WO2014092804A1 - Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity - Google Patents
Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity Download PDFInfo
- Publication number
- WO2014092804A1 WO2014092804A1 PCT/US2013/051667 US2013051667W WO2014092804A1 WO 2014092804 A1 WO2014092804 A1 WO 2014092804A1 US 2013051667 W US2013051667 W US 2013051667W WO 2014092804 A1 WO2014092804 A1 WO 2014092804A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- antibody
- immunoconjugate
- antibodies
- dosage
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- SXEIGHMPGZUIRR-UHFFFAOYSA-N CC(C)(C)CCOC(C)(C)CNC(COCC(C)=O)=O Chemical compound CC(C)(C)CCOC(C)(C)CNC(COCC(C)=O)=O SXEIGHMPGZUIRR-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/4738—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems
- A61K31/4745—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems condensed with ring systems having nitrogen as a ring hetero atom, e.g. phenantrolines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61B—DIAGNOSIS; SURGERY; IDENTIFICATION
- A61B6/00—Apparatus or devices for radiation diagnosis; Apparatus or devices for radiation diagnosis combined with radiation therapy equipment
- A61B6/48—Diagnostic techniques
- A61B6/481—Diagnostic techniques involving the use of contrast agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
- A61K31/337—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having four-membered rings, e.g. taxol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/4164—1,3-Diazoles
- A61K31/4184—1,3-Diazoles condensed with carbocyclic rings, e.g. benzimidazoles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/4353—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems
- A61K31/4375—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a six-membered ring having nitrogen as a ring heteroatom, e.g. quinolizines, naphthyridines, berberine, vincamine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/445—Non condensed piperidines, e.g. piperocaine
- A61K31/4523—Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems
- A61K31/454—Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. pimozide, domperidone
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/513—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/66—Phosphorus compounds
- A61K31/675—Phosphorus compounds having nitrogen as a ring hetero atom, e.g. pyridoxal phosphate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/713—Double-stranded nucleic acids or oligonucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68037—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a camptothecin [CPT] or derivatives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6853—Carcino-embryonic antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2833—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3007—Carcino-embryonic Antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3015—Breast
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3023—Lung
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/303—Liver or Pancreas
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3061—Blood cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
- C07K16/3092—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present invention relates to therapeutic use of immunoconjugates of antibodies or antigen-binding antibody fragments and camptothecins, such as SN-38, with improved ability to target various cancer cells in human subjects.
- the antibodies and therapeutic moieties are linked via an intracellularly-cleavable linkage that increases therapeutic efficacy.
- the immunoconjugates are
- the optimized dosages and schedules of administration of SN-38- conjugated antibodies for human therapeutic use disclosed herein show unexpected superior efficacy that could not have been predicted from animal model studies, allowing effective treatment of cancers that are resistant to standard anti-cancer therapies, including the parental compound, irinotecan (CPT-11).
- MAbs monoclonal antibodies
- suitable toxic agents have been developed, but have had mixed success in the therapy of cancer in humans, and virtually no application in other diseases, such as infectious and autoimmune diseases.
- the toxic agent is most commonly a chemotherapeutic drug, although particle-emitting radionuclides, or bacterial or plant toxins, have also been conjugated to MAbs, especially for the therapy of cancer (Sharkey and Goldenberg, CA Cancer J Clin.
- M Ab-chemotherapeutic drug conjugates are that (a) the chemotherapeutic drug itself is structurally well defined; (b) the chemotherapeutic drug is linked to the MAb protein using very well-defined conjugation chemistries, often at specific sites remote from the MAbs' antigen binding regions; (c) MAb-chemotherapeutic drug conjugates can be made more reproducibly and usually with less immunogenicity than chemical conjugates involving MAbs and bacterial or plant toxins, and as such are more amenable to commercial development and regulatory approval; and (d) the MAb- chemotherapeutic drag conjugates are orders of magnitude less toxic systemically than radionuclide MAb conjugates, particularly to the radiation-sensitive bone marrow.
- Camptothecin (CPT) and its derivatives are a class of potent antitumor agents.
