WO2014106649A1 - Selective nox-1 inhibitor peptides and uses thereof - Google Patents

Selective nox-1 inhibitor peptides and uses thereof Download PDF

Info

Publication number
WO2014106649A1
WO2014106649A1 PCT/EP2014/050063 EP2014050063W WO2014106649A1 WO 2014106649 A1 WO2014106649 A1 WO 2014106649A1 EP 2014050063 W EP2014050063 W EP 2014050063W WO 2014106649 A1 WO2014106649 A1 WO 2014106649A1
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
seq
skin
noxl
composition
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2014/050063
Other languages
English (en)
French (fr)
Inventor
Hamid Reza Rezvani
Fréderic Mazurier
Alain Taieb
L'Emira Ghida Harfouche
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Universite Victor Segalen Bordeaux 2
Institut National de la Sante et de la Recherche Medicale INSERM
Original Assignee
Universite Victor Segalen Bordeaux 2
Institut National de la Sante et de la Recherche Medicale INSERM
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=47458818&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2014106649(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to MA38296A priority Critical patent/MA38296B2/fr
Priority to BR112015015242-2A priority patent/BR112015015242B1/pt
Priority to EP14700063.2A priority patent/EP2941268B1/en
Priority to CN201480003978.1A priority patent/CN105007933A/zh
Priority to RU2015132087A priority patent/RU2699726C2/ru
Priority to CA2894576A priority patent/CA2894576A1/en
Priority to DK14700063.2T priority patent/DK2941268T3/da
Application filed by Universite Victor Segalen Bordeaux 2, Institut National de la Sante et de la Recherche Medicale INSERM filed Critical Universite Victor Segalen Bordeaux 2
Priority to AU2014204309A priority patent/AU2014204309B2/en
Priority to JP2015551182A priority patent/JP6488237B2/ja
Priority to US14/758,991 priority patent/US20170000842A9/en
Publication of WO2014106649A1 publication Critical patent/WO2014106649A1/en
Priority to TNP2015000295A priority patent/TN2015000295A1/fr
Priority to IL239762A priority patent/IL239762B/en
Anticipated expiration legal-status Critical
Priority to US15/667,737 priority patent/US10517919B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/08Peptides having 5 to 11 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/005Enzyme inhibitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/44Oxidoreductases (1)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/645Polycationic or polyanionic oligopeptides, polypeptides or polyamino acids, e.g. polylysine, polyarginine, polyglutamic acid or peptide TAT
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00Cosmetics or similar toiletry preparations
    • A61K8/18Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64Proteins; Peptides; Derivatives or degradation products thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/08Drugs for disorders of the urinary system of the prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/16Emollients or protectives, e.g. against radiation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/18Antioxidants, e.g. antiradicals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q17/00Barrier preparations; Preparations brought into direct contact with the skin for affording protection against external influences, e.g. sunlight, X-rays or other harmful rays, corrosive materials, bacteria or insect stings
    • A61Q17/04Topical preparations for affording protection against sunlight or other radiation; Topical sun tanning preparations
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00Preparations for care of the skin
    • A61Q19/08Anti-ageing preparations
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0012Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7)
    • C12N9/0036Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on NADH or NADPH (1.6)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y106/00Oxidoreductases acting on NADH or NADPH (1.6)
    • C12Y106/03Oxidoreductases acting on NADH or NADPH (1.6) with oxygen as acceptor (1.6.3)
    • C12Y106/03001NAD(P)H oxidase (1.6.3.1), i.e. NOX1
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2800/00Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
    • A61K2800/74Biological properties of particular ingredients
    • A61K2800/78Enzyme modulators, e.g. Enzyme agonists
    • A61K2800/782Enzyme inhibitors; Enzyme antagonists

