ID NO: 80) as a recognition motif, with each occurrence of X independently representing any amino acid residue. This recognition motif can be used for constructing the sortaggable surface proteins described herein.
  • the sortase is a sortase D (Srt D).
  • Sortases in this class are predicted to recognize motifs with a consensus sequence NA-[E/A/S/H]-TG (SEQ ID NO: 100; Comfort D, supra). Sortase D has been found, e.g., in Streptomyces spp.,
  • LPXTA SEQ ID NO: 2
  • LAXTG SEQ ID NO: 101
  • B. anthracis Sortase C has been shown to specifically cleave the LPNTA (SEQ ID NO: 102) motif in B. anthracis Basl and BasH (see Marrafini, supra).
  • sortases including, but not limited to, sortases recognizing additional sortase recognition motifs are also suitable for use in some embodiments of this invention. For example, sortases described in Chen et al., Proc Natl Acad Sci USA. 2011 Jul
  • sortase that recognizes QVPTGV (SEQ ID NO: 103) motif as described in Barnett et al., Journal of Bacteriology, Vol. 184, No. 8, p. 2181-2191, 2002; the entire contents of which are incorporated herein by reference).
  • sortases found in any gram-positive organism, such as those mentioned herein and/or in the references (including databases) cited herein is contemplated in the context of some embodiments of this invention.
  • sortases found in gram negative bacteria, e.g., Colwellia psychrerythraea, Microbulbifer degradans, Bradyrhizobium japonicum, Shewanella oneidensis, and Shewanella putrefaciens.
  • sortases recognize sequence motifs outside the LPXTX (SEQ ID NO: 80) consensus, for example, LP[Q/K]T[A/S]T (SEQ ID NO: 104).
  • a sequence motif LPXT[A/S] (SEQ ID NO: 105), e.g., LPXTA (SEQ ID NO: 2) or LPSTS (SEQ ID NO: 106) may be used.
  • Agents that can be conjugated to cell surfaces via sortagging can be any molecule, entity, or moiety, including, but are not limited to a protein, an amino acid, a peptide, a polynucleotide, a carbohydrate, a detectable label, a binding agent, a tag, a mptal n ⁇ nm n rnntrnct aopnt a p.ntnlvet fi a recognition element, a lipid, a linker, or chemical compound, such as a small molecule.
  • the agent is a binding agent, for example, a ligand or a ligand-binding molecule such as streptavidin/biotin, and an antibody or an antibody fragment.
  • the agent when it is a polypeptide, it can be conjugated directly to a cell expressing a sortaggable surface protein in the presence of a sortase.
  • protein protein
  • peptide and “polypeptide” are used interchangeably herein, and refer to a polymer of amino acid residues linked together by peptide (amide) bonds.
  • the terms refer to a protein, peptide, or polypeptide of any size, structure, or function.
  • a protein, peptide, or polypeptide will be at least three amino acids Ions.
  • a nrotein. nentide. or nolvnentide rnav refer to an individual protein or a collection of proteins.
  • One or more of the amino acids in a protein, peptide, or polypeptide may be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modification, etc.
  • a protein, peptide, or polypeptide may also be a single molecule or may be a multi-molecular complex.
  • a protein, peptide, or polypeptide may be just a fragment of a naturally occurring protein or peptide.
  • a protein, peptide, or polypeptide may be naturally occurring, recombinant, or synthetic, or any combination thereof.
  • a protein to be conjugated to cell surfaces by the conjugation methods described herein can be any protein having a desired bioactivity, e.g., diagnostic or therapeutic.
  • the protein is a protein drug ⁇ e.g., an antibody or a fragment thereof), a peptide capable of targeting a specific type of cells (e.g., disease cells such as cancer cells), or an immunogenic peptide capable of eliciting desired immune responses (e.g., B cell responses or T cell responses).
  • a protein can also be a protein-based binding agent, e.g., streptavidin.
  • the target protein comprises or consists of a polypeptide that is at least 80%, or at least 90%, e.g., at least 95%, 86%, 97%, 98%, 99%, 99.5%, or 100% identical to a naturally occurring protein or polypeptide.
  • the target protein has no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid differences relative to a naturally occurring sequence.
  • the naturally occurring protein is a mammalian protein, e.g., of human origin.
  • antibody refers to a protein belonging to the
  • immunoglobulin superfamily The terms antibody and immunoglobulin are used.
  • mammalian antibodies are typically made of basic structural units each with two large heavy chains and two small light chains.
  • antibody heavy chains There are several different types of antibody heavy chains, and several different kinds of antibodies, which are grouped into different isotypes based on which heavy chain they possess.
  • Five different antibody isotypes are known in mammals, IgG, IgA, IgE, IgD, and IgM, which perform different roles, and help direct the appropriate immune response for each different type of foreign object they encounter.
  • an antibody is an IgG antibody, e.g., an antibody of the IgGl, 2, 3, or 4 human subclass.
  • Antibodies from mammalian species are within the scope of the term, as are antibodies from non-mammalian species (e.g. , from birds, reptiles, amphibia) are also within the scope of the term, e.g., IgY antibodies.
  • Suitable antibodies and antibody fragments for use in the context of some embodiments of the present invention include, for example, human antibodies, humanized antibodies, domain antibodies, F(ab'), F(ab')2, Fab, Fv, Fc, and Fd fragments, antibodies in which the Fc and/or FR and/or CDR1 and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; antibodies in which the FR and/or CDR1 and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; antibodies in which the FR and/or CDR1 and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; and antibodies in which the FR and/or CDR1 and/or CDR2 regions have been replaced by homologous human or non-human sequences.
  • single chain antibodies e.g., ScFv
  • single domain antibodies camelid and camelized antibodies and fragments thereof, for example, VHH domains, or nanobodies, such as those described in patents and published patent applications of Ablynx NV and Domantis are also encompassed in the term antibody.
  • a single domain antibody may consist of a single monomeric variable antibody domain and is capable of specifically binding to an antigen.
  • chimeric antibodies e.g., antibodies comprising two antigen-binding domains that bind to different antigens, are also suitable for use in the context of some embodiments of the present invention.
  • antigen-binding antibody fragment refers to a fragment of an antibody that comprises the paratope, or a fragment of the antibody that binds to the antigen the antibody binds to, with similar specificity and affinity as the intact antibody.
  • Antibodies e.g., fully human monoclonal antibodies, may be identified using phage display (or other display methods such as yeast display, ribosome display, bacterial display).
  • Display libraries e.g., phage display libraries, are available (and/or can be generated by one of ordinary skill in the art) that can be screened to identify an antibody that binds to an antigen of interest, e.g., using panning. See, e.g., Sidhu, S. (ed.) Phage Display in Biotechnology and
  • Drug Discovery Drug Discovery Series; CRC Press; 1st ed., 2005; Aitken, R. (ed.) Antibody Phage Display: Methods and Protocols (Methods in Molecular Biology) Humana Press; 2nd ed., 2009.
  • Exemplary antibodies include, but are not limited to, Abciximab (glycoprotein Ilb/IIIa; cardiovascular disease), Adalimumab (TNF- , various auto-immune disorders, e.g., rheumatoid arthritis), Alemtuzumab (CD52; chronic lymphocytic leukemia), Basiliximab (IL- 2Ra receptor (CD25); transplant rejection), Bevacizumab (vascular endothelial growth factor A; various cancers, e.g., colorectal cancer, non-small cell lung cancer, glioblastoma, kidney cancer; wet age-related macular degeneration), Catumaxomab, Cetuximab (EGF receptor, various cancers, e.g., colorectal cancer, head and neck cancer), Certolizumab (e.g.,
  • Certolizumab pegol (TNF alpha; Crohn's disease, rheumatoid arthritis), Daclizumab (IL-2Ra receptor (CD25); transplant rejection), Eculizumab (complement protein C5; paroxysmal nocturnal hemoglobinuria), Efalizumab (CD1 la; psoriasis), Gemtuzumab (CD33; acute myelogenous leukemia (e.g., with calicheamicin)), Ibritumomab tiuxetan (CD20; Non- Hodgkin lymphoma (e.g., with yttrium-90 or indium- 11 1)), Infliximab (TNF alpha; various autoimmune disorders, e.g., rheumatoid arthritis) Muromonab-CD3 (T Cell CD3 receptor; transplant rejection), Natalizumab (alpha-4 (a4) integrin; multiple sclerosis, Crohn's disease
  • Panitumumab (EGF receptor; cancer, e.g., colorectal cancer), Ranibizumab (vascular endothelial growth factor A; wet age-related macular degeneration) Rituximab (CD20; Non-Hodgkin lymphoma), Tositumomab (CD20; Non- Hodgkin lymphoma), Trastuzumab (ErbB2; breast cancer), and any antigen-binding fragment thereof.
  • EGF receptor cancer
  • Ranibizumab vascular endothelial growth factor A; wet age-related macular degeneration
  • Rituximab CD20; Non-Hodgkin lymphoma
  • Tositumomab CD20; Non- Hodgkin lymphoma
  • Trastuzumab ErbB2; breast cancer
  • any antigen-binding fragment thereof any antigen-binding fragment thereof.
  • binding agent refers to any molecule that binds another molecule with high affinity. In some embodiments, a binding agent binds its binding partner with high specificity. Examples for binding agents include, without limitation, antibodies, antibody fragments, receptors, ligands, aptamers, and adnectins.
  • the protein of interest to be conjugated to red blood cells is a cytokine, e.g., a type I cytokine.
  • the target protein is a four-helix bundle protein, e.g., a four-helix bundle cytokine.
  • Exemplary four- helix bundle cytokines include, e.g., certain interferons (e.g., a type I interferon, e.g., IFN-a), interleukins (e.g., IL-2, IL -3, IL-4, IL-5, IL-6, IL-7, IL-12), and colony stimulating factors (e.g., G-CSF, GM-CSF, M-CSF).
  • the IFN can be, e.g., interferon alpha 2a or interferon alpha 2b. See, e.g., Mott HR and Campbell ID. "Four-helix bundle growth factors and their receptors: protein-protein interactions.” Curr Opin Struct Biol. 1995 Feb;5(l): 114-21 ;
  • the protein of interest may also be a cytokine protein that has a similar structure to one or more of the afore-mentioned cytokines.
  • the cytokine can be an IL-6 class cytokine such as leukemia inhibitory factor (LIF) or oncostatin M.
  • LIF leukemia inhibitory factor
  • LIF leukemia inhibitory factor
  • M oncostatin M.
  • the cytokine is one that in nature binds to a receptor that comprises a GP130 signal transducing subunit.
  • Other four-helix bundle proteins of interest include growth hormone (GH), prolactin (PRL), and placental lactogen.
  • the target protein is an erythropoiesis stimulating agent, e.g., (EPO), which is also a four-helix bundle cytokine.
  • EPO erythropoiesis stimulating agent
  • an erythropoiesis stimulating agent is an EPO variant, e.g., darbepoetin alfa, also termed novel erythropoiesis stimulating protein (NESP), which is engineered to contain five N-linked carbohydrate chains (two more than recombinant HuEPO).
  • the protein comprises five helices.
  • the protein can be an interferon beta, e.g., interferon beta- la or interferon beta- lb, which (as will be appreciated) is often classified as a four-helix bundle cytokine.
  • a target protein is IL-9, IL-10, IL-11, IL-13, or IL-15. See, e.g., Hunter, CA, Nature Reviews Immunology 5, 521-531, 2005, for discussion of certain cytokines. See also Paul, WE (ed.), Fundamental Immunology, Lippincott Williams & Wilkins; 6th ed., 2008. Any protein described in the references cited herein, all of which are incorporated herein by reference, can be used as a target protein.
  • the protein of interest may be a protein that is approved by the US Food & Drug Administration (or an equivalent regulatory authority such as the European Medicines Evaluation Agency) for use in treating a disease or disorder in humans. Such proteins may or may not be one for which a PEGylated version has been tested in clinical trials and/or has been approved for marketing.
  • the protein of interest may also be a neurotrophic factor, i.e., a factor that promotes survival, development and/or function of neural lineage cells (which term as used herein includes neural progenitor cells, neurons, and glial cells, e.g., astrocytes, oligodendrocytes, microglia).
  • the target protein is a factor that promotes neurite outgrowth.
  • the protein is ciliary neurotrophic factor (CNTF; a four-helix bundle protein) or an analog thereof such as Axokine, which is a modified version of human Ciliary neurotrophic factor with a 15 amino acid truncation of the C terminus and two amino acid substitutions, which is three to five times more potent than CNTF in in vitro and in vivo assays and has improved stability properties.
  • CNTF ciliary neurotrophic factor
  • Axokine an analog thereof
  • human Ciliary neurotrophic factor with a 15 amino acid truncation of the C terminus and two amino acid substitutions, which is three to five times more potent than CNTF in in vitro and in vivo assays and has improved stability properties.
  • the protein of interest is a protein that forms homodimers or heterodimers, (or homo- or heterooligomers comprising more than two subunits, such as tetramers).
  • the homodimer, heterodimer, or oligomer structure is such that a terminus of a first subunit is in close proximity to a terminus of a second subunit.
  • an N-terminus of a first subunit is in close proximity to a C-terminus of a second subunit.
  • the homodimer, heterodimer, or oligomer structure is such that a terminus of a first subunit and a terminus of a second subunit are not involved in interaction with a receptor, so that the termini can be joined via a non-genetically encoded peptide element without significantly affecting biological activity.