- Irinotecan also referred to as CPT-11
- topotecan are CPT analogs that are approved cancer therapeutics (Iyer and Ratain, Cancer Chemother. Phamacol. 42: S31-S43 (1998)).
- CPTs act by inhibiting topoisomerase I enzyme by stabilizing topoisomerase I-DNA complex (Liu, et al. in The Camptothecins: Unfolding Their Anticancer Potential, Liehr J.G., Giovanella, B.C. and Verschraegen (eds), NY Acad Sci., NY 922:1-10 (2000)).
- CPTs present specific issues in the preparation of conjugates. One issue is the insolubility of most CPT derivatives in aqueous buffers.
- CPTs provide specific challenges for structural modification for conjugating to macromolecules.
- CPT itself contains only a tertiary hydroxyl group in ring-E.
- the hydroxyl functional group in the case of CPT must be coupled to a linker suitable for subsequent protein conjugation; and in potent CPT
- the conjugation protocol is performed such that it is carried out at a pH of 7 or lower to avoid the lactone ring opening.
- conjugation of a bifunctional CPT possessing an amine- reactive group such as an active ester would typically require a pH of 8 or greater.
- an intracellularly-cleavable moiety preferably is incorporated in the linker/spacer connecting the CPTs and the antibodies or other binding moieties.
- the methods comprise optimized dosing and administration schedules that maximize efficacy and minimize toxicity of the antibody-CPT conjugates for therapeutic use in human patients.
- CPT may refer to camptothecin or any of its derivatives, such as SN-38, unless expressly stated otherwise.
- the present invention resolves an unfulfilled need in the art by providing improved methods and compositions for preparing and administering CPT-antibody immunoconjugates.
- the camptothecin is SN-38.
- the disclosed methods and compositions are of use for the treatment of a variety of diseases and conditions which are refractory or less responsive to other forms of therapy, and can include diseases against which suitable antibodies or antigen-binding antibody fragments for selective targeting can be developed, or are available or known.
- Preferred diseases or conditions that may be treated with the subject immunoconjugates include, for example, cancer or diseases caused by infectious organisms.
- the targeting moiety is an antibody, antibody fragment, bispecific or other multivalent antibody, or other antibody-based molecule or compound.
- the antibody can be of various isotypes, preferably human IgGl, IgG2, IgG3 or IgG4, more preferably comprising human IgGl hinge and constant region sequences.
- the antibody or fragment thereof can be a chimeric human-mouse, a chimeric human-primate, a humanized (human framework and murine hypervariable (CDR) regions), or fully human antibody, as well as variations thereof, such as half-IgG4 antibodies (referred to as "unibodies"), as described by van der Neut Kolfschoten et al. (Science 2007; 317:1554-1557).
- the antibody or fragment thereof may be designed or selected to comprise human constant region sequences that belong to specific allotypes, which may result in reduced immunogenicity when the immunoconjugate is administered to a human subject.
- Preferred allotypes for administration include a non-Glml allotype (nGlml), such as Glm3, Glm3,l, Glm3,2 or Glm3,l ,2. More preferably, the allotype is selected from the group consisting of the nGlml, Glm3, nGlml , 2 and Km3 allotypes.
- Antibodies of use may bind to any disease-associated antigen known in the art.
- cancer many antigens expressed by or otherwise associated with tumor cells are known in the art, including but not limited to, carbonic anhydrase IX, alpha-fetoprotein (AFP), a-actinin-4, A3, antigen specific for A33 antibody, ART-4, B7, Ba 733, BAGE, BrE3-antigen, CA125, CAMEL, CAP-1, CASP-8/m, , CCCL19, CCCL21, CD1, CDla, CD2, CD3, CD4, CD5, CD8, CD11A, CD14, CD15, CD16, CD18, CD19, CD20, CD21, CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD44, CD45, CD46, CD52, CD54, CD55, CD59, CD64, CD66a-e, CD67, CD70, CD70L, CD74, CD79a, CD80, CD83, CD95, CD126
- the antibody binds to CEACAM5, CEACAM6, EGP-1 (TROP-2), MUC- 16, AFP, MUC5a,c, PAM4 antigen, CD74, CD19, CD20, CD22 or HLA-DR.