Definitions

  • the invention relates to novel peptides, compositions and methods for the prevention and/or treatment of pathological conditions and diseases associated with NADPH oxidase 1 (Noxl) activity, and/or increased reactive oxygen species (ROS) production.
  • the novel peptides are thus particularly useful for treating and/or preventing cancer, atherosclerosis, angiogenesis, and aging.
  • Noxl generates ROS in physiological conditions and certain pathological conditions.
  • ROS are known to contribute to damage within organisms and are thus associated with many different conditions.
  • NADPH oxidases are also known as a source of oxidative stress, which contributes to the cause of many conditions.
  • Noxl expression is known to be associated with many different conditions, including cancers.
  • Therapeutic selectivity without toxicity is clearly important in a therapeutic agent.
  • preferential killing of cancer cells without toxicity to normal cells is one of the most important considerations in cancer therapy.
  • Nox NADPH oxidases
  • gp91ds-tat peptide Several cell-permeable peptide inhibitors, such as gp91ds-tat peptide, PR-39, as well as Rac peptide inhibitors have been also tested.
  • the gp9 lds-tat peptide was designed to inhibit specifically Nox2 by mimicking a sequence of Nox2 that is thought to be important for the interaction with p47phox.
  • the peptide lacked specificity since the region targeted by the peptide is homologous in other NOX isoforms.
  • the peptide had a low-efficacy inhibitor, inhibiting neutrophil ROS generation by 25% at 50 mM.
  • GenKyoTex developed more specific Nox inhibitors using Pyrazolo- pyrido-diazepine, -pyrazine and -oxazine dione derivatives, targeting in particular Noxl and Nox4 enzymes.
  • GenKyoTex is currently conducting a Phase I clinical with a small molecule, GKT137831 for the treatment of diabetic nephropathy.
  • Preclinical experiments are also conducted for the treatment of diabetic nephropathy, atherosclerosis, idiopathic pulmonary fibrosis, liver fibrosis and models of angiogenesis.
  • GKT137831 while being specific for Noxl/Nox4, GKT137831 also shows affinity for Nox2, Nox3, and Nox5, and thus has a low selectivity.
  • DPI diphenylene iodonium
  • AEBSF 4-(2-aminoethyl)-benzensulfonyl fluoride hydrochloride
  • Apocynin which was extracted from Picrorhiza kurroa, can prevent the formation of the active oxidase complex.
  • the inhibitory effect of apocynin is however controversial. In fact, it was shown that apocynin is not specific for NADPH oxidases, but rather influences other events such as Thromboxane A2 formation and the induction of AP-1 transcription factor, and that it is an antioxidant, rather than a Nox enzyme inhibitor.
  • Diphenylene iodonium is an unspecific inhibitor of all flavoenzymes, and thus can inhibit the Nox enzymes, but also xanthine oxidase and cytochrome P450 enzymes. In addition of being non-selective, DPI has been showed to be toxic. It is also an inhibitor of acetylcholinesterase and butyrylcholinesterase as well as of the internal Ca 2+ pump, which in addition to its intrinsic toxicity raises major concerns on its application.
  • AEBSF Aminoethyl-benzenesulfono-fluoride
  • VAS2870 which is a thiotriazolopyrimidine compound which inhibits PDGF-dependent Src activation of Nox enzymes
  • ACE inhibitors angiotensin converting enzyme inhibitors
  • ARBs Ang II receptor blockers
  • phosphodiesterase eicosanoids
  • corticosteroids eicosanoids
  • MAP kinase protein kinase C inhibitors (such as a benzo(b)pyran-4-one derivative, S17834 of Shionogi Pharma).
  • Noxl NADPH oxidase- 1
  • novel peptides according to the present invention are thus also particularly advantageous as they do not have non-specific ROS scavenging or antioxidant activity and they do not inhibit other sources of ROS.
  • the peptide inhibitors are very specific for their target protein, thereby reducing the likelihood of off-target effect.
  • the peptides according to the present invention showed no toxic effect in vivo. Furthermore, they are easy to design and produce.
  • the present invention thus provides a peptide per se comprising an amino acid sequence comprising at least 7 to 35 continuous amino acids, comprising a portion of the following amino acid general sequence X1-P-X2-X3-P-X4-R (SEQ ID NO: 1), wherein XI is A, P or Q; X2 is P, T, V, A, S, C, M or K; X3 is L, I, V or A, and X4 is T, V, S, A, M.
  • Such peptides are particularly useful in a method of preventing and/or treating a pathological condition or disease associated either with Noxl activity and/or increased reactive oxygen species (ROS) production.
  • ROS reactive oxygen species
  • the present invention is directed towards novel selective peptides which are capable of selectively inhibiting Noxl activation, and are designated hereinafter Noxl inhibitor peptides.
  • These novel peptides are thus useful as medicament, as photoprotection agent and/or as anti-aging agent. They may optionally be conjugated to a cell penetrating peptide or an agent which increases the accumulation of said peptide in a cell (cell carrier).
  • the present invention concerns compositions comprising an effective amount of the Noxl inhibitor peptides according to the present invention, as well as pharmaceutical compositions comprising a therapeutically effective amount of the Noxl inhibitor peptides and a pharmaceutically acceptable vehicle or excipient, and cosmetic compositions.
  • the novel Noxl inhibitor peptides and compositions according to the present invention may be advantageously be used in a method of treating and/or preventing of oxygen-radical mediated diseases, and more specifically NADPH Oxidase- 1 /Noxl related disorders, including cardiovascular disorders, angiogenesis-dependant disorders, respiratory disorders, skin disorders, neurodegenerative disorders, allergic and autoimmune disorders, gastrointestinal disorders, cancers, and diseases related to impaired metabolism. Most particularly, they are useful in a method of treating and/or preventing vascular and cardiovascular diseases, cancer diseases, such as colon cancer and skin cancer, as well as skin disorders, UV skin damage, skin conditions due to aging, ROS induced skin damage, premature aging, and/or skin tumorigenesis following UV exposition (UV A or UV B).
  • the present invention relates to a method of decreasing the levels of reactive oxygen species (ROS) and/or inhibiting production of reactive oxygen species (ROS) in a subject in need, and particularly a method of selectively reducing and/or inhibiting NADPH oxidase 1 (Noxl) activity comprising administering a therapeutically effective amount of the novel Noxl inhibitor peptides or compositions.
  • ROS reactive oxygen species
  • Noxl NADPH oxidase 1
  • the present invention concerns as a method of treating and/or preventing oxygen-radical mediated diseases, and more specifically NADPH Oxidase-l/Noxl related disorders, including cardiovascular disorders, angiogenesis-dependant disorders, respiratory disorders, skin disorders, neurodegenerative disorders, allergic and autoimmune disorders, gastrointestinal disorders, cancers such as colon cancers and skin cancers, and diseases related to impaired metabolism.
  • the methods of the present invention are also useful for treating and/or preventing skin disorders, UV skin damage, skin conditions due to aging, ROS induced skin damage, premature aging and/or skin tumorigenesis following UV exposition (UV A or UV B).
  • the present invention relates to a process for preparing the novel peptides as well as peptides which are optionally conjugated to a cell penetrating peptide or a cell carrier.
  • Figures 1A and IB show the cytotoxic effect of each peptide tested on normal primary human keratinocytes using trypan blue exclusion assay and MTT assay.
  • human keratinocytes were treated with different concentrations of the peptides A (SEQ ID NO: 41), B (SEQ ID NO: 42), and C (SEQ ID NO: 43) and the viability was measured 24, 48 and 72 hours post-treatment using the trypan blue dye (A) and the MTT assay (B).
  • the percentage of viability in treated keratinocytes was normalized to the non-treated cells (NTC).
  • Figures 2 A and 2B show the relative ROS level as measured in primary human keratinocytes and HT29 (human colon adenocarcinoma cell line) treated with 10 or 50 ⁇ of peptide inhibitor for 24 h using the CM-H2DCF-DA probes.
  • Cells were treated with 10 ⁇ of the peptides A (SEQ ID NO: 41), B (SEQ ID NO: 42), and C (SEQ ID NO: 43), and the ROS level was measured 24 h post-treatment.
  • ROS level was normalized to non-treated cells (NTC) (*P ⁇ 0.05).
  • Figures 3A, 3B and 3C show inhibition of endogenous Noxl and Nox2 protein expression using lenti virus-mediated expression of shRNA against Noxl and Nox2. Keratinocytes were transduced with different shRNA (shNoxl, shNox2 and the control shCtrl). Transduction efficacy was checked by western blotting analysis.
  • Figure 3 A shows that both shNoxl and shNox2 stably inhibited more than 80% of Noxl and Nox2 expression, respectively.
  • Transduction efficacy was checked by western blotting analysis.
  • Relative ROS level (3B) and Nox activity (3C) were measured 24 h post-treatment with Noxl inhibitor peptide A compared to control peptide C.
  • ROS level was normalized to counterpart peptide C-treated cells. NADPH oxidase activity was measured by relative luminescence unit (RLU) per ⁇ g of proteins. *P ⁇ 0.05. As per Figure 3B measurement of ROS level revealed that treatment with peptide inhibitor A had no effect on steady-state levels of ROS in shNoxl -transduced cells, indicating that peptide A blocked Noxl -dependent ROS generation with very high (near 100%) efficiency and specificity. In Figure 3C NADPH oxidase activity was measured in shCtrl and shNoxl -transduced cells treated with or without Noxl inhibitor peptide A.
  • RLU relative luminescence unit
  • Figures 4A, 4B, and 4C show the inhibition of ROS production and NADPH oxidase activity and thus the photo protection effect on human and murin keratinocytes of Noxl inhibitor peptide A.
  • Keratinocytes isolated from human biopsies (Ker human) and mouse epidermis (Ker mouse) were treated with 10 ⁇ of either Noxl inhibitor peptide A or control scramble peptide C.
  • the ROS level (4A) and the NADPH oxidase activity (4B) were measured 24 h post-treatment.
  • the activity of NADPH oxidase in both human and mouse keratinocytes treated with control scramble peptide (C) was arbitrarily set to 100%.
  • the % of inhibition of NADPH oxidase activity upon treatment with Noxl inhibitor peptide A was then assessed (4C).
  • Figures 5A and 5B show effect of peptide A on Noxl activity in mouse skin.
  • SKH-1 mice were treated topically with different doses: 0.4, 3 and 12 mg/kg (3 mice per dose) of Noxl inhibitor peptide A.
  • Skin biopsies were harvested 2 h, 24 h, 48 h and 72 h post-treatment and the NADPH oxidase activity was measured (RLU ⁇ g of proteins). Results was normalized to the non-treated (NT) mice and expressed as % of inhibition of Nox activity.
  • Skin biopsies were harvested 2 h, 24 h. At 46 h after first treatment, mice were treated again with the same concentration of peptide A and exposed to UVB 10 min later. Skin biopsies were then harvested at 2 h, 24 h (i.e. 48 and 72 h after first treatment, respectively). The NADPH oxidase activity was measured (RLU ⁇ g of proteins) and was normalized to the non-treated (NT) and non-irradiated mice.
  • Figure 6A, 6B and 6C show the photoprotective effects of peptide A on UVB-induced squamous cell carcinomas (SCC) induction using SKH-1 hairless mice.
  • Mice were treated topically with 3 mg/kg of peptide A or control peptide, and irradiated with UVB 10 min later three times per week.
  • the number (6A) and the size (6B) of tumors were assessed once a week during 29 weeks (6C). The tumor volume distribution was evaluated at week 29.
  • Figure 7 shows a significant decrease in NADPH oxidase activity in both non-tumor bearing skin and UVB-induced tumors in SKH-1 mice treated with peptide A or control peptide. Mice were sacrificed after 29 weeks of treatment. Non-tumor bearing skin and tumors were harvested from irradiated mice treated with peptide A or the vehicle. NADPH oxidase activity was measured as RLU ⁇ g of proteins in non-tumor bearing skin and UVB-induced tumors. Relative inhibition of Nox activity in non-tumor bearing skin and tumors was evaluated following arbitrary setting the Nox activity in non-tumor bearing skin and tumors taken from vehicle treated-mice to 100%. Results were then expressed as the average percentage of vehicle -treated mice.
  • Figures 8A and 8B show that the peptide A without tat can inhibit Nox activity as efficiently as peptide A. Moreover, the smaller peptides derived from peptide A efficiently inhibit the NADPH oxidase activity. Keratinocytes were treated with 10 ⁇ of the indicated peptides: scramble control peptide PI (SEQ ID NO: 57), peptide A with tat sequence (SEQ ID NO: 41) or without the tat sequence (SEQ ID NO:20); shorter peptides P7 (SEQ ID NO: 2) and P8 (SEQ ID NO: 56) (Fig 8A). The NADPH oxidase activity was measured 24 h post-treatment (RLU ⁇ g of proteins) and was normalized to the scramble treated cells (Fig. 8B).
  • Figures 9A and 9B show the progerin expression in skin biopsies of young and old XPC proficient (XPC + + ) and deficient (XPC 7 ) mice. Young mice were 4 months old and old mice were 1.5 year old.
  • A Total protein extracts of skin biopsies were assessed for progerin by Western blot analysis, ⁇ -actin was used as a loading control.
  • B The protein bands corresponding to progerin was quantified and normalized with ⁇ -actin. The average density ⁇ SD from six mice in each group is presented as the relative value to the density in young wild type mice.
  • Figures 10A, 10B and IOC show the effects of XPC deficiency on Nox activity and OXPHOS complexes expression.
  • NOX activity was measured (RLU/ug protein) in skin biopsies of young and old XPC + + and XPC 7 mice. Results were normalized to the young wild type mice.
  • B Expression of OXPHOS complexes were assessed by western blot analysis in young and old proficient and deficient XPC mice.