  • termini of two subunits of a homodimer, heterodimer, or oligomer are conjugated via click chemistry using a method described herein, thereby producing a dimer (or oligomer) in which at least two subunits are covalently joined.
  • the neurotrophins nerve growth factor NEF
  • brain-derived neurotrophic factor BDNF
  • neurotrophin 3 NT3
  • neurotrophin 4 NT4
  • the dimeric protein is a cytokine, e.g. , an interleukin.
  • the protein of interest is an enzyme, e.g., an enzyme that is important in metabolism or other physiological processes.
  • deficiencies of enzymes or other proteins can lead to a variety of disease.
  • diseases include diseases associated with defects in carbohydrate metabolism, amino acid metabolism, organic acid metabolism, porphyrin metabolism, purine or pyrimidine metabolism, lysosomal storage disorders, blood clotting, etc. Examples include Fabry disease, Gaucher disease, Pompe disease, adenosine deaminase deficiency, asparaginase deficiency, porphyria, hemophilia, and hereditary angioedema.
  • a protein is a clotting or coagulation factor,(e.g., factor VII, Vila, VIII or IX).
  • a protein is an enzyme that plays a role in carbohydrate metabolism, amino acid metabolism, organic acid metabolism, porphyrin metabolism, purine or pyrimidine metabolism, and/or lysosomal storage, wherein exogenous administration of the enzyme at least in part alleviates the disease.
  • the protein of interest may be a receptor or receptor fragment (e.g., extracellular domain).
  • the receptor is a TNFoc receptor.
  • the target protein comprises urate oxidase.
  • the protein of interest is an antigenic protein, which may derive from a pathogen (e.g., a virus or bacterium).
  • An antigenic protein may be naturally occurring or synthetic in various embodiments. It may be naturally produced by and/or comprises a polypeptide or peptide that is genetically encoded by a pathogen, an infected cell, or a neoplastic cell (e.g., a cancer cell).
  • the antigenic protein is an autoantigen ("self antigen"), that has the capacity to initiate or enhance an autoimmune response.
  • the antigenic protein is produced or genetically encoded by a virus, bacteria, fungus, or parasite which, in some embodiments, is a pathogenic agent.
  • an agent e.g., virus, bacterium, fungus, parasite infects and, in some embodiments, causes disease in, at least one mammalian or avian species, e.g., human, non- human primate, bovine, ovine, equine, caprine, and/or porcine species.
  • mammalian or avian species e.g., human, non- human primate, bovine, ovine, equine, caprine, and/or porcine species.
  • a pathogen is intracellular during at least part of its life cycle. In some embodiments, a pathogen is extracellular.
  • an antigen that originates from a particular source may, in various embodiments, be isolated from such source, or produced using any appropriate means (e.g., recombinantly, synthetically, etc.), e.g., for purposes of using the antigen, e.g., to identify, generate, test, or use an antibody thereto).
  • An antigen may be modified, e.g., by conjugation to another molecule or entity (e.g. , an adjuvant), chemical or physical denaturation, etc.
  • an antigen is an envelope protein, capsid protein, secreted protein, structural protein, cell wall protein or polysaccharide, capsule protein or polysaccharide, or enzyme.
  • an antigen is a toxin, e.g., a bacterial toxin.
  • Retroviridae e.g., lentiviruses such as human immunodeficiency viruses, such as HIV-I
  • Caliciviridae e.g. strains that cause
  • Togaviridae e.g., equine encephalitis viruses, rubella viruses
  • Flaviridae e.g. dengue viruses, encephalitis viruses, yellow fever viruses, hepatitis C virus
  • Coronaviridae e.g. coronaviruses
  • Rhabdoviridae e.g. vesicular stomatitis viruses, rabies viruses
  • Filoviridae e.g. Ebola viruses
  • Paramyxoviridae e.g. parainfluenza viruses, mumps virus, measles virus, respiratory syncytial virus
  • Orthomyxoviridae e.g. influenza viruses
  • Bunyaviridae e.g.
  • Papovaviridae papilloma viruses, polyoma viruses
  • Adenoviridae papilloma viruses, polyoma viruses
  • Herpesviridae herpes simplex virus (HSV) 1 and 2, varicella zoster virus, cytomegalovirus (CiviV), EBV, KSV); Poxviridae (variola viruses, vaccinia viruses, pox viruses); and Picomaviridae (e.g. polio viruses, hepatitis A virus; enteroviruses, human coxsackie viruses, rhinoviruses, echoviruses).
  • Exemplary bacteria include, e.g., Helicobacter pylori, Borellia burgdorferi,
  • Legionella pneumophilia Mycobacteria (e.g., M. tuberculosis, M. avium, M, intracellulare, M. kansasii, M. gordonae), Staphylococcus aureus, Neisseria gonorrhoeae, Neisseria meningitidis, Listeria monocytogenes, Streptococcus pyogenes (Group A Streptococcus), Streptococcus agalactiae (Group B Streptococcus), Streptococcus (viridans group), Streptococcus faecalis, Streptococcus bovis, Streptococcus (anaerobic sps.), Streptococcus pneumoniae, Campylobacter sp., Enterococcus sp., Chlamydia sp., Haemophilus influenzae, Bacillus anthracis,
  • Exemplary fungi include, e.g., Aspergillus, such as Aspergillus flavus, Aspergillus fumigatus, Aspergillus niger, Blastomyces, such as Blastomyces dermatitidis, Candida, such as Candida albicans, Candida glabrata, Candida guilliermondii, Candida krusei, Candida parapsilosis, Candida tropicalis, Coccidioides, such as Coccidioides immitis, Cryptococcus, such as Cryptococcus neoformans, Epidermophyton, Fusarium, Histoplasma, such as Histoplasma capsulatum, Malassezia, such as Malassezia furfur, Microsporum, Mucor, Paracoccidioides, such as Paracoccidioides brasiliensis, Penicillium, such as Penicillium marneffei, Pichia, such as Pichia anomala, Pichia guilliermondii, Pneu
  • Trichosporon such as Trichosporon asahii, Trichosporon cutaneum, Trichosporon inkin, and Trichosporon mucoides.
  • an antigen is a tumor antigen (TA).
  • TA tumor antigen
  • a tumor antigen can be any antigenic substance produced by tumor cells (e.g., tumorigenic cells or in some embodiments tumor stromal ceils, e.g., tumor-associated cells such as cancer-associated fibroblasts).
  • a tumor antigen is a molecule (or portion thereof) that is differentially expressed by tumor cells as compared with non-tumor cells.
  • Tumor antigens may include, e.g., proteins that are normally produced in very small quantities and are expressed in larger quantities by tumor cells, proteins that are normally produced only in certain stages of development, proteins whose structure (e.g., sequence or post-translational modification(s)) is modified due to mutation in tumor cells, or normal proteins that are (under normal conditions) sequestered from the immune system.
  • Tumor antigens may be useful in, e.g., identifying or detecting tumor cells (e.g., for purposes of diagnosis and/or for purposes of monitoring subjects who have received treatment for a tumor, e.g., to test for recurrence) and/or for purposes of targeting various agents (e.g., therapeutic agents) to tumor cells.
  • a chimeric antibody comprising an antibody of antibody fragment that binds a tumor antigen, and conjugated via click chemistry to a therapeutic agent, for example, a cytotoxic agent.
  • a TA is an expression product of a mutated gene, e.g., an oncogene or mutated tumor suppressor gene, an overexpressed or aberrantly expressed cellular protein, an antigen encoded by an oncogenic virus (e.g., HBV; HCV; herpesvirus family members such as EBV, KSV;
  • an oncogenic virus e.g., HBV; HCV; herpesvirus family members such as EBV, KSV;
  • Oncofetal antigens are normally produced in the early stages of embryonic development and largely or completely disappear by the time the immune system is fully developed. Examples are alphafetoprotein (AFP, found, e.g., in germ cell tumors and hepatocellular carcinoma) and carcinoembryonic antigen (CEA, found, e.g., in bowel cancers and occasionally lung or breast cancer).
  • AFP alphafetoprotein
  • CEA carcinoembryonic antigen
  • Tyrosinase is an example of a protein normally produced in very low quantities but whose production is greatly increased in certain tumor cells (e.g., melanoma cells).
  • exemplary TAs include, e.g., CA-125 (found, e.g., in ovarian cancer); MUC-1 (found, e.g., in breast cancer); epithelial tumor antigen (found, e.g., in breast cancer); melanoma-associated antigen (MAGE; found, e.g., in malignant melanoma); prostatic acid phosphatase (PAP, found in prostate cancer),.
  • a TA is at least in part exposed at the cell surface of tumor cells.
  • a tumor antigen comprises an abnormally modified polypeptide or lipid, e.g., an aberrantly modified cell surface glycolipid or glycoprotein. It will be appreciated that a TA may be expressed by a subset of tumors of a particular type and/or by a subset of cells in a tumor.
  • TKLT (SEQ ID NO: 6)
  • SRLRSHINPTGTVLLQLENTM (SEQ ID NO: 9)
  • arylsulfatase-A (iduronidase, a-L-) THYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLG
  • PALQICCHPGCTPRPACCHCP SEQ ID NO: 10.
  • arylsulfatase B N-acetylgalactos-amine- YLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLW 4-sulfatase (lfsu) NNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVG
  • beta-hexosaminidase A (2gjx) LRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPV
  • TNF-beta (lymphotoxin) (ltnr) SGIYFVYSQVVFSG AYSPKATSSPLYLAHEVQLFSSQYPFHV
  • Insulin Chain B FVNQHLCGSHLVEALYLVCGERGFFYTPK (SEQ ID NO:
  • G Growth hormone
  • FSH Follicle-stimulating hormone
  • Insulin-like growth factor or PETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGI somatomedin (Iwqj) VDECCFRSCDLRRLEMYCAP (SEQ ID NO: 34)
  • Chain B VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQR
  • any of the proteins of interest as described herein may be modified, which may comprise (i) one or more nucleophilic residues such as glycine at the N-terminus (e.g., between 1 and 10 residues) and, optionally, a cleavage recognition sequence, e.g., a protease cleavage recognition sequence that masks the nucleophilic residue(s); or (ii) a sortase recognition motif at or near the C-terminus.
  • the target protein comprises both (i) and (ii).
  • modified proteins can be used in the methods of protein conjugation as described herein.
  • proteins e.g., secreted eukaryotic (e.g., mammalian) proteins
  • intracellular processing e.g., cleavage of a secretion signal prior to secretion and/or removal of other portion(s) that are not required for biological activity
  • Such mature, biologically active versions of target proteins are used in certain embodiments of the present disclosure.
  • proteins of interest may be found in, e.g., USSN 10/773,530; 1 1/531,531;
  • Non-protein agents include, but are not limited to a lipid, a carbohydrate, a small molecule such as a click chemistry handle or a chemotherapeutic agent, a detectable label (e.g. , an imaging agent), or a chemotherapeutic agent. Additional agents suitable for use in
  • the non-protein agent is antigenic such that it can elicit immune responses.
  • antigenic agents may comprise, for example, a polysaccharide, a
  • carbohydrate a lipid, a nucleic acid, or combination thereof, and may derived from a pathogen, e.g., those described herein.
  • conjugated refers to an association of two molecules, for example, two proteins or a protein and an agent, e.g., a small molecule, with one another in a way that they are linked by a direct or indirect covalent or non-covalent interaction.
  • agent e.g., a small molecule
  • the association is covalent, and the entities are said to be “conjugated” to one another.
  • a protein is post-translationally conjugated to another molecule, for example, a second protein, a small molecule, a detectable label, a click chemistry handle, or a binding agent, by forming a covalent bond between the protein and the other molecule after the protein has been formed, and, in some embodiments, after the protein has been isolated.
  • two molecules are conjugated via a linker connecting both molecules.
  • the two proteins may be conjugated via a polypeptide linker, e.g., an amino acid sequence connecting the C-terminus of one protein to the N-terminus of the other protein.
  • two proteins are conjugated at their respective C-termini, generating a C-C conjugated chimeric protein. In some embodiments, two proteins are conjugated at their respective N-termini, generating an N-N conjugated chimeric protein. In some embodiments, conjugation of a protein to a peptide is achieved by transpeptidation using a sortase. See, e.g., Ploegh et al., International PCT Patent Application, PCT7US2010/000274, filed February 1, 2010, published as
  • click chemistry does not refer to a specific reaction, but to a concept including, but not limited to, reactions that mimic reactions found in nature.
  • click chemistry reactions are modular, wide in scope, give high chemical yields, generate inoffensive byproducts, are stereospecific, exhibit a large thermodynamic driving force > 84 kJ/mol to favor a reaction with a single reaction product, and/or can be carried out under physiological conditions.
  • a click chemistry reaction exhibits high atom economy, can be carried out under simple reaction conditions, use readily available starting materials W
  • a click chemistry handle can be a reactant, or a reactive group, that can partake in a click chemistry reaction.
  • a strained alkyne e.g., a cyclooctyne
  • click chemistry reactions require at least two molecules comprising click chemistry handles that can react with each other.
  • click chemistry handle pairs that are reactive with each other are sometimes referred to herein as partner click chemistry handles.
  • an azide is a partner click chemistry handle to a cyclooctyne or any other alkyne.
  • click chemistry handles suitable for use according to some aspects of this invention are described herein, for example, in Tables A and B.
  • Other suitable click chemistry handles are known to those of skill in the art.
  • the click chemistry handles of the molecules have to be reactive with each other, for example, in that the reactive moiety of one of the click chemistry handles can react with the reactive moiety of the second click chemistry handle to form a covalent bond.
  • Such reactive pairs of click chemistry handles are well known to those of skill in the art and include, but are not limited to, those described in Table 2:
  • R, Rl, and R2 may represent any molecule comprising a sortase recognition motif.
  • each ocurrence of R, Rl, and R2 is independently RR-LPXT (SEQ ID NO: 50)-[X]y-, or - [X]y-LPXT (SEQ ID NO: 50)-RR, wherein each occurrence of X independently represents any amino acid residue, each occurrence of y is an integer between 0 and 10, inclusive, and each occurrence of RR independently represents a protein or an agent (e.g., a protein, peptide, a detectable label, a binding agent, a small molecule, etc.), and, optionally, a linker.
  • a protein or an agent e.g., a protein, peptide, a detectable label, a binding agent, a small molecule, etc.
  • click chemistry handles are used that can react to form
  • click chemistry handles are well known to those of skill in the art and include the click chemistry handles described in Becer, Hoogenboom, and Schubert, Click Chemistry beyond Metal-Catalyzed Cycloaddition,
  • N 2 is the only by-product
  • a detectable label is a moiety that has at least one element, isotope, or functional group incorporated into the moiety which enables detection of the molecule, e.g., a protein or peptide, or other entity, to which the label is attached.
  • Labels can be directly attached (i.e., via a bond) or can be attached by a linker (such as, for example, an optionally substituted alkylene; an optionally substituted alkenylene; an optionally substituted alkynylene; an optionally substituted heteroalkylene; an optionally substituted heteroalkenylene; an optionally substituted heteroalkynylene; an optionally substituted arylene; an optionally substituted heteroarylene; or an optionally substituted acylene, or any combination thereof, which can make up a linker).
  • a linker such as, for example, an optionally substituted alkylene; an optionally substituted alkenylene; an optionally substituted alkynylene; an optionally substituted heteroalkylene; an optionally substituted heteroalkenylene; an optionally substituted heteroalkynylene; an optionally substituted arylene; an optionally substituted heteroarylene; or an optionally substituted acylene, or any combination thereof, which can make up a linker
  • a detectable label can fall into any one (or more) of five classes: a) a label which contains isotopic moieties, which may be radioactive or heavy isotopes, including, but not limited to, 2H, 3H, 13C, 14C, 15N, 18F, 31P, 32P, 35S, 67Ga, 76Br,
  • a label which contains an immune moiety which may be antibodies or antigens, which may be bound to enzymes (e.g., such as horseradish peroxidase);
  • a label which is a colored, luminescent, phosphorescent, or fluorescent moieties e.g., such as the fluorescent label fluorescein- isothiocyanate (FITC);
  • FITC fluorescent label fluorescein- isothiocyanate
  • a label which has one or more photo affinity moieties and e) a label which is a ligand for one or more known binding partners (e.g., biotin-streptavidin,
  • a label comprises a radioactive isotope, preferably an isotope which emits detectable particles, such as ⁇ particles.
  • the label comprises a fluorescent moiety.
  • the label is the fluorescent label fluorescein-isothiocyanate (FITC).
  • the label comprises a ligand moiety with one or more known binding partners.
  • the label comprises biotin.
  • a label is a fluorescent polypeptide (e.g., GFP or a derivative thereof such as enhanced GFP (EGFP)) or a luciferase (e.g., a firefly, Renilla, or
  • a label may react with a suitable substrate (e.g. , a luciferin) to generate a detectable signal.
  • suitable substrate e.g. , a luciferin
  • fluorescent proteins include GFP and derivatives thereof, proteins comprising fluorophores that emit light of different colors such as red, yellow, and cyan fluorescent proteins.
  • Exemplary fluorescent proteins include, e.g., Sirius, Azurite, EBFP2, TagBFP, mTurquoise, ECFP, Cerulean, TagCFP, mTFPl , mUkGl, mAGl , AcGFPl, TagGFP2,
  • a label comprises a dark quencher, e.g., a substance that absorbs excitation energy from a fluorophore and dissipates the energy as heat.
  • Small molecule refer to molecules, whether naturally-occurring or artificially created (e.g., via chemical synthesis) that have a relatively low molecular weight.
  • a small molecule is an organic compound (i.e., it contains carbon).
  • a small molecule may contain multiple carbon-carbon bonds, stereocenters, and other functional groups (e.g., amines, hydroxyl, carbonyls, heterocyclic rings, etc.).
  • small molecules are monomeric and have a molecular weight of less than about 1500 g/mol. In certain embodiments, the molecular weight of the small molecule is less than about 1000 g/mol or less than about 500 g/mol.
  • the small molecule is a drug, for example, a drug that has already been deemed safe and effective for use in humans or animals by the appropriate governmental agency or regulatory body.
  • any of the non-protein agent described herein can be conjugated to a protein backbone via methods known to those skilled in the art.
  • the transpeptidation reaction catalyzed by sortase results in the conjugation of a first protein containing a C-terminal sortase recognition motif, e.g., LPXTX (SEQ ID NO: 80; wherein each occurrence of X independently represents any amino acid residue), with a second protein comprising an N-terminal sortase acceptor peptide, e.g., one or more N- terminal glycine residues.
  • the sortase recognition motif is a sortase recognition motif described herein.
  • the sortase recognition motif is LPXT (SEQ ID NO: 50) motif or LPXTG (SEQ ID NO: 1).
  • the sortase transacylation reaction provides means for efficiently linking an acyl donor with a nucleophilic acyl acceptor. This principle is widely applicable to many acyl donors and a multitude of different acyl acceptors.
  • the sortase reaction was employed for ligating proteins and/or peptides to one another, ligating synthetic peptides to recombinant proteins, linking a reporting molecule to a protein or peptide, joining a nucleic acid to a protein or peptide, conjugating a protein or peptide to a solid support or polymer, and linking a protein or peptide to a label.
  • Sortase-mediated transpeptidation reactions also sometimes referred to as Sortase-mediated transpeptidation reactions
  • transacylation reactions are catalyzed by the transamidase activity of sortase, which forms a peptide linkage (an amide linkage), between an acyl donor compound and a nucleophilic acyl acceptor containing an NH2-CH2-moiety.
  • sortase employed to carry out a sortase-mediated transpeptidation reaction is sortase A (SrtA).
  • SertA sortase A
  • any sortase, or transamidase, catalyzing a transacylation reaction can be used in some embodiments of this invention, as the invention is not limited to the use of sortase A.
  • an agent of interest e.g., a protein or a non-protein agent conjugated to a protein backbone
  • an agent of interest can be ligated to the surface of a cell expressing sortaggable surface protein by contacting the protein agent or protein backbone to which an agent of interest is conjugated with the cell under suitable conditions allowing for occurrence of the
  • the agent of interest can be incubated with a sortase first under suitable conditions for a suitable period of time allowing for cleavage at the sortase recognition site. The mixture is then in contact with the cells under suitable conditions such that the agent of interest is conjugated to the surface sortaggable protein on the cells.
  • the cell such as a CD4+ progenitor cell or an enucleated red blood cell, expresses a fusion protein that comprises a sortase recognition motif at the C-terminus
  • the cell expresses a fusion protein comprising a membrane protein and an acceptor peptide (e.g., a glycine polymer) fused to the N-terminus of the membrane protein W
  • a protein to be conjugated with the cell- surface fusion protein comprises a sortase recognition motif as described above at the C- terminal and can be conjugated to the N-terminus of the surface fusion protein.
  • sortase recognition motif included either in the surface sortaggable protein on the cells or in the protein to be conjugated to the surface protein. This is well within the knowledge of those skilled in the art. See, e.g., descriptions above regarding recognition sites for various sortases.
  • CD34+ or enucleated red blood cells derived therefrom can express a plurality of different surface sortaggable proteins (e.g., 2, 3, or more).
  • specific modification of one or more of the plurality of surface sortaggable proteins involves the use of different sortases, each specifically recognizing a different sortase recognition motif included in the one or more sortaggable proteins.
  • a first sortaggable protein can be modified with SrtA au reus> recognizing the C-terminal sortase recognition motif LPETGG (SEQ ID NO: 107) and the N-terminal sortase recognition motif (G)n
  • a second sortaggable can be modified with SrtA py o g enes, recognizing the C-terminal sortase recognition motif LPETAA (SEQ ID NO: 108) and the N-terminal sortase recognition motif (A) n .
  • the sortases in this example recognize their respective recognition motif but do not recognize the other sortase recognition motif to a significant extent, and, thus, "specifically" recognize their respective recognition motif.
  • a sortase binds a sortase recognition motif specifically if it binds the motif with an affinity that is at least 5-fold, 10-fold, 20-fold, 50-fold, 100-fold, 200-fold, 500-fold, 1000-fold, or more than 1000-fold higher than the affinity that the sortase binds a different motif
  • orthogonal sortases and their respective recognition motifs e.g., of the orthogonal sortase A enzymes SrtA aureus and SrtA py o g enes, can be used to site-specifically conjugate two different moieties onto two different surface sortaggable proteins.
  • sortagging of a plurality of different proteins is achieved by sequentially contacting a cell comprising the different sortaggable surface proteins with a first sortase recognizing a sortase recognition motif of a first sortaggable protein and a suitable first protein of interest, and then with a second sortase recognizing a sortase recognition motif of a second sortaggable protein and a second protein of interest, and so forth.
  • the cell may be contacted with a plurality of sortases in parallel, for example, with a first sortase recognizing a sortase recognition motif of a first sortaggable protein and a suitable first protein of interest, and with a second sortase recognizing a sortase recognition motif of a second target protein and a second protein of interest, and so forth.
  • a first sortaggable protein e.g., a type I transmembrane protein fused to an oligoglycine
  • sortase A is modified using sortase A from
  • Staphylococcus aureus (SrtA aU reus), and a second sortaggable protein, e.g., a type II transmembrane protein fused to a suitable sortase recognition motif, is modified using sortase A from Streptococcus pyogenes (SrtA py0 genes)- SrtA aureU s recognizes the motif LPXTG (SEQ ID NO: 1), in which X is any amino acid residue, and uses oligoglycine as the acceptor peptide.
  • SrtA py0 g en e S recognizes the motif LPXTA (SEQ ID NO: 2), in which X is any amino acid residue, and uses oligoalanine as the acceptor peptide.
  • sortases that recognize sufficiently different sortase recognition motifs with sufficient specificity are suitable for sortagging of a plurality of sortaggable proteins expressed on red blood cells.
  • the respective sortase recognition motifs can be inserted into the sortaggable proteins or the proteins to be conjugated to the sortaggable proteins using recombinant technologies known to those of skill in the art.
  • suitable sortase recognition motifs may be present in a wild type membrane protein.
  • a suitable sortase for the conjugation of a given protein may depend on the sequence of the sortaggable protein, e.g., on whether or not the sortaggable protein comprises a sequence at its C-terminus or its N-terminus that can be recognized as a substrate by any known sortase.
  • use of a sortase that recognizes a naturally-occurring C-terminal or N-terminal recognition motif is preferred since further engineering of the target protein can be avoided.
  • any of the genetically modified CD34+ progenitor cells and enucleated red blood cells are within the scope of the present disclosure.
  • Enucleated red blood cells having a surface modification of an agent of interest as , described herein can be administered to a subject in need thereof (e.g., a human patient) for various purposes, e.g., treating a specific disease when the agent of interest is a therapeutic agent, detecting the presence of specific cell types when the agent of interest is capable of recognizing the target cells, and eliciting desired immune responses when the agent of interest is immunogenic.
  • a subject in need thereof e.g., a human patient
  • Any suitable delivery route can be used in the methods described herein, e.g., cell infusion.
  • the red blood cells are delivered to the same subject from which the cells are originally obtained.
  • peripheral blood cells can be obtained from a subject such as human patient, expanded in vitro, genetically modified such that they express sortaggable surface proteins, differentiated into enucleated red blood cells, and conjugated with an agent of interest.
  • the modified enucleated red blood cells can then be administered to the same subject.
  • the CD34 + progenitor cells are obtained from a suitable subject and, after being differentiated and genetically modified as described herein, the resultant enucleated red blood cells are administered to a different subject, which preferably is immunocompatible with the donor (e.g., administration of the enucleated blood cells would not elicit undesirable immune responses).
  • the enucleated red blood ceils can be administered to a subject who has or suspected of having a condition associated with red blood cell deficiency, for example, anemia, blood loss due to surgery or trauma.