- CEACAM5 CEACAM6, EGP-1 (TROP-2), MUC- 16, AFP, MUC5a,c, PAM4 antigen, CD74, CD19, CD20, CD22 or HLA-DR.
- Exemplary antibodies that may be utilized include, but are not limited to, hRl (anti- IGF-1R, U.S. Patent Application Serial No. 12/722,645, filed 3/12/10), hPAM4 (anti-mucin, U.S. Patent No. 7,282,567), hA20 (anti-CD20, U.S. Patent No. 7,251,164), hA19 (anti-CD19, U.S. Patent No. 7,109,304), hIMMU31 (anti-AFP, U.S. Patent No. 7,300,655), hLLl (anti- CD74, U.S. Patent No. 7,312,318), hLL2 (anti-CD22, U.S. Patent No.
- hMu-9 anti-CSAp, U.S. Patent No. 7,387,773
- hL243 anti-HLA-DR, U.S. Patent No. 7,612,180
- hMN-14 anti-CEACAM5, U.S. Patent No. 6,676,924
- hMN-15 anti-CEACAM6, U.S. Patent No. 7,541,440
- hRS7 anti-EGP-1, U.S. Patent No. 7,238,785)
- hMN-3 anti- CEACAM6, U.S. Patent No. 7,541,440
- Abl24 and Abl25 anti-CXCR4, U.S. Patent No.
- the antibody is IMMU-31 (anti-AFP), hRS7 (anti-TROP-2), hMN-14 (anti-CEACAM5), hMN-3 (anti-CEACAM6), hMN-15 (anti-CEACAM6), hLLl (anti-CD74), hLL2 (anti-CD22), hL243 or IMMU-114 (anti-HLA-DR), hA19 (anti-CD19) or hA20 (anti-CD20).
- epratuzumab and hLL2 are interchangeable, as are the terms veltuzumab and hA20, hL243g4P, hL243gamma4P and IMMU-114.
- Alternative antibodies of use include, but are not limited to, abciximab (anti- glycoprotein Ilb/IIIa), alemtuzumab (anti-CD52), bevacizumab (anti-VEGF), cetuximab (anti-EGFR), gemtuzumab (anti-CD33), ibritumomab (anti-CD20), panitumumab (anti- EGFR), rituximab (anti-CD20), tositumomab (anti-CD20), trastuzumab (anti-ErbB2), lambrolizumab (anti-PD- 1 receptor), nivolumab (anti-PD-1 receptor), ipilimumab (anti- CTLA-4), abagovomab (anti-CA-125), adecatumumab (anti-EpCAM), atlizumab (anti-IL-6 receptor), benralizumab (anti-CD125), obinutuzumab (
- Patent 8,333,971 Ab 75, Ab 76, Ab 77 (Paulik et al., 1999, Biochem Pharmacol 58: 1781-90), as well as the anti-HIV antibodies described and sold by Polymun (Vienna, Austria), also described in U.S. Patent 5,831,034, U.S. Patent 5,911,989, and Vcelar et al, AIDS 2007; 21(16):2161-2170 and Joos et al., Antimicrob. Agents Chemother. 2006;
- pathogens such as CR6261 (anti-influenza), exbivirumab (anti-hepatitis B), felvizumab (anti-respiratory syncytial virus), foravirumab (anti-rabies virus), motavizumab (anti-respiratory syncytial virus), palivizumab (anti-respiratory syncytial virus), panobacumab (anti-Pseudomonas), rafivirumab (anti-rabies virus), regavirumab (anti-cytomegalovirus), sevirumab (anti- cytomegalovirus), tivirumab (anti-hepatitis B), and urtoxazumab (anti-E. coli).
- pathogens such as CR6261 (anti-influenza), exbivirumab (anti-hepatitis B), felvizumab (anti-respiratory syncytial virus), foravirumab (
- the chemotherapeutic moiety is selected from
- camptothecin CPT and its analogs and derivatives and is more preferably SN-38.