  • C The bands corresponding to different OXPHOS complexes were quantified and normalized with ⁇ -actin. The average density ⁇ SD from six mice in each group is presented as the relative value to the density in young wild type mice.
  • Figures 11A and 11B show the effect of NOX1 inhibitor peptide A (InhNOX) on progerin expression in skin biopsies of young XPC + + and XPC 7" mice.
  • InhNOX NOX1 inhibitor peptide A
  • mice One month old mice were treated topically with 3 mg/kg (6 mice per group) Noxl inhibitor peptide A (InhNOX) or control peptide (vehicle) three times per week for three months.
  • A Total protein extracts of skin biopsies were assessed for progerin by Western blot analysis, ⁇ -actin was used as a loading control.
  • B The protein bands corresponding to progerin was quantified and normalized with ⁇ -actin.
  • FIGS. 12A and 12B show the effects of Noxl inhibitor peptide A (InhNOX) on protein expression of OXPHOS complexes in skin biopsies of young XPC + + and XPC 7 mice. One month old mice were treated topically with 3 mg/kg (6 mice per group) Noxl inhibitor peptide A (InhNOX) or control peptide (vehicle) three times per week for three months.
  • InhNOX Noxl inhibitor peptide A
  • control peptide vehicle
  • the present invention is directed towards novel selective peptides which are capable of selectively inhibiting Noxl activation, by specifically blocking NADPH oxidase-1 assembly and consequently its activation, as well as their applications as medicament, and photoprotection agents.
  • the invention thus relates to both therapeutic and cosmetic methods.
  • These peptides may be designated hereinafter as Noxl inhibitor peptides.
  • Additional modifications may entail peptide penetration into the cells for targeting proteins in the cytosol.
  • An example of a successful method is adding an arginine rich sequence or a tat sequence.
  • the peptides according to the present invention have been selected based on their potential abilities to compete with Noxl assembly through interacting with Noxl.
  • the individuals who will be treated include humans and animals, preferably mammals, such as rodents and primates.
  • the individual may be non-human animal or non-human mammal.
  • the individual may have any of the conditions mentioned herein or may be at risk of developing them.
  • human individuals they may be at least 50 years old, such as at least 60 or 70 years old.
  • SEQ ID NO: 44 the PRR region of NoxOl
  • SEQ ID NO: 45 the SH3 region of NoxAl
  • They will normally comprise 5 to 35 amino acids, or 5 to 20 amino acids, or 7 to 20 contiguous amino acids from SEQ ID NO:44 or SEQ ID NO:45.
  • SEQ ID NO: 44 is PPTVPTRPSPGAIQSRCCTVTRRAL and SEQ ID NO: 45 is QVVAQHSYSAQGPEDLGFRQGDTVDVLCEEPDVPLAVDQAWLEGHCDGRIGIFPKCFVVP AGPRM.
  • the peptide of the invention typically comprises two distinct sequences. One of these is generally referred to as the 'portion' herein and this is responsible for the therapeutic activity of the peptide discussed herein.
  • the portion may generally have a length of 5 to 20 amino acids, or 7 to 20 amino acids such as 7 to 19; 7 to 18; 7 to 17; 7 to 16; 7 to 15; 7 to 14; 7 to 13; 7 to 12; 7 to 11; 7 to 10; preferably 7 to 18; 7 to 15; 7 to 10; around 7 amino acids; or 8 to 18; 8 to 15; 8 to 10 amino acids.
  • the second distinct sequence, or any of the remainder of the sequence, within the peptide may provide additional advantageous properties to the peptide.
  • This second part of the peptide may be absent, and so in one embodiment the peptide consists only of the 'portion' sequence described above which confers therapeutic properties, Le ⁇ , the length of the portion and peptide are the same.
  • the second sequence is typically 0 to 31 amino acids in length, such as 5 to 30, 7 to 30, 10 to 25 or 15 to 20 amino acids in length.
  • the second sequence may be a cell penetrating peptide, which is identical to or homologous with any of the specific cell penetrating peptides, mentioned herein.
  • the peptide typically has a length of 7 to 35 amino acids, or 7 to 30, or 7 to 20, or 7 to 15, or 7 to 10, or around to 7, 8, 9 or 10 amino acids long, or preferably 7, 8, or 9, and most preferably 7 amino acids long.
  • the said peptide or portion may be, or may comprise a sequence as set forth in the general following amino acid general formula X1-P-X2-X3-P-X4-R (SEQ ID NO: l),
  • XI is A, P or Q
  • X2 is P, T, V, A, S, C, M or K
  • X3 is L, I, V or A
  • X4 is T, V, S, A or M.
  • the said peptide or portion may be, or may also comprise, any of the sequences as listed in the Table 1 below or may be a homologue thereof:
  • PPTVPTR SEQ ID NO : 2
  • PPSVPTR SEQ ID NO: 3
  • PPMVPTR SEQ ID NO: 4
  • PPCVPTR SEQ ID NO: 5
  • PPPVPTR SEQ ID NO: 6
  • PPAVPTR SEQ ID NO: 7
  • PPTVPSR SEQ ID NO : 9
  • PPTVPMR SEQ ID NO : 10.
  • APTVPTR (SEQ ID NO: 19)
  • the said peptide or portion may be, or may also comprise, any of the sequences as listed in the Tables 2 and 3 below or may be a homologue thereof:
  • PPTVPTRPS SEQ ID NO: 20
  • IQSRCCTVT SEQ ID NO: 21
  • LGFRQGDTVD (SEQ ID NO:34)
  • VLCEEPDVPL (SEQ ID NO:36)
  • the present invention also provides a peptide or a portion comprising an amino acid sequence of at least 7 to 35 continuous amino acids, 7 to 30 continuous amino acids, or 7 to 20 continuous amino acids which may be identical to or have homology with a fragment of SEQ ID NO:44 (PRR region of NoxOl) or SEQ ID NO:45 (SH3 region of NoxAl). Suitable levels of homology are discussed in the section below relating to homology, and include for example analogues or conservative variants thereof.
  • the sequence of the therapeutic portion or peptide has 75%, 80%, 85%, 87%, 90%, 93%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 44 or SEQ ID NO: 45.
  • said peptide is for use in a method of preventing and/or treating a pathological condition or disease associated either with Noxl activity and/or increased reactive oxygen species (ROS) production.
  • ROS reactive oxygen species
  • the said peptide is 7 to 15 amino acids long and/or said portion is preferably 7 to 10 amino acids long, more preferably around 7 amino acids long.
  • the said peptide is identical to at least 7 contiguous amino acids of SEQ ID NO: 44 (PRR region of NoxOl) or SEQ ID NO: 45 (SH3 region of NoxAl), or has at least 80%, or 85%, or 90% or 95% identity to SEQ ID NO: 44 or SEQ ID NO: 45.
  • homologous sequences are mentioned herein.
  • the homologous sequences may represent the therapeutic 'portion' sequence within the peptide or be the second (remainder) sequence in the peptide of the invention.
  • the homologous sequences may be homologous of any of the specific sequences mentioned herein.
  • a homologue has one or more (such as a least 2, 3, 4 or 5) additions and/or deletions and/or substitutions in comparison to the original sequence.
  • the homologous sequence may comprise at least 70%, at least 75%, at least 80%, at least 85%, at least 87%, at least 90%, at least 95%, 96%, 97%, 98%, or at least 99% amino acid identity over the length of the original sequence or over 4, 6, 10, 15 or 20 amino acids of the original sequence.
  • sequence identity typically refer to sequences which have the stated value when assessed using ClustalW (Thompson et al., 1994, supra) with the following parameters: Pairwise alignment parameters -Method: accurate, Matrix: PAM, Gap open penalty: 10.00, Gap extension penalty: 0.10; Multiple alignment parameters -Matrix: PAM, Gap open penalty: 10.00, % identity for delay: 30, Penalize end gaps: on, Gap separation distance: 0, Negative matrix: no, Gap extension penalty: 0.20, Residue-specific gap penalties: on, Hydrophilic gap penalties: on, Hydrophilic residues: G, P, S, N, D, Q, E, K. Sequence identity at a particular residue is intended to include identical residues which have simply been derivatized.
  • the homologous sequence may have 1 , 2, 3, 4, 5 or more, or up to 10 amino acid substitutions in comparison to the original sequence.
  • the substitutions are preferably conservative substitutions. These may be made according to the Table 4 below. Amino acids in the same block in the second column and preferably in the same line in the third column may be substituted for each other.
  • the peptides of the present invention may be produced by any suitable method known in the art, such as chemical synthesis and/or recombinant DNA technology.
  • the inventive peptide can be synthesized using solid phase peptide synthesis techniques (e.g., Fmoc).
  • the peptide can be synthesized using recombinant DNA technology (g ⁇ g., using bacterial or eukaryotic expression systems).
  • a nucleotide sequence encoding a polypeptide of the invention may be constructed by isolating or synthesizing a nucleotide sequence encoding the parent peptide and then changing the nucleotide sequence so as to effect introduction (i.e. insertion or substitution) or removal (i.e.
  • a variant of a peptide may be naturally occurring or it may be a variant that is not known to occur naturally.
  • Non-naturally occurring variants of peptides may be made by direct synthesis, or alternatively, mutations can be introduced randomly along all or part of a peptide of this invention, such as by saturation mutagenesis or site -directed mutagenesis in accordance with conventional methods.
  • the resultant variants can be screened for the ability of Inhibiting Noxl and/or ROS to identify variants of this invention.
  • the novel peptides can be isolated and/or purified (or substantially isolated and/or substantially purified). Accordingly, the invention provides the peptide of the first aspect of the present invention in isolated or substantially isolated form (ej*., substantially isolated from other peptides or impurities).
  • the peptide can be isolated from other peptides as a result of solid phase protein synthesis, for example. Alternatively, the peptide can be substantially isolated from other proteins after cell lysis from recombinant production. Standard methods of protein purification (e.g., HPLC) can be employed to substantially purify the inventive peptides.
  • a preparation of the peptide according to the present invention preferably is at least 90% (by weight) free of other peptides and/or contaminants, and more preferably is at least about 95% (by weight) free of other peptides and/or contaminants (such as at least about 97% or 98% (by weight) free of other peptides and/or contaminants).
  • peptide includes not only molecules in which amino acid residues are joined by peptide (-CO-NH-) linkages but also molecules in which the peptide bond is reversed.
  • retro- inverso peptidomimetics may be made using methods known in the art. This approach involves making pseudopeptides containing changes involving the backbone, and not the orientation of side chains. Retro-inverse peptides, which contain NH-CO bonds instead of CO-NH peptide bonds, are much more resistant to proteolysis.
  • the peptide bond may be dispensed with altogether provided that an appropriate linker moiety which retains the spacing between the carbon atoms of the amino acid residues is used; it is particularly preferred if the linker moiety has substantially the same charge distribution and substantially the same planarity as a peptide bond.
  • the peptide may conveniently be blocked at its N-or C-terminus so as to help reduce susceptibility to exoproteolytic digestion.
  • the N-terminal amino group of the peptides may be protected by reacting with a carboxylic acid and the C-terminal carboxyl group of the peptide may be protected by reacting with an amine.
  • modifications include glycosylation and phosphorylation.
  • Another potential modification is that hydrogens on the side chain amines of R or K may be replaced with methylene groups (-NH2 -" -NH(Me) or -N(Me)2).
  • the peptide may be modified in other ways, for example to increase or decrease the peptide's half-life in vivo.
  • peptoid analogues, D-amino acid derivatives, and peptide -peptoid hybrids may be used.
  • a further embodiment of the variant polypeptides used according to the invention comprises D-amino acid forms of the polypeptide.
  • the preparation of polypeptides using D-amino acids rather than L- amino acids greatly decreases any unwanted breakdown of such an agent by normal metabolic processes, decreasing the amounts of agent which needs to be administered, along with the frequency of its administration.
  • the peptide of the invention is capable of reducing Noxl activity, for example by at least 20%, or at least 30%, or at least 35%, 40%, 45%, 50%, 54%, 55%, 56%, 57 %, 58%, 59%, or 60%.
  • the peptide selectively decreases and/or inhibits Noxl activity, but does not inhibit human NADPH oxidases selected among Nox2, Nox4, Nox5, Duoxl, and Duox2. More preferably, the peptides according to the present invention selectively decrease and/or inhibit Noxl activity through abrogating specifically the interaction between NoxOl and NoxAl, but not p47phox and p67phox.
  • the peptides according to the present invention as described herein above are thus Noxl specific inhibitory peptides.
  • the present invention is further directed to methods and compositions for reducing NADPH oxidase or NOX induced ROS-mediated damage to a subject's skin or mucosal membranes.
  • One embodiment of the present invention is a method for inhibiting and reducing NADPH oxidase or NOX induced ROS-mediated damage to a subject's skin or mucosal membranes comprising the step of delivering an effective dose of a peptide according to the present invention in a pharmaceutically acceptable carrier to a subject suffering from NADPH oxidase or NOX induced ROS-mediated damage to said subject's skin or mucosal membranes.
  • the present invention provides methods to modulate NADPH oxidase or NOX induced ROS-mediated free radicals responsible for oxidative tissue damage associated with pre-mature aging.
  • the present invention further generally comprises incorporating peptides according to invention as a nutraceutical and/or pharmaceutical agent in suitable compositions.
  • modulate includes any increase or decrease in the activity of any component of NADPH oxidase or NOX system, specifically Noxl.
  • ROS are highly reactive molecules and can generate diverse damages in the cells, the ROS vicious cycle is believed to account for an exponential increase in oxidative damage during aging, which results in a gradually functional decline that characterizes the aging process.