  • the enucleated red blood cells can also be administered to a subject in need of a treatment or diagnosis that can be achieved by the agent of interest conjugated on the surface of the enucleated red blood cells.
  • the enucleated red blood cells may be conjugated to an cancer antigen or an antigen derived from a pathogen.
  • Such cells can be delivered to a subject in need (e.g., a human subject having or at risk for cancer or infection by the pathogen) for either preventive or therapeutic treatment.
  • the nucleated red blood cells can be conjugated to an enzyme effective in treating a disease or disorder associated with deficiency of the enzyme, e.g., Fabry disease, Gaucher disease, Pompe disease, adenosine deaminase deficiency, asparaginase deficiency, porphyria, hemophilia, and hereditary angioedema.
  • a disease or disorder associated with deficiency of the enzyme e.g., Fabry disease, Gaucher disease, Pompe disease, adenosine deaminase deficiency, asparaginase deficiency, porphyria, hemophilia, and hereditary angioedema.
  • the enucleated red blood cells carry a clotting or coagulation factor, (e.g. , factor VII, Vila, VIII or IX) and may be delivered to a human subject having or suspected of having conditions associated with abnormal blood clotting or coagulation.
  • a clotting or coagulation factor e.g. , factor VII, Vila, VIII or IX
  • kits useful for the genetic modification and surface modification of red blood cells via sortagging can comprise one or more expression vectors encoding one or more fusion protein each comprising a red blood cell membrane protein and a peptide as described herein. If a kit comprises multiple expression vectors as described, they can include sequences encoding different sortase recognition motifs. In some embodiments, the different sortase recognition motifs are recognized by orthogonal sortases, for example, one by SrtA aureus and another by SrtA P yo g enes-
  • kits described herein can comprise one or more of the medium components for use in the in vitro culturing process for producing enucleated red blood cells, e.g., one or more of the cytokines used therein, and one or more of the media used therein, and/or other components for cell culture.
  • the medium components for use in the in vitro culturing process for producing enucleated red blood cells e.g., one or more of the cytokines used therein, and one or more of the media used therein, and/or other components for cell culture.
  • the kit can comprise one or more suitable sortases.
  • the sortase comprised in the kit recognizes a sortase recognition motif encoded by a nucleic acid comprised in the kit.
  • the sortase is provided in a storage solution and under conditions preserving the structural integrity and/or the activity of the sortase.
  • a plurality of sortases is provided, each recognizing a different sortase recognition motif encoded by the nucleic acid(s).
  • the kit comprises SrtA au reus and/or SrtApy 0 genes-
  • the kit further comprises an agent of interest, e.g., a protein of interest or a protein backbone conjugated with a non-protein agent.
  • an agent of interest e.g., a protein of interest or a protein backbone conjugated with a non-protein agent.
  • the protein of interest or the protein backbone comprises a sortase recognition motif, which may be compatible with the peptide in the fusion protein encoded by a nucleic acid in the kit in that both motifs can partake in a sortase-mediated transpeptidation reaction catalyzed by the same sortase.
  • the kit may also comprise SrtA aureus and a protein of interest or a protein backbone , which will comprise the C-terminal sortase recognition motif.
  • the kit further comprises a buffer or reagent useful for carrying out a sortase-mediated transpeptidation reaction, for example, a buffer or reagent described in the Examples section.
  • Human peripheral blood G-CSF mobilized hematopoietic stem/progenitor cells enriched for CD34+ are purchased from Fred Hutchinson Cancer Research Center (FHCRC), Seattle. Cells are thawed according to the FHCRC protocol.
  • the human CD 34+ (hCD 34+ ) blood cells were differentiated into mature enucleated red blood cells by a method composed of 4 phases in 21 days: (a) Expansion, (b) Differentiation I ("Dif I”), (c) Differentiation II (“Dif II”), and Differentiation III (“Dif III”) illustrated in Figure 1, and described below.
  • the human CD * ⁇ blood cells were cultured in Expansion medium (StemspanSFEM, CCIOO cytokine mix, which includes Flt-3 ligant, SCF, IL-3 and IL-6, and 2% penicillin-streptomycin) at 10 5 cells/mL from Day 1-4. After expansion, cells are subsequently cultured in IMDM-based erythroid differentiation medium supplemented with different cytokines in Dif I, II and III.
  • ExpanSFEM CCIOO cytokine mix, which includes Flt-3 ligant, SCF, IL-3 and IL-6, and 2% penicillin-streptomycin
  • the medium base for all three differentiation phases comprises: IMDM, 15% FBS, 2mM glutamine, 1% BSA, 500 ⁇ g/mL holo human transferrin, 10 ⁇ g mL recombinant human insulin and 2% penicillin-streptomycin.
  • Day 5-9 cells are cultured in Dif I medium, which contains erythroid medium base, 2 ⁇
  • Day 10-13 ceils are grown in Dif II medium containing erythroid medium base, 50 ng/mL SCF and 6U Epo.
  • Day 14-21 cells were cultured in fibronectin-coated plates in Dif III medium, which is erythroid medium base supplemented with 2U Epo. Cell numbers re-seeded in the beginning of Dif I, II and III were 10 5 , 2xl0 5 , and 3xl0 5 /mL, respectively.
  • the red blood cells at various time points during the above-noted 4-phrase process were subjected to Benzidine-Giemsa staining and the cell morphology was observed under a microscope. As shown in Figure 2, decrease of cell sizes was observed upon erythroid maturation and enucleated red blood cells were observed at day 8 of Dif. III. The sizes of the enucleated red blood cells obtained from the 4-phrase method described were found to be similar to those of normal human reticulocytes or red blood cells. Table 4 below.
  • ⁇ Cell Nos. 1-5 Enucleated red blood cells obtained from the differentiation process described above
  • the hemoglobin contents of the red blood cells at Dif I, Dif II, and Dif III were determined by Drabkin's reagent. The results indicate that the enucleated blood cells obtained at the end of the differentiation process is around 30 pg/cell.
  • CD235a Glycophorin A
  • c-Kit c-Kit
  • CD71 CD71
  • Figures 4 and 5 Hoechst and glycophorin A staining indicated that around 40-50% of the red blood cells underwent enucleation at the end of the differentiation process.
  • the study described above indicates that a four-phase hCD 34+ cell culture and differentiation process has been successfully developed. This process yielded about 17,000- 32,000-fold cell expansion (14-15 doubling) after a 21-day culture and around 40-50% of the cells were found to undergo enucleation.
  • the enucleated red blood cells obtained from this culturing process are similar to normal human reticulocytes or normal red blood cells in cell size, hemoglobin content ( ⁇ 30 pg/cell), and cell surface marker expression.
  • RBCs lack a nucleus and at their mature stage cannot be genetically modified.
  • erythroid precursors were genetically engineered to express sortase-modifiable proteins that are retained on the plasma membrane of mature RBCs.
  • sortase-modifiable membrane proteins were expressed in erythroid progenitors, Kell and Glycophorin A (GPA):
  • the blood group antigen Kell is a type II membrane protein with an extracellularly exposed C-terminus and was selected as a target for C-terminal labeling.
  • GPA a type I membrane protein with its N-terminus extracellularly disposed, is the most abundant protein on the RBC surface and was chosen for N-terminal modification.
  • the coding sequences of human, mouse glycophorin A (GPA) and Kell were obtained from NCBI ref sequence NM_002099.6, NM_010369.3, and NM_000420.2, respectively.
  • the Myc-tag coding sequence was obtained from NCBI ref sequence NM_002099.6, NM_010369.3, and NM_000420.2, respectively.
  • GAGAAACTCATCTCAGAAGAGGATCTG SEQ ID NO: 109 was inserted between the signal peptide and the mature GPA for detection of cell surface expression.
  • sortase tag SEQ ID NO: 3
  • three glycine tag coding sequences GGTGGCGGAGGTGGA; SEQ ID NO: 110 or
  • GGTGGCGGA GGTGGCGGA
  • LPETGGHHHHHH SEQ ID NO: 115
  • GPA N-terminus with biotin 30 ⁇ of 500 ⁇ S. aureus sortase, 1 mM K(biotin)LPRTGG (SEQ ID NO: 116) peptide in 83 mM Tris-HCl pH 7.5, 250 mM NaCl buffer was pre-incubated on ice for 15 minutes and added to 70 ⁇ of ⁇ lxlO 6 cultured cells (reticulocytes or HEK293T cells) or up to 5x10 7 red blood cells (10 ⁇ of whole blood) in DMEM (pre-washed with DMEM).
  • DMEM pre-washed with DMEM
  • VHH-LPETG-His6 SEQ ID NO: 1266
  • 50 mM Tris-HCl pH 7.5, 150 mM NaCl buffer was pre-incubated on ice for 15 minutes and added to 50 ⁇ of up to 5x10 7 red blood cells in DMEM.
  • Kell C-terminus with biotin 30 ⁇ of 500 ⁇ S.
  • aureus sortase 1.4 mM GGGK(biotin) (SEQ ID NO: 47) peptide in 83 mM Tris-HCl pH 7.5, 250 mM NaCl buffer was added to 70 ⁇ of ⁇ 1x106 cultured cells (reticulocytes or HEK293T cells) or up to 5x107 red blood cells in DMEM (pre-washed with DMEM). All sortase and cell mixtures were incubated on ice for 30 minutes with occasional gentle mixing. They were spun at 2000 RPM for 2 minutes at 4 °C to remove buffer/DMEM and washed 3 times with 1 ml of ice-cold PBS.
  • red blood were first lysed with 500 ⁇ of ammonium chloride solution (Stemcell Technologies) via a 5 minute incubation on ice and spun down at 14000 RPM for 10 minutes at 4 °C.
  • Membranes were washed once with 500 ⁇ of PBS.
  • Cells were solubilized in 25 mM Tris-HCl pH7.5, 0.5 % NP40, 5 mM MgCl 2 , 150 mM NaCl supplemented with a Complete mini protease inhibitor cocktail tablet (Roche), vortexed, incubated on ice for 10 minutes, and spun at 14,000 RPM for 10 minutes at 4 °C.
  • Virus production Six million 293T cells were split and plated on 10 cm plates one day before transfection in antibiotic free Dulbecco's Modified Eagle Medium (DMEM) with added 15% Fetal Bovine Serum (FBS) and 2 mM L-Glutamine (Invitrogen). On day 0, 10 ug plasmids together with 5 ug packaging vector were added to the 293 T 10-cm plate with Fugene 6 (Promega). Six-eight hours later, new DMEM with added 15% FBS, 2 mM L- Glutamine, and 1 ⁇ Pen Strep (Invitrogen) replaced the old medium. On day 1 , the supernatant containing fresh virus was collected, filtered through 0.45 ⁇ filter (Millipore), and then immediately used to infect the murine erythroid progenitors. GPA & Kell expression:
  • HEK293T cells were plated on 10 cm dish and transfected with either 15 ⁇ g of Gn-myc- h/mGPA constructs in retroviral vectors, or 7.5 ⁇ g of hKell-LPETG (SEQ ID NO: 44)-HA and 7.5 ⁇ g of 3G-myc-hGPA both in retroviral vectors (for sequential dual sortase labeling) using TransIT transfection reagent according to manufacturer's recommendations (Mirus). Cells were analyzed for protein expression and sortase-labeled 24 hours after cellular transfection. (vi) Isolation of erythroid progenitors from murine E14.5 fetal liver cells
  • lineage negative fetal liver cells were prepared at a concentration of 10 million cells per ml. Ten microliters of the cells were plated in each well of a 24-well plate, together with 1 ml virus-containing supernatant with 5 ug/ml polybrene. The plate was spun at 2000 RPM for 90 min at 37 degree.
  • the virus- containing supernatant was aspirated and replaced with erythroid maintenance medium (StemSpan-SFEM (StemCell Technologies) supplemented with recombinant mouse stem cell factor (100 ng/ml SCF, R&D), recombinant mouse IGF-1 (40 ng/ml, R&D), dexamethasone (100 nM, Sigma), and erythropoietin (2 u/ml, Amgen)).
  • erythroid maintenance medium Steml SCF, R&D
  • recombinant mouse IGF-1 40 ng/ml, R&D
  • dexamethasone 100 nM, Sigma
  • erythropoietin 2 u/ml, Amgen
  • Epo-only erythroid differentiation medium Iscove modified Dulbecco's medium (IMDM) containing 15% FBS (Stemcell), 1% detoxified bovine serum albumin (BSA) (Stemcell), 500 ⁇ g/mL holo-transferrin (Sigma- Aldrich), 0.5 U/mL Epo (Amgen), 10 ⁇ g/mL recombinant human insulin (Sigma- Aldrich), 2 mM L-glutamine (Invitrogen), and 1 ⁇ Pen Strep (Invitrogen)) for 48 hours.
  • IMDM Epo-only erythroid differentiation medium
  • FBS FBS
  • BSA bovine serum albumin
  • Amgen 10 ⁇ g/mL recombinant human insulin
  • Invitrogen 2 mM L-glutamine
  • Pen Strep Invitrogen
  • the desired cells washed them once by PBS, and resuspended them at a density of 5- 10 M/ml in PBS with 1 ⁇ g ml PI for FACS sorting or analysis.
  • the cells were first stained with Anti-Mouse TER-119 antibody (eBioscience, 14-5921) and Hoechst (Sigma) for 15 minutes at room temperature.
  • the cells were stained with anti-Myc antibody (Cell signalling, 3739), anti-HA antibody (Thermo Fisher Scientific, NC9843881) or anti-biotin antibody (eBioscience, 12-9895-82), respectively, for 30 minutes at room temperature.
  • anti-Myc antibody Cell signalling, 3739
  • anti-HA antibody Thermo Fisher Scientific, NC9843881
  • anti-biotin antibody eBioscience, 12-9895-82
  • Bone marrow in femur and tibias from C57BL/6J mice was isolated using 23G needle and cultured at density of 2x106 cells/ml for 18 hours in DMEM supplemented with 15% fetal calf serum, 2 mM L-Glutamine (Invitrogen), lx Pen/Strep (Invitrogen), 20 ng/ml IL-3 (Peprotech), 50 ng/ml SCF (Peprotech), and 50 ng/ml IL-6 (Peprotech) in 6-well plates.
  • Cells were infected by incubating 4x106 cells in 500 ⁇ of retrovirus-containing media, 500 ⁇ DMEM, and 5 ⁇ g/ml polybrene and spinning the cells at 2500 RPM for 1.5 hours at room temperature and further incubating them in a C0 2 incubator for 5 hours. Cells were returned to the above IL-3/SCF/IL-6 supplemented media and further incubated for 16 hours.
  • mice B6.SJL-i3 ⁇ 4?rca ep3b/BoyJ mice (The Jackson Lab) were subjected to total body irradiation with 1050 cGy in a Gammacell 40 irradiator chamber 1 day before transplantation.
  • Mouse fetal liver cells were harvested and prepared as mentioned above. Following retroviral infection, cells were cultured in erythroid maintenance media for 18 hours. Alternatively, mouse bone marrow cells were harvested and retrovirus transduced as described above.