- chemotherapeutic moieties include taxanes (e.g, baccatin III, taxol), epothilones, anthracyclines (e.g., doxorubicin (DOX), epirubicin, morpholinodoxorubicin (morpholino-DOX), cyanomorpholino-doxorubicin (cyanomorpholino-DOX), 2- pyrrolinodoxorubicin (2-PDOX) or a prodrug form of 2-PDOX (pro-2-PDOX); see, e.g., Priebe W (ed.), ACS symposium series 574, published by American Chemical Society, Washington D.C., 1995 (332pp) and Nagy et al., Proc.
- the antibody or fragment thereof links to at least one chemotherapeutic moiety; preferably 1 to about 5 chemotherapeutic moieties; more preferably 6 or more chemotherapeutic moieties, most preferably about 6 to about 12 chemotherapeutic moieties.
- CPT-11 An example of a water soluble CPT derivative is CPT-11.
- Extensive clinical data are available concerning CPT-l l's pharmacology and its in vivo conversion to the active SN-38 (Iyer and Ratain, Cancer Chemother Pharmacol. 42:S31-43 (1998); Mathijssen et al., Clin Cancer Res. 7:2182-2194 (2002); Rivory, Ann NY Acad Sci. 922:205-215, 2000)).
- the active form SN-38 is about 2 to 3 orders of magnitude more potent than CPT-11.
- the immunoconjugate may be an hMN-14-SN-38, hMN-3-SN-38, hMN-15-SN-38, IMMU-31 -SN-38, hRS7-SN-38, hA20-SN-38, hL243-SN-38, hLLl -SN-38 or hLL2-SN-38 conjugate.
- Various embodiments may concern use of the subject methods and compositions to treat a cancer, including but not limited to non-Hodgkin's lymphomas, B-cell acute and chronic lymphoid leukemias, Burkitt lymphoma, Hodgkin's lymphoma, acute large B-cell lymphoma, hairy cell leukemia, acute myeloid leukemia, chronic myeloid leukemia, acute lymphocytic leukemia, chronic lymphocytic leukemia, T-cell lymphomas and leukemias, multiple myeloma, Waldenstrom's macroglobulinemia, carcinomas, melanomas, sarcomas, gliomas, bone, and skin cancers.
- the carcinomas may include carcinomas of the oral cavity, esophagus, gastrointestinal tract, pulmonary tract, lung, stomach, colon, breast, ovary, prostate, uterus, endometrium, cervix, urinary bladder, pancreas, bone, brain, connective tissue, liver, gall bladder, urinary bladder, kidney, skin, central nervous system and testes.
- the subject methods and compositions may be used to treat an infectious disease, for example diseases involving infection by pathogens such as bacteria, rickettsia, mycoplasma, protozoa, fungi, viruses, parasites, or other microbial agents.
- HIV human immunodeficiency virus
- Examples include human immunodeficiency virus (HIV) causing AIDS, Mycobacterium of tuberculosis, Streptococcus agalactiae, methicillin-resistant Staphylococcus aureus, Legionella pneumophilia, Streptococcus pyogenes, Escherichia coli, Neisseria gonorrhoeae, Neisseria meningitidis, Pneumococcus, Cryptococcus neoformans, Histoplasma capsulatum,
- HCV human immunodeficiency virus
- Hemophilis influenzae B Treponema pallidum, Lyme disease spirochetes, West Nile virus, Pseudomonas aeruginosa, Mycobacterium leprae, Brucella abortus, rabies virus, influenza virus, cytomegalovirus, herpes simplex virus I, herpes simplex virus II, human serum parvo- like virus, respiratory syncytial virus, varicella-zoster virus, hepatitis B virus, hepatitis C virus, measles virus, adenovirus, human T-cell leukemia viruses, Epstein-Barr virus, murine leukemia virus, mumps virus, vesicular stomatitis virus, Sindbis virus, lymphocytic choriomeningitis virus, wart virus, blue tongue virus, Sendai virus, feline leukemia virus, reo virus, polio virus, simian virus 40, mouse mammary tumor virus, dengue virus,
- the drug conjugates may be used in combination with surgery, radiation therapy, chemotherapy, immunotherapy with naked antibodies, radioimmunotherapy, immunomodulators, vaccines, and the like.