  • the peptides and their compositions are very effective as photo- protecting agents.
  • Sunlight has a profound effect on the skin causing premature skin aging, skin cancer, and a host of skin changes. Exposure to ultraviolet light, particularly UVA or UVB accounts for 90% of the symptoms of premature skin aging. Skin cancer is a serious consequence of chronic UV exposure.
  • UV radiation from the sun is the main cause of skin cancer. UV rays damage DNA, the genetic material that makes up genes. Genes control the growth and overall health of skin cells. If the genetic damage is severe, a normal skin cell may begin to grow in the uncontrolled, disorderly manner to become cancerous. UV also can cause sunburn, and other damage that makes the skin look prematurely old and wrinkled.
  • Skin cancer can be a basal cell carcinoma, squamous cell carcinoma or malignant melanoma.
  • a composition based on peptides of the invention that enhances photoprotection to both UVA and UVB radiations is described. Such compositions can be used to treat subjects who are predisposed to the risks of skin damage associated with acute or chronic UV exposure.
  • the said composition can be administered through topical, oral or intradermal means.
  • composition can easily be incorporated into topically applied vehicles such as solutions, suspensions, emulsions, oils, creams, ointments, powders, liniments, salves or the like, as a means of administering the active agents directly to a desired area of the skin. Further, the said composition may also be incorporated into oral dosage forms like capsules, tablets, syrups, toffees, chocolates, functional drinks and the like.
  • the present invention provides a method directed to treating and/or preventing skin tumorigenesis following chronic UV exposition (UVA or UVB).
  • the present invention relates to a method of treating skin to provide protection from UV-radiation comprising: applying to the skin a composition comprising a therapeutically effective amount of the Noxl inhibitor peptides as described above, or its analogues or conservative variants thereof wherein the peptide is optionally conjugated or attached to an agent which increases the accumulation of said peptide in a cell.
  • the peptide having a sequence according to the general amino acid formula of SEQ ID NO: 1 or in any of the amino acid sequences as set forth in SEQ ID NOs: 2 to 42, and preferably 2 to 19 may be used.
  • the present invention is directed to a method for the treatment and/or care of skin, mucous membranes, scalp and/or hair which comprises administering a cosmetic or pharmaceutical effective amount of Noxl inhibitor peptides as described above, analogues or conservative variants thereof wherein the peptide is optionally conjugated or attached to an agent which increases the accumulation of said peptide in a cell.
  • the peptide has the SEQ ID NO: 1 or 42.
  • the invention is directed to method for the treatment and/or care for those conditions, disorders and/or pathologies of skin, mucous membranes, scalp and/or hair which are the result of the generation of ROS.
  • Still specifically treatment and/or care afforded by the methods and compositions according to the present invention is photoprotection, protection of cell DNA and/or repair of cell DNA of skin, mucous membranes, scalp and/or hair.
  • the treatment and/or skin care with the compositions of the present invention is done to reduce, postpone and/or prevent signs of aging, photoaging and the like.
  • the disease conditions that may be treated can include skin conditions due to aging or premature aging wherein the peptide according to the invention is administered as an anti-aging agent or a photoprotectant.
  • the present invention also provides a composition that enhances photoprotection to both UVA and UVB induced skin damage, said composition comprising a therapeutically effective amount of a Noxl inhibitor peptide as described above, analogues or conservative variants thereof. Said peptide may be optionally conjugated or attached to an agent, which increases the accumulation of said peptide in a cell.
  • a composition offers a safe, long-term therapeutic solution for subjects in need of enhanced photoprotection to both UVA and UVB rays.
  • a composition can be administered to subjects who are predisposed to the risks of skin cancer due to prolonged UVA and UVB exposure.
  • the present invention relates to a method of selectively reducing or inhibiting or modulating NOX/NADPH oxidase, specifically Noxl activity, function or levels in a subject in need thereof.
  • Said method comprises administering to the subject an effective amount of a Noxl inhibitor peptide as described herein, wherein the peptide is optionally conjugated or attached to an agent which increases the accumulation of said peptide in a cell.
  • the present invention further provides a method of decreasing the levels of reactive oxygen species (ROS) or inhibiting production of reactive oxygen species (ROS), in a subject in need thereof, comprising administering to the subject an effective amount of a Noxl inhibitor peptide as described herein, optionally conjugated or attached to an agent which increases the accumulation of said peptide in a cell.
  • ROS reactive oxygen species
  • ROS reactive oxygen species
  • the peptide is optionally conjugated or attached to an agent, which increases the accumulation of said peptide in a cell.
  • an agent which increases the accumulation of said peptide in a cell.
  • Such conjugation with a suitable agent would render said peptide more membrane permeable, such as cell membrane permeable carriers.
  • agent may be a cell membrane permeable carrier, for example a positively charged amino acid rich peptide, e.g., an arginine rich peptide.
  • arginine rich peptide may be a polyarginine tag having the sequence RRRRRRRRR (SEQ ID NO: 46).
  • NGR peptides may be chosen among the NGR peptide derived from the aminopeptidase (CD13) N Ligand (CNGRCG: SEQ ID NO: 47), or Antennapedia Leader Peptide (CT) (KKWKMRRNQFWVKVQRG: SEQ ID: 48), Bcl-2 Binding Peptide (Decanoyl-KNLWAAQRYGRELRRMSDEFEGSFKGL: SEQ ID NO: 49), a tat sequence (RKKRRQRRR: SEQ ID NO: 50), the buforin (TRSSRAGLQFPVGRVHRLLRK: SEQ ID NO: 51), a peptidic fragment of the Human T-cell Lymphotrophic Virus (HTLV)-II Rex (TRRQRTRRARRNR: SEQ ID NO: 52), the lipid membrane translocating peptide (KKAAAVLLPVLLAAP: SEQ ID NO: 53), the NRP-1 Targeting Peptide, Streptomyces
  • the peptides according to the present invention can be used for prophylaxis and/or treatment of any NADPH oxidases-related disorder which may include cardiovascular diseases and disorders including, but is not limited to, hypertension, atherosclerosis, cardiac hypertrophy, heart failure, myocardial infarction, restenosis, diabetes, diabetic nephropathy, damage to intestinal mucosa (particularly to mucosal lesions of inflammatory bowel disease), neointimal hyperplasia and angina pectoris, other diseases and disorders coinciding with increased NADPH oxidases-mediated superoxide production including, but are not limited to, arthritis, chronic inflammatory bowel diseases (IBD), sepsis and other inflammatory disorders, bronchial asthma, chronic obstructive pulmonary disease (COPD), pulmonary infectious disease, lung fibrosis, Acute Respiratory Distress Syndrome (ARDS), cancer, auto-immune diseases, reperfusion injuries, kidney diseases, stroke, Alzheimer's disease, Parkinson's disease
  • peptides according to the invention can be used for prophylaxis or treatment of any reactive oxygen species (ROS) mediated inflammatory disorder including but not limited to, phosphorylation mediated disorders, polymorphonuclear leucocyte mediated disorders, macrophage mediated disorders, lipopolysaccharide mediated disorders, tumor necrosis factor-a mediated disorders, cytokine IFN- ⁇ mediated disorders, interleukin-2 mediated disorders, inflammatory arthritis, potassium peroxochromate arthritis, rheumatoid arthritis, osteoarthritis or Alzheimer's disease.
  • ROS reactive oxygen species
  • the present invention relates to a treatment or a prophylaxis, wherein the NADPH oxidase 1 (Noxl) activity or ROS activity leads to a disease condition selected from a group comprising of cardiovascular disorders, respiratory disorders, metabolism disorders, skin disorders, bone disorders, CNS disorders, neuro-inflammatory and/or neurodegenerative disorders, kidney diseases, sleep disorders, reproduction disorders, diseases affecting the eye and/or the lens, inflammatory disorders, liver diseases, pain, cancers, tumours Acute renal failure (ARF), allergic disorders, skin disorders, UV damage, skin conditions due to aging, photodamage of the skin, ROS induced skin damage, premature aging, age-related disease or disorder, disorders of the gastrointestinal system, angiogenesis disorders, atherosclerosis, restenosis after stent insertion, and/or hypertension and the like.
  • a disease condition selected from a group comprising of cardiovascular disorders, respiratory disorders, metabolism disorders, skin disorders, bone disorders, CNS disorders, neuro-inflammatory and/or neurodegenerative disorders, kidney diseases, sleep disorders, reproduction
  • the present invention provides a method of inhibiting tumor cell growth in a subject in need thereof comprising administering a therapeutically effective amount of a Noxl inhibitor peptide according to the invention, analogues or conservative variants thereof.
  • Said peptide may be optionally conjugated or attached to an agent which increases the accumulation of said peptide in a cell.
  • the said inhibition of tumor cell growth is inhibition of tumorigenic keratinocyte growth.
  • the said is a method for treating and/or preventing skin tumorigenesis following chronic UV exposition (UVA or UVB).
  • the methods according to the present invention are useful for a host of conditions selected from a group comprising of cancer, ROS induced skin damage, prevention of aging in skin and other age-related disorders, atherosclerosis, restenosis after stent insertion, and/or hypertension and the like.
  • the cancer that is amenable to treatment by the methods according to the present invention is selected from a group comprising of skin cancer, premalignant skin lesions, colon, colon adenocarcinomas, prostate cancers, benign or malignant papilloma and the like.
  • the cancer may be melanoma or a hematopoietic malignancy, such as acute lymphoblastic leukemia (ALL), myelodysplastic syndrome (MDS), or a myeloid leukemia, such as chronic myeloid leukemia (CML) or acute myeloid leukemia (AML). It may be pancreatic cancer.
  • the cancer may be one caused by Ras-induced oncogenic cell transformation, such as colorectal cancer.
  • the cancer may be adenocarcinoma or a Helicobacter pylori infection-induced gastrointestinal neoplasm.
  • the cancer may be caused by papilloma virus.
  • the cancer may be caused by xeroderma pigmentosum type C (XPC) gene silencing.
  • the present invention encompasses cosmetic or pharmaceutical composition
  • cosmetic or pharmaceutical composition comprising a cosmetically or pharmaceutically or therapeutically effective amount of at least one peptide of the invention or mixtures of peptides or the invention with a pharmaceutically acceptable salt, and typically at least one cosmetically or pharmaceutically acceptable excipient or adjuvant.
  • the present invention also provides pharmaceutical or nutraceutical compositions for inhibiting or modulating Noxl activity in a subject, comprising a peptide of the invention.
  • the present invention provides compositions for selectively reducing and/or inhibiting Noxl activity in a subject in need thereof, or compositions for decreasing the levels of reactive oxygen species (ROS) or inhibiting production of reactive oxygen species (ROS) in a subject in need thereof, wherein the said composition comprises an efficient amount of a Noxl inhibitor peptide according to the present invention.
  • the present invention provides a composition for selectively reducing and/or inhibiting Noxl activity and or decreasing the levels of reactive oxygen species (ROS) or inhibiting production of reactive oxygen species (ROS) in a subject in need thereof, comprising an effective amount of a peptide having an amino acid sequence selected among SEQ ID NO: l to 42 and preferably 1 to 19 analogues or conservative variants thereof, wherein the peptide is optionally conjugated or attached to an agent which increases the accumulation of said peptide in a cell.
  • a composition for selectively reducing and/or inhibiting Noxl activity and or decreasing the levels of reactive oxygen species (ROS) or inhibiting production of reactive oxygen species (ROS) in a subject in need thereof comprising an effective amount of a peptide having an amino acid sequence selected among SEQ ID NO: l to 42 and preferably 1 to 19 analogues or conservative variants thereof, wherein the peptide is optionally conjugated or attached to an agent which increases the accumulation of said peptide in a cell.
  • the present invention relates to compositions comprising peptides according to the present invention wherein said composition further comprising a pharmaceutically acceptable excipient or carrier.
  • the present invention relates to the use of the Noxl inhibitor peptides of the present invention as an active ingredient, together with at least one pharmaceutically acceptable carrier, excipient and/or diluents for the manufacture of a pharmaceutical composition for the treatment and/or prophylaxis diseases disclosed herein.
  • Such pharmaceutical compositions comprise the Noxl inhibitor peptide together with at least one pharmaceutically acceptable carrier, excipient, binders, disintegrates, glidents, diluents, lubricants, colouring agents, sweetening agents, flavouring agents, preservatives or the like.
  • the pharmaceutical compositions of the present invention can be prepared in a conventional solid or liquid carrier or diluents and a conventional pharmaceutically-made adjuvant at suitable dosage level in a known way.
  • Administration forms include, for example, pills, tablets, film tablets, coated tablets, capsules, liposomal formulations, micro- and nano-formulations, powders and deposits.