  • Infected cells were then washed 2 times in sterile PBS and resuspended in sterile PBS at 2-5 million cells/mL. ⁇ of these mouse stem and progenitor cells were then retro-orbitally injected into the lethally irradiated mice. Starting from four weeks, mature red cells were extracted from the irradiated mice for analysis and sortagging.
  • Lysine coated slides for 5 minutes at 400rpm (Cytospin 3, Thermo Shandon). Samples were air dried, fixed in 4% paraformaldehyde for 30 minutes at room temperature and blocked for
  • RBCs After mature RBCs were sortagged, they were washed twice in IX PBS and resuspended in RPMI medium. These sortagged RBCs were collected by centrifugation at 1500rpm for 5 minutes and labeled with 5 ⁇ CFSE in Hank's Balanced Salt Solution (HBSS) for 8 minutes (Life Technologies). Equivolumes of 10% FBS in HBSS were then added to quench the reaction. RBCs were washed, counted, and resuspended in sterile HBSS for injection. 2.5 billion CFSElabeled RBCs ( ⁇ 300 ⁇ 1 mouse blood) were then injected intravenously into recipient CD 45 1+ mice. Normal RBCs served as a control.
  • HBSS Hank's Balanced Salt Solution
  • Figure 11 shows the expression of the fusion proteins in the human CD34 + cells and red blood cells obtained at the end of Dif. I and Dif II as described in Example 1 above.
  • the expression of 5Gly (SEQ ID NO: 3)-myc-hGYPA fusion protein on the surface of red blood cells transduced by the EF1 vectors was observed at least at the end of Dif. II.
  • the lentiviral vectors for expressing the 5Gly (SEQ ID NO: 3)-myc-hGYPA and 3Gly-myc-hGYPA fusion proteins were also transduced into K562 cells and expression of both fusion proteins were observed on the surface of the K562 cells.
  • sortag hGYPA 300 ⁇ sortase A of Staphylococcus aureus and 500 ⁇ biotin- LPRTGG (SEQ ID NO: 118) were pre-incubated in a sortase buffer at 37°C for 30 minutes.
  • sortaggable hGYPA 5Gly (SEQ ID NO: 3)-myc- hGYPA or 3Gly-myc-hGYPA
  • sortase-substrate mix 37°C for 1 hour.
  • the cells were washed with PBS for 3 ⁇ 4 times before detection by flow cytometry or Western blotting for biotin conjugation. Labeling efficiency is normally 80-100%.
  • sortaggable hGYPA expressed on K562 cells was successfully modified by biotin in the presence of a sortase.
  • a PE-conjugated peptide comprising the LPXTG (SEQ ID NO: 1) motif was included with sortase A for 45 minutes at 37 °C.
  • the mixture was then incubated with erythrocytes expressing 3Gly-GYPA or 5Gly (SEQ ID NO: 3)-GYPA sortaggable surface protein for 30 minutes at 37 °C.
  • the cells were then subjected to FACS analysis. Results thus obtained indicate that the PE-conjugated peptide was conjugated to both 3Gly-GYPA and 5Gly (SEQ ID NO: 3)-GYPA on the surface of the erythrocytes.
  • the N-terminal signal sequence was retained, followed by glycine residues and a myc epitope tag. Cleavage of the signal peptide would yield (Gly)n-myc tag-GPA.
  • HEK293T cells were transfected with expression vectors for producing surface fusion proteins hsCD71-LPETG (SEQ ID NO: 44)-HA and hsKell-LPETG (SEQ ID NO: 44)-HA via routine recombinant technology. Stable ceil lines expressing the fusion proteins were established. The cells were incubated with 200 ⁇ sortase and 0.5 mM or 1 mM GGG- biotin and subjected to Western blotting analysis. The results indicate that biotin was successfully conjugated to the fusion proteins.
  • nucleated erythroblasts and enucleated reticulocytes displayed modified Kell at the cell surface, and a large fraction of these could be sortagged with a biotin-containing probe as shown by flow cytometry, immunoblotting, and immunofluorescence (Fig. 22).
  • Reticulocytes obtained by in vitro differentiation must undergo not only expulsion of remaining organelles, they must also execute the membrane reorganizations that lead to the biconcave disk shape of mature RBCs.
  • murine fetal liver lineage-negative cells were infected with retroviral vectors expressing engineered hKell-LPETG (SEQ ID NO: 44)-HA and transplanted into lethally irradiated mice (Fig. 20). Mature red blood cells were harvested from transplanted mice after 4 weeks and analyzed for the presence of sortase-modifiable Kell on their surface.
  • Sortases with distinct substrate specificity, it is possible to combine N-terminal and C-terminal labeling strategies (Antos et al., 2009, J. Ameri. Chem. Soc., 131(31): 10800- 10801) to generate multi-labeled RBCs.
  • Sortase A derived from Staphylococcus aureus
  • Sortase A derived from Streptococcus pyogenes recognizes LPXTA (SEQ ID NO: 2) motifs and accepts oligo-alanine probes as nucleophiles. Therefore, the sortase reactions of both enzymes can be performed as orthogonal reactions.
  • HEK293T cells were infected with 2 constructs: AAA-myc-hGPA and hKell-LPETG (SEQ ID NO: 44)-HA.
  • the cells were sequentially incubated with 2 different types of Sortase A in the presence of either biotin-LPETA (SEQ ID NO: 119; for GPA sortagging via S. pyogenes sortase) or GGG-TAMRA (for Kell sortagging via S. aureus sortase), giving rise to HEK293T cells containing both the biotinylated GPA and TAMRA-modified Kell (Fig. 16F).
  • biotin-LPETA SEQ ID NO: 119
  • GGG-TAMRA for Kell sortagging via S. aureus sortase
  • CFSE a fluorescent dye that stably stains cytosol of live cells.
  • the RBCs were then transfused into normal recipient mice; cell survival in circulation was assessed periodically using CFSE fluorescence. No difference was observed in in vivo survival of RBCs between the experimental groups (Fig. 24 ⁇ 4), indicating that the sortagging procedure does not cause significant damage to the cells, which would lead to their premature removal.
  • Example 3 Conjugation of an Antibody to Engineered Red Blood Cells for Cell Type- Specific Targeting
  • modified RBCs One potential application of modified RBCs is to provide them with a targeting moiety that would enable their delivery (and attached or incorporated payload) to particular tissues or cell types. Such targeting may be accomplished by installation of proteins or other entities, such as ligands for specific receptors that can participate in specific recognition of the intended target.
  • a sortaggable alpaca-derived single domain antibody was used. This antibody is specific for murine Class II MHC molecules, VHH7-LPETG (SEQ ID NO: 44), and was covalently attached it to red cells with 3G-myc-hGPA on their surface. As shown by the shift in gel mobility of the 3G- myc-hGPA, the sortagging reaction is stoichiometric (Fig. 25A).
  • B cells - red blood cell binding assay was performed as follows. B cells were isolated from either wild-type C57BL/6 mice or mice knock-out for MHC class II using Dynabeads Mouse CD43 (Untouched B cells) (Life Technologies) according to
  • Resuspended cells 500 ⁇ of PBS were further incubated with - 2x107 red blood cells expressing 3G- myc-hGPA and sortase-labeled with VHH7 for 1 hour at 4 °C, washed 4 times with 1 ml of ice-cold PBS, and finally incubated with SDS sample buffer and boiled for subsequent SDS- PAGE analysis.
  • Terminally differentiated human red blood cells were genetically engineered as follows. Plasmids used to engineer in vzYro-differentiated human RBCs were created by cloning the GGGcontaining human GPA into HIV/MSCV lentiviral vector with the addition of enhanced GFP at its C-terminus to make 3G-myc-hGPA-EGFP. Lentivirus was produced by cotransfection of 293T cells with pVSV-G envelope plasmids and pDelta 8.9 packaging vectors.
  • G-CSF granulocyte - colony stimulating factor
  • Analyses of the resulting engineered human reticulocytes were carried out by means of flow cytometry using the following antibodies: PE-conjugated anti-biotin (1 :1000, eBioscience, 12-9895-82), Hoechst (Sigma), and APC-conjugated (1 :100, eBioscience, 17-0087-42).
  • granulocyte - colony stimulating factor-mobilized CD34+ peripheral blood stem cells were differentiated in vitro in 18 days into hemoglobin-containing reticulocytes, with an enucleation efficiency of -50%.
  • a lentiviral vector that encodes a version of 3G-myc-hGPA fused to enhanced GFP at its C-terminus (3G-myc-GPA-GFP) was constructed. This pro ides an example of a cytoplasmically expressed protein domain designed to be retained in mature RBC via its genetic fusion to GPA.
  • Both the empty (control) vector and the 3G- myc-hGPA-GFP vector encoded a GFP moiety 3' of the IRES sequence (3G-myc-hGPA- GFP-IRES-GFP).
  • 3G-myc-hGPA-GFP which contains an additional enhanced GFP attached to the cytoplasmic domain of GPA, these cells will express a significantly higher level ( ⁇ 2x) of GFP signal, as indicated by flow cytometry (Fig. 26 ⁇ 4, first panel).
  • the mobility of the 3G-myc-hGPA-GFP on SDS-PAGE also indicates that the modified GPA proteins are expressed in monomeric and dimeric forms (Fig. 265).
  • Viral transduction of human CD34+ cells with 3G-myc-hGPA-GFP did not affect their differentiation, as similar numbers of enucleated reticulocytes (50-60%) were formed as in cultures infected with an empty (control) vector (Fig. 26A, middle panel).
  • enucleated reticulocytes that contain the modified GPA at the surface could be sortaselabeled with a biotin-containing probe, as monitored by flow cytometry (Fig. 26A). Furthermore, all of the 3G-myc-hGPA-GFP present on the reticulocyte surface was modified by biotin sortagging, as evidenced by the shift in gel mobility of the 3G-mychGPA-GFP (Fig. 265). This experiment therefore establishes the ability to equip mature human RBCs with a cytoplasmically disposed protein of interest, while retaining the ability to selectively target the RBC to an intended target by sortagging of the modified GPA with a targeting moiety of interest.
  • HDR Homologous direct repair
  • the T7-sgRNA template PCR product for in vitro transcription was gel purified by column (Promega), and the purified PCR product was used as a template for IVT using MEGAshortscript T7 kit (Life Technologies). Both the Cas9 mRNA and the sgRNA were purified using MEGAclear kit (Life Technologies) and eluted in RNase-free water. Fertilized zygotes were collected from oviducts of superovulated females, and Cas9 mRNAs, sgRNA and template oligo DNA were injected into the cytoplasm at the pronuclear stage. The injected zygotes were transferred at the 2-cell stage into the oviduct of pseudopregnant females. To genotype the mice: mouse-tails were lysed at 55°C for 12 hours using tail lysis buffer and genomic DNA was purified from the lysates by isopropanol precipitation.
  • Genomic DNA in the vicinity of the sgRNA target was amplified by PCR using primers mKel-sequencing Fw and mKel-sequencing Rv, as in table 3 [KOD Xtreme (VWR), Condition: 95°C for 2 min; 35x(98°C for 10 s, 50°C for 30s, 68°C for 30 s); 68°C for 2 min; hold at 4 °C], and then gel purified. The purified PCR products were sequenced using the same Fw primer.
  • transgenic mice constructed using CRISPR/Cas-9 genome editing technology (Jinek et al., 2012, Science 337(6096):816-821; and Wang et al, 2013, Cell 153(4):910-918) were used to investigate RBC survival in vivo.
  • Such a transgenic mouse contains LPETG (SEQ ID NO: 44) inserted at the C-terminus of the murine endogenous Kell gene (mKell- LPETG; SEQ ID NO: 44). These mice appear normal and reproduce normally.
  • mice can be labeled with a probe in a sortase- mediated reaction as efficiently as hKell-LPETG (SEQ ID NO: 44)-HA RBCs.
  • CFSE staining was performed on control RBCs, mKell-LPETG (SEQ ID NO: 44) RBCs, and mKell-LPETG (SEQ ID NO: 44) RBCs sortagged with biotin, transfused them into wild- type recipient mice, and their survival in circulation was monitored.
  • the modification of mKell with LPETG (SEQ ID NO: 44) at its C-terminus did not affect the survival of the modified RBCs in vivo (Fig. 245).
  • a slight, but significant difference was observed in survival of mKell-LPETG (SEQ ID NO: 44) RBCs sortagged with a biotin probe.
  • hKell-LPETG (SEQ ID NO: 44) RBCs were also harvested from transplanted mice, sortagged with biotin, and transfused into recipients. Similarly, engineered biotin-labeled Kell-LPETG (SEQ ID NO: 44) RBCs last in circulation more than 28 days albeit with a slight lower survival compared to wild-type RBCs (Fig. 24Q. These results show similar experiments comparing the in vivo survival of normal RBCs to sortase-labeled biotin-3G- myc-hGPA RBCs. The results (Fig.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Environmental Sciences (AREA)
  • Molecular Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Hematology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Public Health (AREA)
  • Animal Husbandry (AREA)
  • Biodiversity & Conservation Biology (AREA)
  • Epidemiology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2014/037554 2013-05-10 2014-05-09 In vitro production of red blood cells with sortaggable proteins Ceased WO2014183071A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
HK16110752.9A HK1222662A1 (zh) 2013-05-10 2014-05-09 体外生产具有可分选蛋白的无核红细胞
JP2016513129A JP6599848B2 (ja) 2013-05-10 2014-05-09 ソルタギング可能なタンパク質を有する赤血球のinvitro生成
EP14795167.7A EP2994491A4 (en) 2013-05-10 2014-05-09 IN VITRO PREPARATION OF ERYTHROCYTES WITH SORTASE-PROOF PROTEINS
EP19171188.6A EP3546484B1 (en) 2013-05-10 2014-05-09 In vitro production of red blood cells with sortaggable proteins
US14/890,241 US10471099B2 (en) 2013-05-10 2014-05-09 In vitro production of red blood cells with proteins comprising sortase recognition motifs
AU2014262474A AU2014262474B2 (en) 2013-05-10 2014-05-09 In vitro production of red blood cells with sortaggable proteins
EP19171190.2A EP3546485A1 (en) 2013-05-10 2014-05-09 In vitro production of red blood cells with sortaggable proteins
EP19219550.1A EP3693398A1 (en) 2013-05-10 2014-05-09 In vitro production of red blood cells with sortaggable proteins
US15/934,177 US11266695B2 (en) 2013-05-10 2018-03-23 In vitro production of red blood cells with sortaggable proteins
US16/572,425 US11992505B2 (en) 2013-05-10 2019-09-16 In vitro production of red blood cells with proteins comprising sortase recognition motifs
AU2019283766A AU2019283766B2 (en) 2013-05-10 2019-12-16 In vitro production of red blood cells with sortaggable proteins