- combination therapies can allow lower doses of each therapeutic to be given in such combinations, thus reducing certain severe side effects, and potentially reducing the courses of therapy required.
- ful doses of each can also be given.
- the drug immunoconjugates can be combined with other therapeutic drugs, immunomodulators, naked MAbs, or vaccines (e.g., MAbs against hepatitis, HIV, or papilloma viruses, or vaccines based on immunogens of these viruses, or kinase inhibitors, such as in hepatitis B).
- vaccines e.g., MAbs against hepatitis, HIV, or papilloma viruses, or vaccines based on immunogens of these viruses, or kinase inhibitors, such as in hepatitis B.
- Antibodies and antigen-based vaccines against these and other viral pathogens are known in the art and, in some cases, already in commercial use.
- Preferred optimal dosing of immunoconjugates may include a dosage of between 3 mg/kg and 20 mg/kg, preferably given either weekly, twice weekly or every other week.
- the optimal dosing schedule may include treatment cycles of two consecutive weeks of therapy followed by one, two, three or four weeks of rest, or alternating weeks of therapy and rest, or one week of therapy followed by two, three or four weeks of rest, or three weeks of therapy followed by one, two, three or four weeks of rest, or four weeks of therapy followed by one, two, three or four weeks of rest, or five weeks of therapy followed by one, two, three, four or five weeks of rest, or administration once every two weeks, once every three weeks or once a month.
- Treatment may be extended for any number of cycles, preferably at least 2, at least 4, at least 6, at least 8, at least 10, at least 12, at least 14, or at least 16 cycles.
- the dosage may be up to 24 mg/kg.
- Exemplary dosages of use may include 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 6 mg/kg, 7 mg/kg, 8 mg/kg, 9 mg/kg, 10 mg/kg, 11 mg/kg, 12 mg/kg, 13 mg/kg, 14 mg/kg, 15 mg/kg, 16 mg/kg, 17 mg/kg, 18 mg/kg, 19 mg/kg, 20 mg/kg, 22 mg/kg and 24 mg/kg.
- Preferred dosages are 4, 6, 8, 9, 10, 12, 14, 16 or 18 mg/kg.
- the person of ordinary skill will realize that a variety of factors, such as age, general health, specific organ function or weight, as well as effects of prior therapy on specific organ systems (e.g., bone marrow) may be considered in selecting an optimal dosage of immunoconjugate, and that the dosage and/or frequency of administration may be increased or decreased during the course of therapy.
- the dosage may be repeated as needed, with evidence of tumor shrinkage observed after as few as 4 to 8 doses.
- the optimized dosages and schedules of administration disclosed herein show unexpected superior efficacy and reduced toxicity in human subjects, which could not have been predicted from animal model studies. Surprisingly, the superior efficacy allows treatment of tumors that were previously found to be resistant to one or more standard anti -cancer therapies, including the parental compound, CPT-11, from which SN-38 is derived in vivo.
- the subject methods may include use of CT and/or PET/CT, or MRI, to measure tumor response at regular intervals.
- CA19-9 (carcinoembryonic antigen), CA19-9, AFP, CA 15.3, or PSA, may also be monitored.
- Dosages and/or administration schedules may be adjusted as needed, according to the results of imaging and or marker blood levels.
- a surprising result with the instant claimed compositions and methods is the unexpected tolerability of high doses of antibody-drug conjugate, even with repeated infusions, with only relatively low-grade toxicities of nausea and vomiting observed, or manageable neutropenia.
- a further surprising result is the lack of accumulation of the antibody-drug conjugate, unlike other products that have conjugated SN-38 to albumin, PEG or other carriers. The lack of accumulation is associated with improved tolerability and lack of serious toxicity even after repeated or increased dosing.
- the claimed methods provide for shrinkage of solid tumors, in individuals with previously resistant cancers, of 15% or more, preferably 20% or more, preferably 30% or more, more preferably 40% or more in size (as measured by longest diameter).
- tumor size may be measured by a variety of different techniques, such as total tumor volume, maximal tumor size in any dimension or a combination of size measurements in several dimensions. This may be with standard radiological procedures, such as computed tomography, ultrasonography, and/or positron- emission tomography.