  • the present invention also includes pharmaceutical preparations for parenteral application, including dermal, intradermal, intragastral, intracutaneous, intravasal, intravenous, intramuscular, intraperitoneal, intranasal, intravaginal, intrabuccal, percutaneous, rectal, subcutaneous, sublingual, topical, or transdermal application, which preparations in addition to typical vehicles and/or diluents containing the novel peptides according to the present invention.
  • Techniques for the formulation and administration of the peptide of the present invention may be found in "Remington's Pharmaceutical Sciences” Mack Publishing Co., Easton PA.
  • the peptides of the invention can also be administered in form of its pharmaceutically active salts.
  • Suitable pharmaceutically active salts comprise acid addition salts and alkali or earth alkali salts. For instance, sodium, potassium, lithium, magnesium or calcium salts can be obtained.
  • the Noxl inhibitor peptide or peptide combination of the present invention forms pharmaceutically acceptable salts with organic and inorganic acids.
  • acids for such acid addition salt formation are hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid, acetic acid, citric acid, oxalic acid, malonic acid, salicylic acid, p-aminosalicylic acid, malic acid, fumaric acid, succinic acid, ascorbic acid, maleic acid, sulfonic acid, phosphonic acid, perchloric acid, nitric acid, formic acid, propionic acid, gluconic acid, lactic acid, tartaric acid, hydroxymaleic acid, pyruvic acid, phenylacetic acid, benzoic acid, p-aminobenzoic acid, p-hydroxybenzoic acid, methanesulfonic acid, ethanesulfonic acid, nitrous acid, hydroxyethanesulfonic acid, ethylenesulfonic acid, p- toluenesulfonic acid, naphthylsulfonic acid, sulfanilic
  • the Noxl inhibitor peptide of the present invention may be conjugated to a non-peptide moiety.
  • a polymer molecule to be coupled to the peptide may be any suitable polymer molecule, such as a natural or synthetic homo-polymer or hetero-polymer, typically with a molecular weight in the range of about 300-100,000 Da, such as about 500-20,000 Da.
  • suitable polymer molecules include polymer molecules selected from the group consisting of poly alky lene oxide (PAO), including polyalkylene glycol (PAG), such as polyethylene glycol (PEG) and polypropylene glycol (PPG), branched PEGs, poly-vinyl alcohol (PVA), poly-carboxylate, poly-(vinylpyrolidone), polyethylene -co-maleic acid anhydride, polystyrene-co-maleic acid anhydride, dextran, including carboxymethyl-dextran, or any other biopolymer suitable for reducing immunogenicity and/or increasing functional in vivo half-life and/or serum half-life.
  • PAO poly alky lene oxide
  • PAG polyalkylene glycol
  • PEG polyethylene glycol
  • PPG polypropylene glycol
  • PVA poly-vinyl alcohol
  • PVA poly-carboxylate
  • poly-(vinylpyrolidone) poly-co-maleic acid anhydride
  • dextran
  • polyalkylene glycol-derived polymers are biocompatible, non- toxic, non-antigenic, non-immunogenic, have various water solubility properties, and are easily excreted from living organisms.
  • delivery systems relates to a diluent, adjuvant, excipient or carrier with which the peptide of the invention is administered.
  • These cosmetic or pharmaceutical carriers can be liquids, such as water, oils or surfactants, including those of petroleum, animal, vegetable or synthetic origin, such as and not restricted to, peanut oil, soybean oil, mineral oil, sesame oil, castor oil, polysorbates, sorbitan esters, ether sulfates, sulfates, betaines, glycosides, maltosides, fatty alcohols, nonoxynols, poloxamers, polyoxyethylenes, polyethylene glycols, dextrose, glycerol, digitonin and similar.
  • oils or surfactants including those of petroleum, animal, vegetable or synthetic origin, such as and not restricted to, peanut oil, soybean oil, mineral oil, sesame oil, castor oil, polysorbates, sorbitan esters, ether sulfates, sulfates, betaines, glycosides, maltosides, fatty alcohols, nonoxynols, poloxamers, polyoxyethylenes, polyethylene glycols, dext
  • sustained release is used in a conventional sense relating to a delivery system of a compound which provides the gradual release of this compound during a period of time and preferably, although not necessarily, with relatively constant compound release levels over a period of time.
  • delivery or sustained release systems are liposomes, mixed liposomes, oleosomes, niosomes, ethosomes, miUiparticles, microparticles, nanoparticles and solid lipid nanoparticles, nanostructured lipid carriers, sponges, cyclodextrins, vesicles, micelles, mixed micelles of surfactants, surfactant-phospholipid mixed micelles, millispheres, microspheres and nanospheres, lipospheres, millicapsules, microcapsules and nanocapsules, as well as micro- emulsions and nano-emulsions, which can be added to achieve a greater penetration of the Noxl inhibitor peptides and/or improve its pharmacokinetic and pharmaco
  • compositions of the invention may also comprise conventional cosmetic additives and adjuvants selected, in particular, from fatty substances, organic solvents, thickeners, softeners, antioxidants, opacifying agents, stabilizers, emollients, hydroxy acids, antifoaming agents, moisturizers, vitamins, fragrances, preservatives, surfactants, fillers, sequestering agents, polymers, propellants, basifying or acidifying agents, dyes, colorants, or any other ingredient usually formulated into cosmetics, in particular for the manufacture of antisun/sunscreen compositions in the form of emulsions.
  • conventional cosmetic additives and adjuvants selected, in particular, from fatty substances, organic solvents, thickeners, softeners, antioxidants, opacifying agents, stabilizers, emollients, hydroxy acids, antifoaming agents, moisturizers, vitamins, fragrances, preservatives, surfactants, fillers, sequestering agents, polymers, propellants, basifying or
  • compositions of the present invention can be used in combination with other compositions and procedures for the treatment of diseases.
  • a tumor can be treated conventionally with surgery, radiation, chemotherapy, or immunotherapy, combined with methods and compositions of the present invention.
  • the methods and compositions of the present invention can then also be subsequently administered to the patient to extend the dormancy of micrometastases and to stabilize and inhibit the growth of any residual primary tumor.
  • the compositions of the present invention may also be combined with other anti-angiogenic compounds, or proteins, fragments, antisera, receptor agonists, receptor antagonists of other anti-angiogenic proteins.
  • novel Noxl inhibitor peptides of the present invention can be combined with pharmaceutically acceptable excipients, and optionally sustained-release matrix, such as biodegradable polymers, to form therapeutic compositions.
  • compositions of the present invention may be administered concurrently with other therapies, e.g., in conjunction with a chemotherapy or radiation therapy regimen.
  • chemotherapeutic agents that can be combined with the novel Noxl inhibitor peptides according to the present invention include alkylating agents, for example, nitrogen mustards, ethyleneimine compounds, alkyl sulphonates and other compounds with an alkylating action such as nitrosoureas, cisplatin and dacarbazine; antimetabolites, for example, folic acid, purine or pyrimidine antagonists; mitotic inhibitors, for example, vinca alkaloids and derivatives of podophyllotoxin; cytotoxic antibiotics and camptothecin derivatives.
  • alkylating agents for example, nitrogen mustards, ethyleneimine compounds, alkyl sulphonates and other compounds with an alkylating action such as nitrosoureas, cisplatin and dacarbazine
  • antimetabolites for example, folic acid
  • Preferred chemotherapeutic agents or chemotherapy include amifostine (ethyol), cisplatin and/or other platinum compounds, preferably including carboplatin and/or oxaliplatin, dacarbazine (DTIC), dactinomycin, mechlorethamine (nitrogen mustard), streptozocin, cyclophosphamide, carrnustine (BCNU), lomustine (CCNU), doxorubicin (adriamycin), doxorubicin lipo (doxil), gemcitabine (gemzar), daunorubicin, daunorubicin lipo (daunoxome), procarbazine, mitomycin,cytarabine, etoposide, methotrexate, 5-fluorouracil (5-FU), vinblastine, vincristine, bleomycin, paclitaxel (taxol), docetaxel (taxotere), aldesleukin, asparaginase, busulfan, carb
  • the Noxl inhibitor peptides according to the present invention may either be used alone or in combination with other drugs used for treatment and/or management of atherosclerosis, restenosis after stent insertion, and/or hypertension.
  • Such other drugs may include but are not restricted to thrombolytic agents such as streptokinase, tissue plasminogen activator, plasmin and urokinase, anti-thrombotic agents such as tissue factor protease inhibitors (TFPI), nematode-extr acted anticoagulant proteins (NAPs) and the like, metalloproteinase inhibitors, antiinflammatory agents, antidiabetic or antihyperglycemic agents including insulin, insulin secretagogues, or insulin sensitizers, SGLT-2 inhibitors, AT receptor antagonist, a HMG-Co-A reductase inhibitor, an angiotensin converting enzyme (ACE) inhibitor, an calcium channel blocker, an aldosterone synthase inhibitor, an aldosterone antagonist, an dual angiotensin converting enzyme/neutral endopetidase (ACE/NEP) inhibitor, an endothelin antagonist , a diuretic and the like .
  • thrombolytic agents such as str
  • the Noxl inhibitor peptides of the present invention may be combined with one or more of botanicals/plant extracts; thiodipropionic acid (TDPA) and esters thereof; retinoids (ej>., all-trans retinoic acid, 9-cis retinoic acid, phytanic acid and others); hydroxy acids (including alpha-hydroxy acids and beta-hydroxy acids), salicylic acid and salicylates; exfoliating agents (e.g., glycolic acid, 3,6,9-trioxaundecanedioic acid, etc.), estrogen synthetase stimulating compounds (e.g., caffeine and derivatives); compounds capable of inhibiting 5 alpha-reductase activity (e g., linolenic acid, linoleic acid, finasteride, and mixtures thereof); barrier function enhancing agents (e.g., ceramides, glycerides, cholesterol and
  • the anti-aging or photoprotectant compositions may also include one or more of the following: a skin penetration enhancer, an emollient, a skin plumper, an optical diffuser, a sunscreen, an exfoliating agent, and an antioxidant.
  • An emollient provides the functional benefits of enhancing skin smoothness and reducing the appearance of fine lines and coarse wrinkles. These include by way of examples, isopropyl myristate, petrolatum, isopropyl lanolate, silicones (ej>_., methicone, dimethicone), oils, mineral oils, fatty acid esters, or any mixtures thereof.
  • the emollient may be preferably present from about 0.1 wt % to about 50 wt % of the total weight of the composition.
  • a skin plumper serves as a collagen enhancer to the skin.
  • An example of a suitable, and preferred, skin plumper is palmitoyl oligopeptide.
  • Other skin plumpers are collagen and/or other glycosaminoglycan (GAG) enhancing agents.
  • GAG glycosaminoglycan
  • the skin plumper may comprise from about 0.1 wt % to about 20 wt % of the total weight of the composition.
  • An optical diffuser is a particle that changes the surface optometries of skin, resulting in a visual blurring and softening of, for example, lines and wrinkles.
  • optical diffusers examples include, but are not limited to, boron nitride, mica, nylon, polymethylmethacrylate (PMMA), polyurethane powder, sericite, silica, silicone powder, talc, Teflon, titanium dioxide, zinc oxide, or any mixtures thereof.
  • the optical diffuser may be present from about 0.01 wt % to about 20 wt % of the total weight of the composition.
  • a sunscreen for protecting the skin from damaging ultraviolet rays may also be included.
  • Preferred sunscreens are those with a broad range of UVB and UVA protection, such as octocrylene, avobenzone (Parsol 1789), octyl methoxycinnamate, octyl salicylate, oxybenzone, homosylate, benzophenone, camphor derivatives, zinc oxide, and titanium dioxide.
  • the sunscreen may comprise from about 0.01 wt % to about 70 wt % of the composition.
  • Suitable exfoliating agents include, for example, alpha-hydroxy acids, beta-hydroxy acids, oxaacids, oxadiacids, and their derivatives such as esters, anhydrides and salts thereof.
  • Suitable hydroxy acids include inter alia glycolic acid, lactic acid, malic acid, tartaric acid, citric acid, 2- hydroxyalkanoic acid, mandelic acid, salicylic acid and derivatives thereof.
  • a preferred exfoliating agent is glycolic acid.
  • the exfoliating agent may comprise from about 0.1 wt % to about 80 wt % of the composition.
  • An antioxidant functions, among other things, to scavenge free radicals from skin to protect the skin from environmental aggressors.
  • antioxidants that may be used in the present compositions include compounds having phenolic hydroxy functions, such as ascorbic acid and its derivatives/esters; beta-carotene; catechins; curcumin; ferulic acid derivatives (e.g., ethyl ferulate, sodium ferulate); gallic acid derivatives (e ⁇ ., propyl gallate); lycopene; reductic acid; rosmarinic acid; tannic acid; tetrahydrocur cumin; tocopherol and its derivatives; uric acid; or any mixtures thereof.
  • antioxidants are those that have one or more thiol functions (— SH), in either reduced or non-reduced form, such as glutathione, lipoic acid, thioglycolic acid, and other sulfhydryl compounds.
  • the antioxidant may be inorganic, such as bisulfites, metabisulfites, sulfites, or other inorganic salts and acids containing sulfur.
  • vitamins such as tocopherol and ascorbic acid
  • vitamin derivatives such as ascorbyl monopalmitate
  • thickeners such as hydroxy alkyl cellulose
  • gelling agents such as bentonite, smectite, magnesium aluminum silicate and lithium magnesium silicate
  • metal chelating agents such as EDTA
  • pigments such as zinc oxide and titanium dioxide
  • colorants such as emollients; and humectants.
  • the present invention also extends to a portion or part or fragment of the Nox 1 gene or its mRNA, specifically NADPH oxidase 1 isoform long variant, NADPH oxidase activator 1 isoform 3, NADPH oxidase organizer 1 isoform.
  • the present invention relates to nucleic acid sequences encoding the peptides according to the present invention.