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201361822071P 2013-05-10 2013-05-10
US61/822,071 2013-05-10

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US14/890,241 A-371-Of-International US10471099B2 (en) 2013-05-10 2014-05-09 In vitro production of red blood cells with proteins comprising sortase recognition motifs
US15/934,177 Division US11266695B2 (en) 2013-05-10 2018-03-23 In vitro production of red blood cells with sortaggable proteins
US16/572,425 Division US11992505B2 (en) 2013-05-10 2019-09-16 In vitro production of red blood cells with proteins comprising sortase recognition motifs

Publications (2)

Publication Number Publication Date
WO2014183071A2 true WO2014183071A2 (en) 2014-11-13
WO2014183071A3 WO2014183071A3 (en) 2015-01-29

Family

ID=51867887

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2014/037554 Ceased WO2014183071A2 (en) 2013-05-10 2014-05-09 In vitro production of red blood cells with sortaggable proteins

Country Status (7)

Country Link
US (3) US10471099B2 (https=)
EP (4) EP2994491A4 (https=)
JP (3) JP6599848B2 (https=)
AU (2) AU2014262474B2 (https=)
ES (1) ES2901383T3 (https=)
HK (1) HK1222662A1 (https=)
WO (1) WO2014183071A2 (https=)

Cited By (65)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9068179B1 (en) 2013-12-12 2015-06-30 President And Fellows Of Harvard College Methods for correcting presenilin point mutations
US9228207B2 (en) 2013-09-06 2016-01-05 President And Fellows Of Harvard College Switchable gRNAs comprising aptamers
US9322037B2 (en) 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
US9322006B2 (en) 2011-07-22 2016-04-26 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US9359599B2 (en) 2013-08-22 2016-06-07 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
WO2016183482A1 (en) * 2015-05-13 2016-11-17 Rubius Therapeutics, Inc. Membrane-receiver complex therapeutics
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
US9644180B2 (en) 2013-11-18 2017-05-09 Rubius Therapeutics, Inc. Synthetic membrane-receiver complexes
WO2017123644A1 (en) 2016-01-11 2017-07-20 Rubius Therapeutics, Inc. Compositions and methods related to multimodal therapeutic cell systems for immune indications
US9834791B2 (en) 2013-11-07 2017-12-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
WO2018102740A1 (en) 2016-12-02 2018-06-07 Rubius Therapeutics, Inc. Compositions and methods related to cell systems for penetrating solid tumors
WO2018151829A1 (en) 2017-02-17 2018-08-23 Rubius Therapeutics, Inc. Functionalized erythroid cells
US10077453B2 (en) 2014-07-30 2018-09-18 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10113163B2 (en) 2016-08-03 2018-10-30 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
CN108778318A (zh) * 2016-01-14 2018-11-09 北卡罗莱纳州立大学 葡萄糖响应性胰岛素递送组合物和方法
US10167457B2 (en) 2015-10-23 2019-01-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
WO2019017937A1 (en) 2017-07-19 2019-01-24 Rubius Therapeutics, Inc. COMPOSITIONS AND METHODS ASSOCIATED WITH MULTIMODAL THERAPEUTIC CELLULAR SYSTEMS FOR THE TREATMENT OF CARDIOMETABOLIC DISEASE
WO2019017940A1 (en) 2017-07-19 2019-01-24 Rubius Therapeutics, Inc. COMPOSITIONS AND METHODS ASSOCIATED WITH MULTIMODAL THERAPEUTIC CELLULAR SYSTEMS FOR THE TREATMENT OF INFECTIOUS DISEASE
WO2019040649A1 (en) * 2017-08-23 2019-02-28 Whitehead Institute For Biomedical Research PRODUCTION OF REDUCED GLOBULATES AND USES THEREOF
WO2019040516A1 (en) 2017-08-22 2019-02-28 Rubius Therapeutics, Inc. METHODS AND COMPOSITIONS OF LIPID NANOPARTICLES FOR THE PRODUCTION OF MODIFIED ERYTHROID CELLS
WO2019090148A2 (en) 2017-11-03 2019-05-09 Rubius Therapeutics, Inc. Compositions and methods related to therapeutic cell systems for tumor growth inhibition
WO2019133881A1 (en) 2017-12-29 2019-07-04 Rubius Therapeutics, Inc. Gene editing and targeted transcriptional modulation for enginerering erythroid cells
WO2019140116A2 (en) 2018-01-10 2019-07-18 Rubius Therapeutics, Inc. Amplifiable rnas for therapeutic cell systems
US10508298B2 (en) 2013-08-09 2019-12-17 President And Fellows Of Harvard College Methods for identifying a target site of a CAS9 nuclease
WO2020117852A1 (en) 2018-12-03 2020-06-11 Rubius Therapeutics, Inc. Artificial antigen presenting cells including hla-e and hla-g molecules and methods of use
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
WO2020172472A1 (en) 2019-02-20 2020-08-27 Rubius Therapeutics, Inc. Engineered erythroid cells including loadable antigen-presenting polypeptides and methods of use
US10869898B2 (en) 2014-04-01 2020-12-22 Rubius Therapeutics, Inc. Methods and compositions for immunomodulation
WO2021162731A1 (en) 2020-02-10 2021-08-19 Rubius Therapeutics, Inc. Engineered erythroid cells including hla-g polypeptides and methods of use thereof
WO2021185359A1 (en) * 2020-03-20 2021-09-23 Westlake Therapeutics (Hangzhou) Co. Limited Modified red blood cells and uses thereof for delivering agents
US11141433B2 (en) 2018-03-08 2021-10-12 Rubius Therapeutics, Inc. Therapeutic cell systems and methods for treating cancer and infectious diseases
JP2022513312A (ja) * 2018-09-21 2022-02-07 シティー・ユニバーシティー・オブ・ホンコン 表面修飾細胞外小胞
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
US11266695B2 (en) 2013-05-10 2022-03-08 Whitehead Institute For Biomedical Research In vitro production of red blood cells with sortaggable proteins
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
WO2022089605A1 (en) * 2020-10-30 2022-05-05 Westlake Therapeutics (Hangzhou) Co. Limited Modified red blood cells and uses thereof for delivering agents
WO2022104109A1 (en) 2020-11-13 2022-05-19 Catamaran Bio, Inc. Genetically modified natural killer cells and methods of use thereof
WO2022150578A1 (en) 2021-01-08 2022-07-14 Rubius Therapeutics, Inc. Methods of treating a tumor in a human subject
WO2022150569A1 (en) 2021-01-08 2022-07-14 Rubius Therapeutics, Inc. METHODS OF INCREASING NKp30-POSITIVE LYMPHOCYTES IN A SUBJECT AND USES THEREOF
WO2022164392A1 (en) * 2021-01-29 2022-08-04 National University Of Singapore Surface modified red blood cells and methods of generating the same
US11447770B1 (en) 2019-03-19 2022-09-20 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
WO2022197548A1 (en) 2021-03-14 2022-09-22 Rubius Therapeutics, Inc. Methods of increasing nkg2d-positive lymphocytes in a subject and uses thereof
WO2022211740A1 (en) 2021-03-31 2022-10-06 Carmine Therapeutics Pte. Ltd. Extracellular vesicles loaded with at least two different nucleic acids
WO2022256646A1 (en) 2021-06-03 2022-12-08 Rubius Therapeutics, Inc. Methods of treating hpv16-positive or hpv16-associated cancer in a subject
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
WO2023284742A1 (en) * 2021-07-13 2023-01-19 Westlake Therapeutics (Hangzhou) Co. Limited Cells modified by conjugated n-terminal glycine and uses thereof
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
US20230226218A1 (en) * 2020-05-11 2023-07-20 Erytech Pharma Red Cell Extracellular Vesicles (RCEVs) Containing Cargoes and Methods of Use and Production Thereof
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US11970718B2 (en) 2020-01-13 2024-04-30 Carmine Therapeutics Pte. Ltd. Nucleic acid loaded extracellular vesicles
WO2024088213A1 (en) * 2022-10-24 2024-05-02 Westlake Therapeutics (Shanghai) Co., Limited Combination to induce specific immune tolerance
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof

Families Citing this family (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2012275390A1 (en) 2011-06-28 2014-01-16 Whitehead Institute For Biomedical Research Using sortases to install click chemistry handles for protein ligation
WO2014183066A2 (en) 2013-05-10 2014-11-13 Whitehead Institute For Biomedical Research Protein modification of living cells using sortase
US10556024B2 (en) 2013-11-13 2020-02-11 Whitehead Institute For Biomedical Research 18F labeling of proteins using sortases
US10053683B2 (en) 2014-10-03 2018-08-21 Whitehead Institute For Biomedical Research Intercellular labeling of ligand-receptor interactions
KR20170098821A (ko) 2014-12-17 2017-08-30 에프. 호프만-라 로슈 아게 소르타아제를 사용한 1 단계로의 이중 폴리펩티드 컨쥬게이션을 위한 효소 원-포트 반응
EP3234177A1 (en) 2014-12-17 2017-10-25 F. Hoffmann-La Roche AG Activity assay for bond forming enzymes
CN108026560A (zh) 2015-09-25 2018-05-11 豪夫迈·罗氏有限公司 在低共熔溶剂中使用分选酶的转酰胺反应
CN108138204B (zh) 2015-09-25 2021-12-31 豪夫迈·罗氏有限公司 使用分选酶a生产硫酯的方法
US12048753B2 (en) 2015-10-01 2024-07-30 Whitehead Institute For Biomedical Research Labeling of antibodies
US10738338B2 (en) 2016-10-18 2020-08-11 The Research Foundation for the State University Method and composition for biocatalytic protein-oligonucleotide conjugation and protein-oligonucleotide conjugate
WO2019032628A1 (en) 2017-08-07 2019-02-14 The Regents Of The University Of California GENERATING PLATFORM FOR SAFE CELLULAR THERAPEUTIC AGENTS
US10960071B2 (en) 2017-08-07 2021-03-30 The Regents Of The University Of California Platform for generating safe cell therapeutics
RU2763798C1 (ru) * 2017-12-23 2022-01-11 Рубиус Терапьютикс, Инк. Искусственные антигенпрезентирующие клетки и способы их применения
JP2022530130A (ja) 2019-04-26 2022-06-27 ルビウス セラピューティクス, インコーポレイテッド 除核赤血球細胞を含む緩衝組成物
CA3141315A1 (en) 2019-05-24 2020-12-03 Rubius Therapeutics, Inc. Methods of generating enucleated erythroid cells
CN115038784A (zh) 2019-11-04 2022-09-09 鲁比厄斯治疗法股份有限公司 使用肌-肌醇产生去核红系细胞的方法
WO2021092047A1 (en) 2019-11-04 2021-05-14 Rubius Therapeutics, Inc. Methods of generating enucleated erythroid cells using taurine or hypotaurine
JP2023512712A (ja) * 2020-02-07 2023-03-28 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア 除核細胞をバイオ操作するための方法および使用
WO2022166913A1 (en) * 2021-02-04 2022-08-11 Westlake Therapeutics (Hangzhou) Co. Limited Modified red blood cells and uses thereof for treating hyperuricemia and gout
KR20260010390A (ko) * 2023-04-12 2026-01-20 사이토누스 테라퓨틱스, 인크. 치료용 세포의 제조
EP4735584A1 (en) * 2023-06-30 2026-05-06 The Children's Hospital of Philadelphia Click chemistry assisted cell surface engineering for restoring lentivirus entry

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1994029438A1 (en) 1993-06-11 1994-12-22 Cell Genesys, Inc. Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells
WO1997021825A1 (en) 1995-12-15 1997-06-19 Systemix, Inc. Method for obtaining retroviral packaging cell lines producing high transducing efficiency retroviral supernatant
WO1997021824A2 (en) 1995-12-15 1997-06-19 Systemix, Inc. Method for obtaining retroviral vector supernatant having high transduction efficiency
WO2005086654A2 (en) 2004-02-27 2005-09-22 The Trustees Of Princeton University Self-cleaving affinity tags and methods of use
WO2010087994A2 (en) 2009-01-30 2010-08-05 Whitehead Institute For Biomedical Research Methods for ligation and uses thereof
WO2011133704A2 (en) 2010-04-20 2011-10-27 Whitehead Institute For Biomedical Researh Modified polypeptides and proteins and uses thereof
US8211656B2 (en) 2008-08-13 2012-07-03 The Invention Science Fund I, Llc Biological targeting compositions and methods of using the same

Family Cites Families (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5670132A (en) 1994-09-20 1997-09-23 Immunomedics, Inc. Modified radioantibody fragments for reduced renal uptake
US5728369A (en) 1994-10-05 1998-03-17 Immunomedics, Inc. Radioactive phosphorus labeling of proteins for targeted radiotherapy
EP1233780A4 (en) 1999-04-15 2004-09-22 Univ California IDENTIFICATION OF THE SORTASE GENE
CA2413538A1 (en) 2000-07-06 2002-01-17 Bristol-Myers Squibb Pharma Company Stable radiopharmaceutical compositions and methods for preparation thereof
CN101899114A (zh) 2002-12-23 2010-12-01 惠氏公司 抗pd-1抗体及其用途
US6960473B2 (en) * 2003-02-27 2005-11-01 Istituto Superiore Di Sanita In vitro mass production of human erythroid cells from the blood of normal donors and thalassemic patients
WO2005051976A2 (en) 2003-11-20 2005-06-09 Ansata Therapeutics, Inc. Protein and peptide ligation processes and one-step purification processes
EP1753859B1 (en) * 2004-06-04 2014-07-30 Université Pierre et Marie Curie (Paris 6) A method for producing red blood cells
US8398956B2 (en) 2007-01-11 2013-03-19 Immunomedics, Inc. In vivo copper-free click chemistry for delivery of therapeutic and/or diagnostic agents
BR122017025062B8 (pt) 2007-06-18 2021-07-27 Merck Sharp & Dohme anticorpo monoclonal ou fragmento de anticorpo para o receptor de morte programada humano pd-1, polinucleotídeo e composição compreendendo o referido anticorpo ou fragmento
US8865875B2 (en) 2007-08-22 2014-10-21 Medarex, L.L.C. Site-specific attachment of drugs or other agents to engineered antibodies with C-terminal extensions
US20110070154A1 (en) 2008-08-13 2011-03-24 Hyde Roderick A Artificial cells
JP2012500855A (ja) 2008-08-25 2012-01-12 アンプリミューン、インコーポレーテッド Pd−1アンタゴニストおよび感染性疾患を処置するための方法
AU2009288730B2 (en) 2008-08-25 2013-06-20 Amplimmune, Inc. Compositions of PD-1 antagonists and methods of use
WO2010033913A1 (en) 2008-09-22 2010-03-25 Icb International, Inc. Antibodies, analogs and uses thereof
JP2010115136A (ja) * 2008-11-12 2010-05-27 Teruyuki Nagamune N末端標識膜蛋白質の作製方法、及びn末端標識膜蛋白質を表層に有する細胞
WO2010078376A2 (en) 2008-12-30 2010-07-08 Ventana Medical Systems, Inc. Fc-specific polymer-conjugated antibodies and their diagnostic use
JP5844159B2 (ja) 2009-02-09 2016-01-13 ユニヴェルシテ デクス−マルセイユUniversite D’Aix−Marseille Pd−1抗体およびpd−l1抗体ならびにその使用
KR20130009760A (ko) 2010-02-10 2013-01-23 이뮤노젠 아이엔씨 Cd20 항체 및 이의 용도
PL2539441T3 (pl) * 2010-02-22 2017-06-30 Université Pierre Et Marie Curie (Paris 6) Podłoże do hodowli komórkowej do wzrostu i różnicowania komórek linii hematopoetycznych
EP2545078A1 (en) 2010-03-11 2013-01-16 UCB Pharma, S.A. Pd-1 antibody
WO2012142659A1 (en) 2011-04-19 2012-10-26 Baker Idi Heart And Diabetes Institute Holdings Limited Site-selective modification of proteins
AU2012275390A1 (en) 2011-06-28 2014-01-16 Whitehead Institute For Biomedical Research Using sortases to install click chemistry handles for protein ligation
CN102559600A (zh) 2011-12-29 2012-07-11 上海交通大学医学院 一种人工抗原递呈细胞及其在nk细胞扩增中的应用
WO2013132317A1 (en) 2012-03-07 2013-09-12 Aurigene Discovery Technologies Limited Peptidomimetic compounds as immunomodulators
US9751945B2 (en) 2012-04-13 2017-09-05 Whitehead Institute For Biomedical Research Sortase-modified VHH domains and uses thereof
US20140030697A1 (en) 2012-06-14 2014-01-30 Massachusetts Institute Of Technology Sortase-mediated modification of viral surface proteins
US9267127B2 (en) 2012-06-21 2016-02-23 President And Fellows Of Harvard College Evolution of bond-forming enzymes
US9511350B2 (en) 2013-05-10 2016-12-06 Clean Diesel Technologies, Inc. (Cdti) ZPGM Diesel Oxidation Catalysts and methods of making and using same
WO2014183066A2 (en) 2013-05-10 2014-11-13 Whitehead Institute For Biomedical Research Protein modification of living cells using sortase
EP2994491A4 (en) 2013-05-10 2016-12-07 Whitehead Inst Biomedical Res IN VITRO PREPARATION OF ERYTHROCYTES WITH SORTASE-PROOF PROTEINS
EP3760711A1 (en) 2013-05-15 2021-01-06 University Of Rochester Human extensively self-renewing erythroblasts (esre)
WO2015051188A1 (en) 2013-10-02 2015-04-09 Washington University Heterocyclic molecules for biomedical imaging and therapeutic applications
US9878045B2 (en) 2013-10-15 2018-01-30 Regents Of The University Of Minnesota Triorthogonal reagents for dual protein conjugation
US10556024B2 (en) 2013-11-13 2020-02-11 Whitehead Institute For Biomedical Research 18F labeling of proteins using sortases
US10053683B2 (en) 2014-10-03 2018-08-21 Whitehead Institute For Biomedical Research Intercellular labeling of ligand-receptor interactions
US20180135012A1 (en) 2015-05-13 2018-05-17 Rubius Therapeutics, Inc. Membrane-receiver complex therapeutics
US12048753B2 (en) 2015-10-01 2024-07-30 Whitehead Institute For Biomedical Research Labeling of antibodies
WO2019040649A1 (en) 2017-08-23 2019-02-28 Whitehead Institute For Biomedical Research PRODUCTION OF REDUCED GLOBULATES AND USES THEREOF
CA3141315A1 (en) * 2019-05-24 2020-12-03 Rubius Therapeutics, Inc. Methods of generating enucleated erythroid cells