- the means of measuring size is less important than observing a trend of decreasing tumor size with immunoconjugate treatment, preferably resulting in elimination of the tumor.
- the immunoconjugate may be administered as a periodic bolus injection, in alternative embodiments the immunoconjugate may be administered by continuous infusion of antibody-drug conjugates.
- a continuous infusion may be administered for example by indwelling catheter.
- indwelling catheter Such devices are known in the art, such as HICKMAN®, BROVIAC® or PORT-A-CATH® catheters (see, e.g., Skolnik et al., Ther Drug Monit 32:741-48, 2010) and any such known indwelling catheter may be used.
- a variety of continuous infusion pumps are also known in the art and any such known infusion pump may be used.
- the dosage range for continuous infusion may be between 0.1 and 3.0 mg/kg per day. More preferably, these immunoconjugates can be administered by intravenous infusions over relatively short periods of 2 to 5 hours, more preferably 2-3 hours.
- the immunoconjugates and dosing schedules may be efficacious in patients resistant to standard therapies.
- an hMN-14-SN- 38 immunoconjugate may be administered to a patient who has not responded to prior therapy with irinotecan, the parent agent of SN-38.
- the irinotecan-resistant patient may show a partial or even a complete response to hMN-14-SN-38.
- the ability of the immunoconjugate to specifically target the tumor tissue may overcome tumor resistance by improved targeting and enhanced delivery of the therapeutic agent.
- an anti- CEACAM5 immunoconjugate such as hMN-14
- an anti- CEACAM6 immunoconjugate such as hMN-3 or hMN-15.
- Other antibody-SN-38 immunoconjugates may show similar improved efficacy and/or decreased toxicity, compared to alternative standard therapeutic treatments, and combinations of different SN-38 immunoconjugates, or SN-38-antibody conjugates in combination with an antibody conjugated to a radionuclide, toxin or other drug, may provide even more improved efficacy and/or reduced toxicity.
- a specific preferred subject may be a metastatic colon cancer patient, a triple-negative breast cancer patient, a HER+, ER+, progesterone+ breast cancer patient, a metastatic non-small-cell lung cancer (NSCLC) patient, a metastatic pancreatic cancer patient, a metastatic renal cell carcinoma patient, a metastatic gastric cancer patient, a metastatic prostate cancer patient, or a metastatic small-cell lung cancer patient.
- NSCLC metastatic non-small-cell lung cancer
- FIG. 1 In vivo therapy of athymic nude mice, bearing Capan 1 human pancreatic carcinoma, with MAb-CL2A-SN-38 conjugates.
- FIG. 2 In vivo therapy of athymic nude mice, bearing BxPC3 human pancreatic carcinoma, with MAb-CL2A-SN-38 conjugates.
- FIG. 3 In vivo therapy of athymic nude mice, bearing LS174T human colon carcinoma, with hMN-14-CL2A-SN-38 conjugate.
- FIG. 4 Survival curves of hMN14-CL-SN-38 treated mice bearing GW-39 lung metastatic disease.
- mice bearing Calu-3 tumors (N - 5-7) were injected with hRS7-CL2-SN-38 every 4 days for a total of 4 injections (q4dx4).
- FIG. 6 Comparative efficacy of epratuzumab (Emab)-SN-38 and veltuzumab (Vmab)-SN-38 conjugates in the subcutaneous Ramos model.
- Nude mice (N 10 per group) with tumors averaging approximately 0.35 cm 3 (0.20-0.55 cm 3 ) were administered 0.25 or 0.5 mg of each conjugate twice weekly for 4 weeks.
- FIG. 7 Specificity of Emab anti-CD22-SN-38 conjugate (solid line) versus an irrelevant labetuzumab (Lmab)-SN-38 conjugate (dashed line) in nude mice bearing subcutaneous Ramos tumors. Animals were given twice weekly doses of the conjugates intraperitoneally for 4 weeks. A, B, and C were given 75, 125, and 250 g of each conjugate per dose (54.5, 91 , and 182 g/kg of SN-38, respectively, based on average weight of 22 g). Survival based on time-to-progression (TTP) to 3.0 cm 3 , with tumors stalling at an average size of 0.4 cm 3 .