  • a "portion or part or fragment” is defined as having a minimal size of at least about 8 nucleotides or preferably about 12-17 nucleotides or more preferably at least about 18-25 nucleotides and may have a maximal size of at least about 5000 nucleotides. Genomic equivalents larger than 5000 nucleotides may also be employed.
  • This definition includes all sizes in the range of 8-5000 nucleotides.
  • this definition includes nucleic acids of at least 12, 15, 20, 25, 40, 60, 80, 100, 200, 300, 400, 500 or 1000 nucleotides or nucleic acids having any number of nucleotides within these values (e.g., 13, 16, 23, 30, 28, 50, 72, 121 nucleotides, etc..) or nucleic acids having more than 500 nucleotides or any number of nucleotides between 500.
  • the present invention includes all novel nucleic acids having at least 8 nucleotides derived from nucleic acids encoding the Noxl inhibitor peptides according to the present invention, the complement or a functional equivalent thereof.
  • the present invention provides a nucleic acid encoding peptide of SEQ ID NO: 2 to 42 analogues or conservative variants thereof. Still further the invention pertains to plasmids or vectors comprising the nucleic acids encoding the Noxl inhibitor peptides of the present invention. The nucleic acids, plasmids and vectors of the invention may be used to treat any of the conditions mentioned herein.
  • the peptide according to the present invention may be labelled with one or more detectable labels.
  • the label may be conjugated to the peptide either directly or by use of a linker.
  • the direct label is suitably an entity which is detectable in its natural state.
  • the direct label is a coloured particle, such as dye sols, metallic sols (e.g. colloidal gold), and coloured latex particles
  • this may be visible to the naked eye, or become visible with the aid of an optical filter.
  • the direct label is a fluorescent label
  • this may be subjected to applied stimulation, ej*.. UV light to promote fluorescence.
  • Suitable detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials.
  • the Noxl inhibitor peptides according to the invention may be conjugated to one or more detection, diagnostic or therapeutic agent for selective delivery to disease sites such as cancer cells, particularly in humans.
  • the conjugation may be either directly or by use of a linker, analogously to the conjugation described above.
  • the corresponding methods of detection, diagnosis and therapy of the diseases are corresponding aspects of the present invention, as are the peptides for use in such detection, diagnosis and therapeutic methods.
  • Detection, diagnostic and therapeutic agents may be naturally-occurring, modified, or synthetic. Therapeutic agents may promote or inhibit any biological process implicated in a human disease pathway.
  • the methods of detection, diagnosis and therapy, using the peptides according to the present invention conjugated to one or more detection, diagnostic or therapeutic agent for selective delivery to disease sites may be performed in vitro, particularly on a sample obtained from a subject, or in vivo in the body of a subject (patient) to be tested or treated.
  • the additional agent can be a therapeutic agent art-recognized as being useful to treat cancer.
  • the specific binding interaction between the peptide and the cells enables the therapeutic agent to be accurately targeted to cancerous cells in a mammalian patient.
  • Therapeutic agents suitable for this use may include any compound that induces apoptosis, cell death, cell differentiation, cell stasis and/or anti-angiogenesis or otherwise affects the survival and/or growth rate of a cancer cell.
  • the invention further provides a method of preparing the Noxl inhibitor peptide of the invention by solid phase or liquid phase synthesis, wherein said method optionally comprises a step of conjugating or attaching an agent which increase the accumulation of said peptide in a cell.
  • compositions of the invention can be delivered to a subject in vivo using a variety of known routes and techniques.
  • a composition can be provided as an injectable solution, suspension or emulsion and administered via parenteral, subcutaneous, epidermal, intradermal, intramuscular, intra-arterial, intraperitoneal, intravenous injection using a conventional needle and syringe, or using a liquid jet injection system.
  • Compositions can also be administered topically to skin or mucosal tissue, such as nasally, intratracheally, intestinally, rectally or vaginally, or provided as a finely divided spray suitable for respiratory or pulmonary administration.
  • Other modes of administration include oral administration, suppositories, sublingual administration, and active or passive transdermal delivery techniques.
  • Administration of the peptides/polynucleotides may be by any suitable method as described above. Suitable amounts of the peptide may be determined empirically, but typically are in the range given below. A single administration of each peptide may be sufficient to have a beneficial effect for the patient, but it will be appreciated that it may be beneficial if the peptide is administered more than once, in which case typical administration regimes may be, for example, once or twice a week for 2-4 weeks every six months, or once a day for a week every four to six months. As will be appreciated, each peptide or polynucleotide, or combination of peptides and/or polynucleotides may be administered to a patient singly or in combination.
  • Dosages for administration will depend upon a number of factors including the nature of the composition, the route of administration and the schedule and timing of the administration regime. Suitable doses of a molecule or a combination of molecules of the invention may be in the order of 1 ⁇ g up to 10 ⁇ g, up to 15 ⁇ g, up to 20 ⁇ g, up to 25 ⁇ g, up to 30 ⁇ g, up to 35 ⁇ g, up to 50 ⁇ g, up to 100 ⁇ g, up to 500 ⁇ g or more per administration.
  • Suitable doses may be less than 15 ⁇ g, but at least 1 ng, or at least 2 ng, or at least 5 ng, or at least 50 ng, or least 100 ng, or at least 500 ng, or at least 1 ⁇ g, or at least 10 ⁇ g.
  • the dose used may be higher, for example, up to 1 mg, up to 2 mg, up to 3 mg, up to 4 mg, up to 5 mg or higher.
  • Such doses may be provided in a liquid formulation, at a concentration suitable to allow an appropriate volume for administration by the selected route.
  • Peptide A (SEQ ID NO:41) comprises a tat sequence which is N-terminal to the sequence SEQ ID NO:20.
  • Peptide B (SEQ ID NO:42) comprise a tat sequence which is N-terminal to the sequence SEQ ID NO:21.
  • Peptide C (SEQ ID NO:43) is a control peptide (or scramble peptide).
  • Noxl inhibitor peptides were found to efficiently diminish intracellular ROS levels as demonstrated by the following results.
  • ROS level in primary human keratinocytes treated with 10 or 50 ⁇ of peptides A, B, and C for 24 h were assayed using the CM-H2DCF-DA probes (Fig 2A).
  • a significant decrease in ROS level was observed in cells treated with Noxl inhibitor peptides A and B.
  • the ROS levels were assessed in human colon adenocarcinoma HT29 cell line in which Noxl is the only active member of Nox family.
  • Measurement of ROS level in HT29 cells showed that treatment with Noxl inhibitor peptides A and B resulted in a significant reduction in ROS level, suggesting a specific inhibitory effect of these peptides on Noxl activity (Fig 2B).
  • NADPH oxidase activity was measured in shCtrl and shNoxl -transduced cells treated with or without peptide A (Fig 3C). Equally decreased NADPH oxidase activity was found in shNoxl transduced cells, peptide A-treated cells and shNoxl -transduced cells treated with peptide A, thereby demonstrating the efficiency and specificity of peptide A to block Noxl activation.
  • Example 1- In vivo evaluation of the Noxl inhibitor peptides
  • SKH-1 mice were treated topically with different doses of peptide A (Fig 5A). Results showed that peptide A inhibited efficiently Nox activity for up to 3 days when administrated at 3 and 12 mg/kg. The effect of peptide A on UVB irradiated mice was then tested (Fig 5B). Results showed that topical treatment with peptide A 10 min prior to irradiation efficiently blocked UVB -induced Nox activation in mice treated with 3 and 12 mg/kg.
  • peptide A (3 mg/kg) was administrated three times per week and 10 minutes prior to each UV B exposure. Results showed that treatment with peptide A resulted in a decrease of 2.3 and 2.9 times in tumor number and tumor size, respectively (Fig 6A and 6B). Furthermore, 57% of the tumors in peptide A-treated mice had a volume less than 5 mm 3 compared to only 8% in the mice treated with control peptide C (Fig 6C).
  • ALL MOLT4 Acute lymphoblastic leukemia (ALL) MOLT4, CCL-119, CCL-120
  • AML Acute myeloid leukemia
  • CML Chronic myeloid leukemia
  • AR230 AR230
  • Example 2.1 In vitro effect on cancer cell lines
  • Noxl inhibition is assessed on different cell lines as listed in Table 6.
  • Cell proliferation, cell cycle progression and apoptosis may be compared between non-treated cells and cells which are treated with Noxl inhibitor peptides.
  • Example 2.2 Xenografts of cells into NOD/SCID mice.
  • mice are trypsinized, washed in DPBS, and resuspended in DPBS with 25% Matrigel (BD Biosciences). 2 x 10 6 cells are injected subcutaneously into 6 to 8 weeks old NOD/SCID mice (The Jackson Laboratory). For each cell line, mice are divided into two groups: one treated with vehicle and the other is treated with a Noxl inhibitor peptide. Tumor formation and tumor growth is monitored up to two months. Each tumor is dissected, measured, fixed in 4% paraformaldehyde, embedded in paraffin, and processed for H&E staining. Proliferation rate and apoptosis rate are evaluated.
  • mice are divided into two groups: one treated with vehicle and other treated with Noxl inhibitor peptides.
  • Noxl inhibitor peptides are tested on arthritis, periphery blood lymphocyte (PBL)-derived macrophages is activated in presence and absence of Noxl inhibitor peptides. Secretion of different inflammatory mediators (TNF-a, IL-6, IL- ⁇ ⁇ , IL-8, IL-10) is detected.
  • PBL periphery blood lymphocyte
  • Noxl inhibitor peptides are also tested on asthma by assessing IgE-DNP-induced inflammation is tested in presence and absence of Noxl inhibitor peptides.
  • Example 3 in vivo e ffects Rat model of arthritis is treated with different doses of Noxl inhibitor peptides to evaluate peptide amelioration of clinical scores and prevention of bone destruction.
  • Noxl inhibitor peptides on hemangioma, transformation of endothelial cells by the middle T antigen of murine Polyoma virus (PymT) is tested in the presence or absence of Noxl inhibitor peptides.
  • Noxl inhibitor peptides are assessed on hypertension, hypertension induction following infusion of angiotensin-II in presence and absence of Noxl inhibitor peptides.
  • EAE autoimmune encephalomyelitis
  • Noxl inhibitor peptides To evaluate the effect of Noxl inhibitor peptides on Parkinson and Alzheimer's disease, neuronal cells derived from skin cells through iPS technology is used. The effects of Noxl inhibitor peptides on ROS levels of neuronal cells derived from patients and healthy skin are also tested.
  • Noxl inhibitor peptides The effect of Noxl inhibitor peptides is assessed on multiple sclerosis, mouse models of experimental autoimmune encephalomyelitis (EAE). In fact, PLP139-151 peptide-induced EAE model in SJL mice is used.
  • Noxl inhibitor peptides are assessed on atopic dermatitis, secretion of inflammatory mediators by IgE-induced activated keratinocytes in presence and absence of Noxl inhibitor peptides. IgE-induced ear hypersensitivity is also tested in presence and absence of Noxl inhibitor peptides.
  • melanocyte detachment may be tested using reconstructed epidermis and primary melanocytes.
  • Noxl inhibitor peptides are tested on primary keratinocytes and reconstructed epidermis. Differentiation and senescence markers are compared between cells treated with vehicle or Noxl inhibitor peptides.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Organic Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Dermatology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Birds (AREA)
  • Gerontology & Geriatric Medicine (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Neurosurgery (AREA)
  • Hematology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Pulmonology (AREA)
  • Diabetes (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Rheumatology (AREA)
  • Heart & Thoracic Surgery (AREA)
PCT/EP2014/050063 2013-01-03 2014-01-03 Selective nox-1 inhibitor peptides and uses thereof Ceased WO2014106649A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
JP2015551182A JP6488237B2 (ja) 2013-01-03 2014-01-03 選択的nox−1インヒビターペプチドおよびそれらの使用
AU2014204309A AU2014204309B2 (en) 2013-01-03 2014-01-03 Selective Nox-1 inhibitor peptides and uses thereof
EP14700063.2A EP2941268B1 (en) 2013-01-03 2014-01-03 Selective nox-1 inhibitor peptides and uses thereof
CN201480003978.1A CN105007933A (zh) 2013-01-03 2014-01-03 选择性Nox1抑制剂肽及其用途
RU2015132087A RU2699726C2 (ru) 2013-01-03 2014-01-03 Селективные ингибиторные пептиды nox-1 и их применение
CA2894576A CA2894576A1 (en) 2013-01-03 2014-01-03 Selective nox-1 inhibitor peptides and uses thereof
DK14700063.2T DK2941268T3 (da) 2013-01-03 2014-01-03 Selektive nox-1-inhibitor-peptider og anvendelser deraf
MA38296A MA38296B2 (fr) 2013-01-03 2014-01-03 Peptides inhibiteurs sélectifs de nox-1 et leurs utilisations
US14/758,991 US20170000842A9 (en) 2013-01-03 2014-01-03 Selective nox-1 inhibitor peptides and uses thereof
BR112015015242-2A BR112015015242B1 (pt) 2013-01-03 2014-01-03 peptídeos inibidores de nox-1 seletivos e usos dos mesmos
TNP2015000295A TN2015000295A1 (en) 2013-01-03 2015-06-29 Selective nox-1 inhibitor peptides and uses thereof
IL239762A IL239762B (en) 2013-01-03 2015-07-02 Selective nox-1 blocking peptides and their use
US15/667,737 US10517919B2 (en) 2013-01-03 2017-08-03 Selective Nox-1 inhibitor peptides and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP13150187.6 2013-01-03
EP13150187.6A EP2752196A1 (en) 2013-01-03 2013-01-03 Selective nox-1 inhibitor peptides and uses thereof