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1994029438A1 (en) 1993-06-11 1994-12-22 Cell Genesys, Inc. Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells
WO1997021825A1 (en) 1995-12-15 1997-06-19 Systemix, Inc. Method for obtaining retroviral packaging cell lines producing high transducing efficiency retroviral supernatant
WO1997021824A2 (en) 1995-12-15 1997-06-19 Systemix, Inc. Method for obtaining retroviral vector supernatant having high transduction efficiency
WO2005086654A2 (en) 2004-02-27 2005-09-22 The Trustees Of Princeton University Self-cleaving affinity tags and methods of use
US8211656B2 (en) 2008-08-13 2012-07-03 The Invention Science Fund I, Llc Biological targeting compositions and methods of using the same
WO2010087994A2 (en) 2009-01-30 2010-08-05 Whitehead Institute For Biomedical Research Methods for ligation and uses thereof
WO2011133704A2 (en) 2010-04-20 2011-10-27 Whitehead Institute For Biomedical Researh Modified polypeptides and proteins and uses thereof

Non-Patent Citations (74)

* Cited by examiner, † Cited by third party
Title
"NCBI", Database accession no. NM 002099.6
"NCBI", Database accession no. NM 010369.3
"NCBI", Database accession no. NM_000420.2
AITKEN, R.: "Antibody Phage Display: Methods and Protocols (Methods in Molecular Biology); 2nd ed.", 2009, HUMANA PRESS
ANTOS ET AL., J. AM. CHEM. SOC., vol. 131, no. 31, 2009, pages 10800 - 10801
ANTOS ET AL., J. AMERI. CHEM. SOC., vol. 131, no. 31, 2009, pages 10800 - 10801
BARNETT ET AL., JOURNAL OF BACTERIOLOGY, vol. 184, no. 8, 2002, pages 2181 - 2191
BECER; HOOGENBOOM; SCHUBERT: "Click Chemistry beyond Metal-Catalyzed Cycloaddition", ANGEWANDTE CHEMIE INTERNATIONAL EDITION, vol. 48, 2009, pages 4900 - 4908, XP055215368, DOI: doi:10.1002/anie.200900755
BIAGIOTTI ET AL., IUBMB LIFE, vol. 63, no. 8, 2011, pages 621 - 631
BROWN, M. ET AL., CELL, vol. 49, 1987, pages 603 - 612
CHAIKEN IM; WILLIAMS WV: "Identifying structure-function relationships in four-helix bundle cytokines: towards de novo mimetics design", TRENDS BIOTECHNOL, vol. 14, no. 10, October 1996 (1996-10-01), pages 369 - 75, XP004035727, DOI: doi:10.1016/0167-7799(96)10050-0
CHALFIE, M. AND KAIN, SR: "Green fluorescent protein: properties, applications, and protocols Methods of biochemical analysis", vol. 47, 2006, WILEY-INTERSCIENCE
CHEN ET AL., PNAS, vol. 108, no. 28, 2011, pages 1 1399 - 11404
CHEN ET AL., PROC NATL ACAD SCI USA., vol. 108, no. 28, 12 July 2011 (2011-07-12), pages 1 1399
CHUDAKOV, DM ET AL., PHYSIOL REV, vol. 90, no. 3, 2010, pages 1103 - 63
CLARK, W.R.: "The Experimental Foundations of Modern Immunology", 1986, WILEY & SONS, INC.
COMFORT ET AL., INFECT IMMUN., vol. 72, no. 5, 2004, pages 2710 - 22
CONG ET AL., SCIENCE, vol. 339, no. 6121, 2013, pages 819 - 826
CWIRLA, SCIENCE, vol. 276, 1997, pages 1696
DONELLO, J. E. ET AL., J. OF VIROL., vol. 72, 1998, pages 5085 - 5092
DOUAY ET AL., BLOOD, vol. 105, no. l, 2009, pages 85 - 94
DRAMSI ET AL., RES MICROBIOL, vol. 156, no. 3, 2005, pages 289 - 97
ESPOSITO D; CHATTCRJCC DK, CURR OPIN BIOTECHNOL., vol. 17, no. 4, 2006, pages 353 - 8
F. YAO ET AL., HUMAN GENE THERAPY
GIARRATANA ET AL., BLOOD, vol. 118, no. 19, 2011, pages 5071 - 5079
GODFRIN ET AL., EXPERT OPINION ON BIOLOGICAL THERAPY, vol. 12, no. 1, 2012, pages 127 - 133
GOSSEN, M.; BUJARD, H., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 5547 - 5551
GRIFFITHS ET AL., BLOOD, vol. 119, no. 26, 2012, pages 6296 - 6306
GRUEN ET AL., STEM CELLS, vol. 24, no. 10, 2006, pages 2162 - 2169
GUIMARAES ET AL., NAT PROTOC, vol. 8, no. 9, 2013, pages 1787 - 1799
H. C. KOLB; M. G. FINN; K. B. SHARPLESS: "Click Chemistry: Diverse Chemical Function from a Few Good Reactions", ANGEWANDTE CHEMIE INTERNATIONAL EDITION, vol. 40, no. 11, 2001, pages 2004 - 2021, XP002554101
HIRAKAWA ET AL., BIOTECHNOL. BIOENG, vol. 109, no. 12, pages 2955 - 2961
HUNTER, CA, NATURE REVIEWS IMMUNOLOGY, vol. 5, 2005, pages 521 - 531
JINEK ET AL., SCIENCE, vol. 337, no. 6096, 2012, pages 816 - 821
KLAUS W ET AL.: "The three-dimensional high resolution structure of human interferon alpha-2a determined by heteronuclear NMR spectroscopy in solution", J. MOL BIOL., vol. 274, no. 4, 1997, pages 661 - 75, XP004453802, DOI: doi:10.1006/jmbi.1997.1396
LIU ET AL., BLOOD, vol. 115, no. 10, 2010, pages 2021 - 2027
LOEB, V. E. ET AL., HUMAN GENE THERAPY, vol. 10, 1999, pages 2295 - 2305
M. BROWN ET AL., CELL, vol. 49, 1987, pages 603 - 612
M. GOSSEN ET AL., NATL. ACAD. SCI. USA, vol. 89, 1992, pages 5547 - 5551
MALI ET AL., SCIENCE, vol. 339, no. 6121, pages 823 - 826
MARISCOTTI ET AL., JBIOL CHEM, 7 January 2009 (2009-01-07)
MARRAFFINI ET AL., JOURNAL OF BACTERIOLOGY, vol. 189, no. 17, 2007, pages 6425 - 6436
MAXIMILIAN POPP ET AL.: "Sortagging: a versatile method for protein labeling", NATURE CHEMICAL BIOLOGY, vol. 3, no. 11, 23 September 2007 (2007-09-23), pages 707 - 708, XP055305660, DOI: doi:10.1038/nchembio.2007.31
MIHARADA ET AL., NAT. BIOTECHNOL., vol. 24, no. 10, 2006, pages 1255 - 1256
MOTT HR; CAMPBELL ID: "Four-helix bundle growthfactors and their receptors: protein-protein interactions", CURR OPIN STRUCT BIOL, vol. 5, no. 1, February 1995 (1995-02-01), pages 114 - 2 1, XP022455358, DOI: doi:10.1016/0959-440X(95)80016-T
MURCIANO, NATURE BIOTECHNOLOGY, vol. 21, no. 8, 2003, pages 891 - 896
MUZYKANTOV, EXPERT OPINION ON DRUG DELIVERY, vol. 7, no. 4, 2010, pages 403 - 427
NOVERSHTERN ET AL., CELL, vol. 144, 2011, pages 296 - 309
P. SHOCKETT ET AL., PROC. NATL. ACAD. SCI. USA, vol. 92, 1995, pages 6522 - 6526
PALLEN ET AL., TRENDS IN MICROBIOLOGY, vol. 9, no. 3, 2001, pages 97 - 101
PAUL, WE: "Fundamental Immunology; 6th ed.,", 2008, LIPPINCOTT WILLIAMS & WILKINS
POPP ET AL., PLOS PATHOGENS, vol. 8, no. 3, 2012, pages e1002604
ROBINSON RC ET AL.: "Structure of the brain-derived neurotrophic factor/neurotrophin 3 heterodimer", BIOCHEMISTRY, vol. 34, no. 13, 1995, pages 4139 - 46
ROBINSON RC ET AL.: "The structures of the neurotrophin 4 homodimer and the brain-derived neurotrophic factor/neurotrophin 4 heterodimer reveal a common Trk-binding site", PROTEIN SCI., vol. 8, no. 12, 1999, pages 2589 - 97
ROITT, I.: "Essential Immunology, 7th Ed.,", 1991, BLACKWELL SCIENTIFIC PUBLICATIONS
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Mannual", COLD SPRING HARBOR LABORATORY PRESS
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Mannual, 3r dEd.,", COLD SPRING HARBOR LABORATORY PRESS
SANKARAN ET AL., SCIENCE, vol. 322, no. 5909, 2008, pages 1839 - 1842
SANYAL ET AL., CELL HOST & MICROBE, vol. 14, no. 5, 2013, pages 510 - 521
See also references of EP2994491A4
SHOCKELT, P. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 92, 1995, pages 6522 - 6526
SIDHU, S.: "Phage Display in Biotechnology and Drug Discovery", 2005, CRC PRESS
STRIJBIS ET AL., TRAFFIC, vol. 13, no. 6, 2012, pages 780 - 789
THEILE ET AL., NAT. PROTOC., vol. 8, no. 9, 2013, pages 1800 - 1807
TSUTOMU TANAKA ET AL.: "Site-specific protein modification on living cells catalyzed by Sortase", CHEMBIOCHEM, vol. 9, no. 5, 5 March 2008 (2008-03-05), pages 802 - 807, XP055294783, DOI: doi:10.1002/cbic.200700614
VLADIMIR MUZYKANTOV: "Drug delivery by red blood cells: vascular carriers designed by Mother Nature", EXPERT OPINION ON DRUG DELIVERY, vol. 7, no. 4, 1 April 2010 (2010-04-01), pages 403 - 427, XP055088510, DOI: doi:10.1517/17425241003610633
WANG ET AL., CELL, vol. 153, no. 4, 2013, pages 910 - 918
YAMAMOTO T. ET AL.: "Expansion of the sortase-mediated labeling method for site-specific N-terminal labeling of cell surface proteins on living cells", CHEM COMMUN, vol. 7, no. 9, 7 March 2009 (2009-03-07), pages 1022 - 1024, XP055294777, DOI: doi:10.1039/b818792d
YAO, F. ET AL., HUMAN GENE THERAPY, vol. 9, 1998, pages 1939 - 1950
YOO ET AL., NATURE REVIEWS. DRUG DELIVERY, vol. 10, no. 7, 2011, pages 521 - 535
YOO ET AL., NATURE REVIEWS. DRUG DISCOVERY, vol. 10, no. 7, pages 521 - 535
ZAITSEV ET AL., BLOOD, vol. 115, no. 25, 2010, pages 5241 - 5248
ZHANG ET AL., BLOOD, vol. 102, no. 12, pages 3938 - 3946
ZUFFEREY, R. ET AL., J. OF VIROL., vol. 73, 1999, pages 2886 - 2892