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/758,991 A-371-Of-International US20170000842A9 (en) 2013-01-03 2014-01-03 Selective nox-1 inhibitor peptides and uses thereof
US15/667,737 Continuation US10517919B2 (en) 2013-01-03 2017-08-03 Selective Nox-1 inhibitor peptides and uses thereof

Publications (1)

Publication Number Publication Date
WO2014106649A1 true WO2014106649A1 (en) 2014-07-10

Family

ID=47458818

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2014/050063 Ceased WO2014106649A1 (en) 2013-01-03 2014-01-03 Selective nox-1 inhibitor peptides and uses thereof

Country Status (14)

Country Link
US (2) US20170000842A9 (https=)
EP (2) EP2752196A1 (https=)
JP (1) JP6488237B2 (https=)
CN (1) CN105007933A (https=)
AU (1) AU2014204309B2 (https=)
BR (1) BR112015015242B1 (https=)
CA (1) CA2894576A1 (https=)
DK (1) DK2941268T3 (https=)
HU (1) HUE050715T2 (https=)
IL (1) IL239762B (https=)
MA (1) MA38296B2 (https=)
RU (1) RU2699726C2 (https=)
TN (1) TN2015000295A1 (https=)
WO (1) WO2014106649A1 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3034500A1 (en) 2014-12-17 2016-06-22 Genkyotex Sa Amido thiazole derivatives as NADPH oxidase inhibitors
EP3628669A1 (en) 2018-09-28 2020-04-01 GenKyoTex Suisse SA Novel compounds as nadph oxidase inhibitors