Cited By (140)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9322006B2 (en) 2011-07-22 2016-04-26 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US10323236B2 (en) 2011-07-22 2019-06-18 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US12006520B2 (en) 2011-07-22 2024-06-11 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US11266695B2 (en) 2013-05-10 2022-03-08 Whitehead Institute For Biomedical Research In vitro production of red blood cells with sortaggable proteins
US10954548B2 (en) 2013-08-09 2021-03-23 President And Fellows Of Harvard College Nuclease profiling system
US11920181B2 (en) 2013-08-09 2024-03-05 President And Fellows Of Harvard College Nuclease profiling system
US10508298B2 (en) 2013-08-09 2019-12-17 President And Fellows Of Harvard College Methods for identifying a target site of a CAS9 nuclease
US10227581B2 (en) 2013-08-22 2019-03-12 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US9359599B2 (en) 2013-08-22 2016-06-07 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US11046948B2 (en) 2013-08-22 2021-06-29 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US10597679B2 (en) 2013-09-06 2020-03-24 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US9999671B2 (en) 2013-09-06 2018-06-19 President And Fellows Of Harvard College Delivery of negatively charged proteins using cationic lipids
US12559737B2 (en) 2013-09-06 2026-02-24 President And Fellows Of Harvard College Cas9 variants and uses thereof
US9737604B2 (en) 2013-09-06 2017-08-22 President And Fellows Of Harvard College Use of cationic lipids to deliver CAS9
US10912833B2 (en) 2013-09-06 2021-02-09 President And Fellows Of Harvard College Delivery of negatively charged proteins using cationic lipids
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
US9388430B2 (en) 2013-09-06 2016-07-12 President And Fellows Of Harvard College Cas9-recombinase fusion proteins and uses thereof
US10682410B2 (en) 2013-09-06 2020-06-16 President And Fellows Of Harvard College Delivery system for functional nucleases
US11299755B2 (en) 2013-09-06 2022-04-12 President And Fellows Of Harvard College Switchable CAS9 nucleases and uses thereof
US9340800B2 (en) 2013-09-06 2016-05-17 President And Fellows Of Harvard College Extended DNA-sensing GRNAS
US9340799B2 (en) 2013-09-06 2016-05-17 President And Fellows Of Harvard College MRNA-sensing switchable gRNAs
US9322037B2 (en) 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
US9228207B2 (en) 2013-09-06 2016-01-05 President And Fellows Of Harvard College Switchable gRNAs comprising aptamers
US12473573B2 (en) 2013-09-06 2025-11-18 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US12584118B2 (en) 2013-09-06 2026-03-24 President And Fellows Of Harvard College Cas9 variants and uses thereof
US10858639B2 (en) 2013-09-06 2020-12-08 President And Fellows Of Harvard College CAS9 variants and uses thereof
US10190137B2 (en) 2013-11-07 2019-01-29 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US10640788B2 (en) 2013-11-07 2020-05-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAs
US9834791B2 (en) 2013-11-07 2017-12-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US11390887B2 (en) 2013-11-07 2022-07-19 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US10329531B2 (en) 2013-11-18 2019-06-25 Rubius Therapeutics, Inc. Synthetic membrane-receiver complexes
US9644180B2 (en) 2013-11-18 2017-05-09 Rubius Therapeutics, Inc. Synthetic membrane-receiver complexes
US10253296B2 (en) 2013-11-18 2019-04-09 Rubius Therapeutics, Inc. Synthetic membrane-receiver complexes
US10557119B2 (en) 2013-11-18 2020-02-11 Rubius Therapeutics, Inc. Erythroid cells comprising phenylalanine ammonia lyase
US10301594B1 (en) 2013-11-18 2019-05-28 Rubius Therapeutics, Inc Synthetic membrane-receiver complexes
US10301593B2 (en) 2013-11-18 2019-05-28 Rubius Therapeutics, Inc. Synthetic membrane-receiver complexes
US10344263B2 (en) 2013-11-18 2019-07-09 Rubius Therapeutics, Inc. Synthetic membrane-receiver complexes
US11124782B2 (en) 2013-12-12 2021-09-21 President And Fellows Of Harvard College Cas variants for gene editing
US9840699B2 (en) 2013-12-12 2017-12-12 President And Fellows Of Harvard College Methods for nucleic acid editing
US12215365B2 (en) 2013-12-12 2025-02-04 President And Fellows Of Harvard College Cas variants for gene editing
US11053481B2 (en) 2013-12-12 2021-07-06 President And Fellows Of Harvard College Fusions of Cas9 domains and nucleic acid-editing domains
US9068179B1 (en) 2013-12-12 2015-06-30 President And Fellows Of Harvard College Methods for correcting presenilin point mutations
US10465176B2 (en) 2013-12-12 2019-11-05 President And Fellows Of Harvard College Cas variants for gene editing
US11554141B2 (en) 2014-04-01 2023-01-17 Rubius Therapeutics, Inc. Methods and compositions for immunomodulation
US11576934B2 (en) 2014-04-01 2023-02-14 Rubius Therapeutics, Inc. Methods and compositions for immunomodulation
US10869898B2 (en) 2014-04-01 2020-12-22 Rubius Therapeutics, Inc. Methods and compositions for immunomodulation
US11578343B2 (en) 2014-07-30 2023-02-14 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US12398406B2 (en) 2014-07-30 2025-08-26 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10077453B2 (en) 2014-07-30 2018-09-18 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10704062B2 (en) 2014-07-30 2020-07-07 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
WO2016183482A1 (en) * 2015-05-13 2016-11-17 Rubius Therapeutics, Inc. Membrane-receiver complex therapeutics
US12344869B2 (en) 2015-10-23 2025-07-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US10167457B2 (en) 2015-10-23 2019-01-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US12043852B2 (en) 2015-10-23 2024-07-23 President And Fellows Of Harvard College Evolved Cas9 proteins for gene editing
US11214780B2 (en) 2015-10-23 2022-01-04 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US10456421B2 (en) 2016-01-11 2019-10-29 Rubius Therapeutics, Inc. Compositions and methods related to engineered erythoid cells comprising 4-1BBL
CN108697733A (zh) * 2016-01-11 2018-10-23 鲁比厄斯治疗法股份有限公司 与癌症适应症的多模式治疗性细胞体系有关的组合物和方法
US10716811B2 (en) * 2016-01-11 2020-07-21 Rubius Therapeutics Inc. Compositions and methods related to multimodal therapeutic cancer indications
EP4019026A1 (en) 2016-01-11 2022-06-29 Rubius Therapeutics, Inc. Compositions and methods related to multimodal therapeutic cell systems for cancer indications
US10568910B2 (en) 2016-01-11 2020-02-25 Rubius Therapeutics, Inc. Compositions and methods related to engineered erythroid cells comprising IL-15
JP2021078519A (ja) * 2016-01-11 2021-05-27 ルビウス セラピューティクス, インコーポレイテッド がん適応症のためのマルチモーダル治療用細胞系に関連する組成物および方法
JP7093302B2 (ja) 2016-01-11 2022-06-29 ルビウス セラピューティクス, インコーポレイテッド がん適応症のためのマルチモーダル治療用細胞系に関連する組成物および方法
US10517897B1 (en) 2016-01-11 2019-12-31 Rubius Therapeutics, Inc. Methods related to engineered erythoid cells comprising 4-1BBL
WO2017123644A1 (en) 2016-01-11 2017-07-20 Rubius Therapeutics, Inc. Compositions and methods related to multimodal therapeutic cell systems for immune indications
WO2017123646A1 (en) 2016-01-11 2017-07-20 Rubius Therapeutics, Inc. Compositions and methods related to multimodal therapeutic cell systems for cancer indications
US20190083540A1 (en) * 2016-01-11 2019-03-21 Rubius Therapeutics, Inc. Compositions and methods related to multimodal therapeutic cell systems for cancer indications
JP2019501654A (ja) * 2016-01-11 2019-01-24 ルビウス セラピューティクス, インコーポレイテッド がん適応症のためのマルチモーダル治療用細胞系に関連する組成物および方法
CN108778318A (zh) * 2016-01-14 2018-11-09 北卡罗莱纳州立大学 葡萄糖响应性胰岛素递送组合物和方法
US11896673B2 (en) 2016-01-14 2024-02-13 North Carolina State University Glucose responsive insulin delivery compositions and methods
CN108778318B (zh) * 2016-01-14 2022-05-03 北卡罗莱纳州立大学 葡萄糖响应性胰岛素递送组合物和方法
US11702651B2 (en) 2016-08-03 2023-07-18 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US10113163B2 (en) 2016-08-03 2018-10-30 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11999947B2 (en) 2016-08-03 2024-06-04 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US10947530B2 (en) 2016-08-03 2021-03-16 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
US12084663B2 (en) 2016-08-24 2024-09-10 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
WO2018102740A1 (en) 2016-12-02 2018-06-07 Rubius Therapeutics, Inc. Compositions and methods related to cell systems for penetrating solid tumors
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
US11820969B2 (en) 2016-12-23 2023-11-21 President And Fellows Of Harvard College Editing of CCR2 receptor gene to protect against HIV infection
WO2018151829A1 (en) 2017-02-17 2018-08-23 Rubius Therapeutics, Inc. Functionalized erythroid cells
US11020435B2 (en) 2017-02-17 2021-06-01 Rubius Therapeutics, Inc. Functionalized erythroid cells
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12516308B2 (en) 2017-03-09 2026-01-06 President And Fellows Of Harvard College Suppression of pain by gene editing
US12435331B2 (en) 2017-03-10 2025-10-07 President And Fellows Of Harvard College Cytosine to guanine base editor
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
WO2019017937A1 (en) 2017-07-19 2019-01-24 Rubius Therapeutics, Inc. COMPOSITIONS AND METHODS ASSOCIATED WITH MULTIMODAL THERAPEUTIC CELLULAR SYSTEMS FOR THE TREATMENT OF CARDIOMETABOLIC DISEASE
WO2019017940A1 (en) 2017-07-19 2019-01-24 Rubius Therapeutics, Inc. COMPOSITIONS AND METHODS ASSOCIATED WITH MULTIMODAL THERAPEUTIC CELLULAR SYSTEMS FOR THE TREATMENT OF INFECTIOUS DISEASE
US12359218B2 (en) 2017-07-28 2025-07-15 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
WO2019040516A1 (en) 2017-08-22 2019-02-28 Rubius Therapeutics, Inc. METHODS AND COMPOSITIONS OF LIPID NANOPARTICLES FOR THE PRODUCTION OF MODIFIED ERYTHROID CELLS
EP4328314A2 (en) 2017-08-22 2024-02-28 Tessera Therapeutics, Inc. Lipid nanoparticle methods and compositions for producing engineered erythroid cells
WO2019040649A1 (en) * 2017-08-23 2019-02-28 Whitehead Institute For Biomedical Research PRODUCTION OF REDUCED GLOBULATES AND USES THEREOF
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11932884B2 (en) 2017-08-30 2024-03-19 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
WO2019090148A2 (en) 2017-11-03 2019-05-09 Rubius Therapeutics, Inc. Compositions and methods related to therapeutic cell systems for tumor growth inhibition
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
WO2019133881A1 (en) 2017-12-29 2019-07-04 Rubius Therapeutics, Inc. Gene editing and targeted transcriptional modulation for enginerering erythroid cells
WO2019140116A2 (en) 2018-01-10 2019-07-18 Rubius Therapeutics, Inc. Amplifiable rnas for therapeutic cell systems
US11141433B2 (en) 2018-03-08 2021-10-12 Rubius Therapeutics, Inc. Therapeutic cell systems and methods for treating cancer and infectious diseases
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof
JP2022513312A (ja) * 2018-09-21 2022-02-07 シティー・ユニバーシティー・オブ・ホンコン 表面修飾細胞外小胞
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
WO2020117852A1 (en) 2018-12-03 2020-06-11 Rubius Therapeutics, Inc. Artificial antigen presenting cells including hla-e and hla-g molecules and methods of use
CN113366102A (zh) * 2018-12-03 2021-09-07 鲁比厄斯治疗法股份有限公司 包含hla-e和hla-g分子的人工抗原呈递细胞和使用方法
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
CN113795263A (zh) * 2019-02-20 2021-12-14 鲁比厄斯治疗法股份有限公司 包含可负载抗原呈递多肽的工程化红系细胞及使用方法
WO2020172472A1 (en) 2019-02-20 2020-08-27 Rubius Therapeutics, Inc. Engineered erythroid cells including loadable antigen-presenting polypeptides and methods of use
US11795452B2 (en) 2019-03-19 2023-10-24 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12509680B2 (en) 2019-03-19 2025-12-30 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11643652B2 (en) 2019-03-19 2023-05-09 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12281303B2 (en) 2019-03-19 2025-04-22 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11447770B1 (en) 2019-03-19 2022-09-20 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12570972B2 (en) 2019-03-19 2026-03-10 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
US11970718B2 (en) 2020-01-13 2024-04-30 Carmine Therapeutics Pte. Ltd. Nucleic acid loaded extracellular vesicles
WO2021162731A1 (en) 2020-02-10 2021-08-19 Rubius Therapeutics, Inc. Engineered erythroid cells including hla-g polypeptides and methods of use thereof
CN115335064B (zh) * 2020-03-20 2024-08-30 西湖生物医药科技(杭州)有限公司 修饰的红细胞及其用于递送药剂的用途
WO2021185359A1 (en) * 2020-03-20 2021-09-23 Westlake Therapeutics (Hangzhou) Co. Limited Modified red blood cells and uses thereof for delivering agents
CN115335064A (zh) * 2020-03-20 2022-11-11 西湖生物医药科技(杭州)有限公司 修饰的红细胞及其用于递送药剂的用途
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US12031126B2 (en) 2020-05-08 2024-07-09 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US20230226218A1 (en) * 2020-05-11 2023-07-20 Erytech Pharma Red Cell Extracellular Vesicles (RCEVs) Containing Cargoes and Methods of Use and Production Thereof
WO2022089605A1 (en) * 2020-10-30 2022-05-05 Westlake Therapeutics (Hangzhou) Co. Limited Modified red blood cells and uses thereof for delivering agents
WO2022104109A1 (en) 2020-11-13 2022-05-19 Catamaran Bio, Inc. Genetically modified natural killer cells and methods of use thereof
WO2022150578A1 (en) 2021-01-08 2022-07-14 Rubius Therapeutics, Inc. Methods of treating a tumor in a human subject
WO2022150569A1 (en) 2021-01-08 2022-07-14 Rubius Therapeutics, Inc. METHODS OF INCREASING NKp30-POSITIVE LYMPHOCYTES IN A SUBJECT AND USES THEREOF
WO2022164392A1 (en) * 2021-01-29 2022-08-04 National University Of Singapore Surface modified red blood cells and methods of generating the same
WO2022197548A1 (en) 2021-03-14 2022-09-22 Rubius Therapeutics, Inc. Methods of increasing nkg2d-positive lymphocytes in a subject and uses thereof
WO2022211740A1 (en) 2021-03-31 2022-10-06 Carmine Therapeutics Pte. Ltd. Extracellular vesicles loaded with at least two different nucleic acids
WO2022256646A1 (en) 2021-06-03 2022-12-08 Rubius Therapeutics, Inc. Methods of treating hpv16-positive or hpv16-associated cancer in a subject
WO2023284742A1 (en) * 2021-07-13 2023-01-19 Westlake Therapeutics (Hangzhou) Co. Limited Cells modified by conjugated n-terminal glycine and uses thereof
WO2024088213A1 (en) * 2022-10-24 2024-05-02 Westlake Therapeutics (Shanghai) Co., Limited Combination to induce specific immune tolerance

Also Published As

Publication number Publication date
JP2016519933A (ja) 2016-07-11
US11992505B2 (en) 2024-05-28
HK1222662A1 (zh) 2017-07-07
JP6960177B2 (ja) 2021-11-05
US20180280440A1 (en) 2018-10-04
JP6599848B2 (ja) 2019-10-30
EP3546484B1 (en) 2021-09-08
JP2020018317A (ja) 2020-02-06
EP2994491A2 (en) 2016-03-16
EP3693398A1 (en) 2020-08-12
AU2014262474A1 (en) 2015-12-17
ES2901383T3 (es) 2022-03-22
WO2014183071A3 (en) 2015-01-29
JP2022001063A (ja) 2022-01-06
US11266695B2 (en) 2022-03-08
US20200069736A1 (en) 2020-03-05
US10471099B2 (en) 2019-11-12
AU2019283766B2 (en) 2022-01-27
EP2994491A4 (en) 2016-12-07
EP3546485A1 (en) 2019-10-02
AU2019283766A1 (en) 2020-01-16
EP3546484A1 (en) 2019-10-02
AU2014262474B2 (en) 2019-10-31
US20160082046A1 (en) 2016-03-24

Similar Documents

Publication Publication Date Title
US11992505B2 (en) In vitro production of red blood cells with proteins comprising sortase recognition motifs
EP3518981A1 (en) Delivery of therapeutic rnas via arrdc1-mediated microvesicles
EP3692063A1 (en) Hpv-specific binding molecules
US20200206269A1 (en) Production of enucleated red blood cells and uses thereof
US10472408B2 (en) Fusion proteins comprising partial tetraspanin sequences and a system thereof for presenting peptides on the cell surface
WO2023170681A1 (en) Lentiviral vectors for in vivo targeting of immune cells
US20250207168A1 (en) Production cells
HK40034057A (en) In vitro production of red blood cells with sortaggable proteins
HK40014485A (en) In vitro production of red blood cells with sortaggable proteins
HK40014900A (en) In vitro production of red blood cells with sortaggable proteins
HK40014900B (en) In vitro production of red blood cells with sortaggable proteins
US20250312479A1 (en) Receptor engagement-mediated enhancement of biologics delivery
CA3130645A1 (en) Use of an improved sleeping beauty transposase with increased solubility to facilitate and control transfection of a target cell with a transgene
Cordes Targeted gene transfer to enhance safety and efficacy of immunotherapy
HK40119822A (zh) 改进的生产细胞

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14795167

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2016513129

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2014795167

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2014262474

Country of ref document: AU

Date of ref document: 20140509

Kind code of ref document: A

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14795167

Country of ref document: EP

Kind code of ref document: A2