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP6472693B2 (ja) * 2015-03-24 2019-02-20 株式会社荏原製作所 基板処理装置
US20170110622A1 (en) * 2015-10-14 2017-04-20 Solarcity Corporation Apparatus for electroplating of electrodes on photovoltaic structures
WO2019023263A1 (en) * 2017-07-25 2019-01-31 Immune Pharmaceuticals, Inc. METHODS AND COMPOSITIONS FOR TREATING TUMORS COMPRISING A BCR-ABL1 FUSION GENE
FI3861001T3 (fi) * 2018-10-05 2024-01-03 Pfizer Booria sisältäviä PDE4-inhibiittoreita
EA202193251A1 (ru) 2019-06-05 2022-03-10 Эмори Юниверсити Пептидомиметики для лечения коронавирусной и пикорнавирусной инфекций
KR20210129517A (ko) * 2020-04-20 2021-10-28 경북대학교병원 Nadph 산화효소 1 저해제를 유효성분으로 포함하는 허혈-재관류 손상 예방 또는 치료용 조성물
CN113773394B (zh) * 2020-06-10 2023-10-27 山东大学 一种融合肽及在制备抗肿瘤制剂中的应用

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1991017763A1 (en) * 1990-05-24 1991-11-28 The United States Of America, As Represented By The Secretary, U.S. Department Of Commerce PEPTIDE DERIVATIVES OF CYTOCHROME b558 AND THEIR USE AS MEDICAMENTS
WO1995003819A1 (en) * 1993-08-02 1995-02-09 The Scripps Research Institute Regulation of oxidative burst using lmwg-derived peptides and analogs
GB2285047A (en) * 1993-12-21 1995-06-28 Yamanouchi U K Ltd Polypeptides, rich in proline, which inhibit the NADPH oxidase system
WO1995024419A1 (en) * 1994-03-11 1995-09-14 Ariad Pharmaceuticals, Inc. Methods and materials for identifying inhibitors of molecular interactions mediated by sh3 domains
WO1997030074A1 (en) * 1996-02-16 1997-08-21 Cytogen Corporation Isolation and use of sh3 binding peptides
US20030125249A1 (en) * 1995-04-10 2003-07-03 Frank Blecha Synthetic peptides that inhibit leukocyte superoxide anion production and/or attract leukocytes
JP2005168329A (ja) * 2003-12-08 2005-06-30 Hokkaido Univ Nadphオキシダーゼ活性を阻害するポリペプチド
US20070098706A1 (en) * 2005-11-03 2007-05-03 The Board Of Regents, University Of Texas System Nadph oxidase cytosolic cofactor mutant
WO2008109833A2 (en) * 2007-03-07 2008-09-12 University Of Florida Research Foundation, Inc. Polynucleotides and polypeptides identified by iviat screening and methods of use

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1996003649A1 (en) * 1994-07-22 1996-02-08 The University Of North Carolina At Chapel Hill Src SH3 BINDING PEPTIDES AND METHODS OF ISOLATING AND USING SAME
US6551795B1 (en) * 1998-02-18 2003-04-22 Genome Therapeutics Corporation Nucleic acid and amino acid sequences relating to pseudomonas aeruginosa for diagnostics and therapeutics
JP2011515466A (ja) * 2008-03-28 2011-05-19 ニュースキン インターナショナル インコーポレイテッド 反応性酸素種の阻害のためのarnox阻害物質を含む組成物
WO2013074816A2 (en) 2011-11-15 2013-05-23 University Of Pittsburgh - Of The Commonwealth System Of Higher Education Novel inhibitors of nox1

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1991017763A1 (en) * 1990-05-24 1991-11-28 The United States Of America, As Represented By The Secretary, U.S. Department Of Commerce PEPTIDE DERIVATIVES OF CYTOCHROME b558 AND THEIR USE AS MEDICAMENTS
WO1995003819A1 (en) * 1993-08-02 1995-02-09 The Scripps Research Institute Regulation of oxidative burst using lmwg-derived peptides and analogs
GB2285047A (en) * 1993-12-21 1995-06-28 Yamanouchi U K Ltd Polypeptides, rich in proline, which inhibit the NADPH oxidase system
WO1995024419A1 (en) * 1994-03-11 1995-09-14 Ariad Pharmaceuticals, Inc. Methods and materials for identifying inhibitors of molecular interactions mediated by sh3 domains
US20030125249A1 (en) * 1995-04-10 2003-07-03 Frank Blecha Synthetic peptides that inhibit leukocyte superoxide anion production and/or attract leukocytes
WO1997030074A1 (en) * 1996-02-16 1997-08-21 Cytogen Corporation Isolation and use of sh3 binding peptides
JP2005168329A (ja) * 2003-12-08 2005-06-30 Hokkaido Univ Nadphオキシダーゼ活性を阻害するポリペプチド
US20070098706A1 (en) * 2005-11-03 2007-05-03 The Board Of Regents, University Of Texas System Nadph oxidase cytosolic cofactor mutant
WO2008109833A2 (en) * 2007-03-07 2008-09-12 University Of Florida Research Foundation, Inc. Polynucleotides and polypeptides identified by iviat screening and methods of use

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", MACK PUBLISHING CO.
DATABASE WPI Week 200548, Derwent World Patents Index; AN 2005-472700, XP002697185 *
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", COLD SPRING HARMOR PRESS
VALENTE ANTHONY J ET AL: "NOX1 NADPH oxidase regulation by the NOXA1 SH3 domain", FREE RADICAL BIOLOGY & MEDICINE, vol. 43, no. 3, August 2007 (2007-08-01), pages 384 - 396, XP022133335, ISSN: 0891-5849 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3034500A1 (en) 2014-12-17 2016-06-22 Genkyotex Sa Amido thiazole derivatives as NADPH oxidase inhibitors
WO2016098005A1 (en) 2014-12-17 2016-06-23 Genkyotex Sa Amido thiadiazole derivatives as nadph oxidase inhibitors
US10130619B2 (en) 2014-12-17 2018-11-20 Genkyotex Suisse Sa Amido thiadiazole derivatives as NADPH oxidase inhibitors
EP3628669A1 (en) 2018-09-28 2020-04-01 GenKyoTex Suisse SA Novel compounds as nadph oxidase inhibitors
WO2020065048A1 (en) 2018-09-28 2020-04-02 Genkyotex Suisse Sa Novel compounds as nadph oxidase inhibitors
US12202816B2 (en) 2018-09-28 2025-01-21 Calliditas Therapeutics Suisse Sa Compounds as NADPH oxidase inhibitors

Also Published As

Publication number Publication date
US20160030503A1 (en) 2016-02-04
US10517919B2 (en) 2019-12-31
MA38296B2 (fr) 2019-10-31
HUE050715T2 (hu) 2021-01-28
EP2752196A1 (en) 2014-07-09
BR112015015242B1 (pt) 2020-10-27
JP6488237B2 (ja) 2019-03-20
RU2015132087A (ru) 2017-02-06
US20170340697A1 (en) 2017-11-30
EP2941268B1 (en) 2020-06-24
EP2941268A1 (en) 2015-11-11
IL239762B (en) 2020-04-30
IL239762A0 (en) 2015-08-31
JP2016505612A (ja) 2016-02-25
CN105007933A (zh) 2015-10-28
TN2015000295A1 (en) 2016-10-03
AU2014204309B2 (en) 2018-03-01
CA2894576A1 (en) 2014-07-10
AU2014204309A1 (en) 2015-07-09
US20170000842A9 (en) 2017-01-05
RU2699726C2 (ru) 2019-09-09
DK2941268T3 (da) 2020-09-28

Similar Documents

Publication Publication Date Title
US10517919B2 (en) Selective Nox-1 inhibitor peptides and uses thereof
JP6464266B2 (ja) 皮膚状態改善活性を有するペプチド及びその用途
EP2575467B1 (en) Macrocyclic compounds useful as inhibitors of histone deacetylases
Kim et al. Caspase-3 mediated switch therapy of self-triggered and long-acting prodrugs for metastatic TNBC
KR102236495B1 (ko) 티로시나아제 안티센스 올리고뉴클레오티드
Deng et al. Synthesis and pharmacological evaluation of a novel synthetic peptide CWHTH based on the Styela clava-derived natural peptide LWHTH with improved antioxidant, hepatoprotective and angiotensin converting enzyme inhibitory activities
Han et al. Design, synthesis and activity evaluation of reduction-responsive anticancer peptide temporin-1CEa drug conjugates
AU2020287607B2 (en) Modified peptides and associated methods of use
Wang et al. Structure-based design, synthesis and biological evaluation of a novel d-amino acid-containing peptide inhibitor by blocking the RAD51-BRCA2 interaction for the treatment of kidney cancer
GB2545169B (en) Taxane Prodrug Comprising A Membrane Type Matrix Metalloproteinase Cleavage Site
CN108484729B (zh) 一种基质金属蛋白酶9的多肽抑制剂及其应用
EP2134365B1 (en) Compositions and methods for inhibiting tumor cell growth
CN109862903A (zh) 治疗性sall4肽
Li et al. A mitochondria-targeted idebenone derivative W1a mitigates cerebral ischemia-reperfusion injury by preserving mitochondrial integrity and suppressing neuroinflammation
EP4267251A1 (en) Cyclic peptides and uses thereof
ES2906396T3 (es) Oligonucleótidos antisentido de tirosinasa
Chen et al. Further structural optimization and SAR study of sungsanpin derivatives as cell-invasion inhibitors
WO2026078691A1 (en) Matrix metalloproteinase inhibitors and uses thereof
CN111094357A (zh) 一类新的Bcl10聚合抑制剂及其应用
US20190054159A1 (en) Pharmaceutical composition for cancer treatment, process for its preparation, and its use
Colvin A Synthetic Study and Preliminary Evaluation of a Protease-Activated Doxazolidine Prodrug
HK1237667A (en) Taxane prodrug comprising a membrane type matrix metalloproteinase cleavage site

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14700063

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2894576

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: DZP2015000328

Country of ref document: DZ

WWE Wipo information: entry into national phase

Ref document number: 239762

Country of ref document: IL

Ref document number: 14758991

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2015551182

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 139450140003004094

Country of ref document: IR

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015015242

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2014204309

Country of ref document: AU

Date of ref document: 20140103

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2014700063

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 38296

Country of ref document: MA

ENP Entry into the national phase

Ref document number: 2015132087

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112015015242

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20150624