- TTP time-to-progression
- FIG. 8 History of prior treatment of patient, before administering IMMU-130 (labetuzumab-NS-38).
- Prior treatment included stage IV CRC coloectomy/hepatectomy (partial lobe), radiofrequency ablation therapy of liver metasteses, wedge resection of lung metasteses, and chemotherapy with irinotecan/oxaliplatin, Folfirinox, Folfirinox +
- an antibody refers to a full-length (i.e., naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes) immunoglobulin molecule (e.g., an IgG antibody) or an antigen-binding portion of an immunoglobulin molecule, such as an antibody fragment.
- An antibody or antibody fragment may be conjugated or otherwise derivatized within the scope of the claimed subject matter.
- Such antibodies include but are not limited to IgGl, IgG2, IgG3, IgG4 (and IgG4 subforms), as well as IgA isotypes.
- the abbreviation "MAb” may be used interchangeably to refer to an antibody, antibody fragment, monoclonal antibody or multispecific antibody.
- An antibody fragment is a portion of an antibody such as F(ab') 2 , F(ab) 2 , Fab', Fab, Fv, scFv (single chain Fv), single domain antibodies (DABs or VHHs) and the like, including the half-molecules of IgG4 cited above (van der Neut Kolfschoten et al. (Science 2007; 317(14 Sept): 1554-1557). Regardless of structure, an antibody fragment of use binds with the same antigen that is recognized by the intact antibody.
- the term "antibody fragment” also includes synthetic or genetically engineered proteins that act like an antibody by binding to a specific antigen to form a complex.
- antibody fragments include isolated fragments consisting of the variable regions, such as the "Fv” fragments consisting of the variable regions of the heavy and light chains and recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker ("scFv proteins").
- the fragments may be constructed in different ways to yield multivalent and/or multispecific binding forms.
- a naked antibody is generally an entire antibody that is not conjugated to a therapeutic agent.
- a naked antibody may exhibit therapeutic and/or cytotoxic effects, for example by Fc-dependent functions, such as complement fixation (CDC) and ADCC
- Naked antibodies include polyclonal and monoclonal antibodies, naturally occurring or recombinant antibodies, such as chimeric, humanized or human antibodies and fragments thereof. In some cases a “naked antibody” may also refer to a “naked” antibody fragment. As defined herein, “naked” is synonymous with “unconjugated,” and means not linked or conjugated to a therapeutic agent.
- a chimeric antibody is a recombinant protein that contains the variable domains of both the heavy and light antibody chains, including the complementarity determining regions (CDRs) of an antibody derived from one species, preferably a rodent antibody, more preferably a murine antibody, while the constant domains of the antibody molecule are derived from those of a human antibody.
- CDRs complementarity determining regions
- the constant domains of the chimeric antibody may be derived from that of other species, such as a primate, cat or dog.
- a humanized antibody is a recombinant protein in which the CDRs from an antibody from one species; e.g., a murine antibody, are transferred from the heavy and light variable chains of the murine antibody into human heavy and light variable domains (framework regions).
- the constant domains of the antibody molecule are derived from those of a human antibody.
- specific residues of the framework region of the humanized antibody particularly those that are touching or close to the CDR sequences, may be modified, for example replaced with the corresponding residues from the original murine, rodent, subhuman primate, or other antibody.
- a human antibody is an antibody obtained, for example, from transgenic mice that have been "engineered” to produce human antibodies in response to antigenic challenge.
- elements of the human heavy and light chain loci are introduced into strains of mice derived from embryonic stem cell lines that contain targeted disruptions of the endogenous heavy chain and light chain loci.
- the transgenic mice can synthesize human antibodies specific for various antigens, and the mice can be used to produce human antibody-secreting hybridomas. Methods for obtaining human antibodies from transgenic mice are described by Green et al, Nature Genet. 7:13 (1994), Lonberg et al, Nature
- a fully human antibody also can be constructed by genetic or chromosomal transfection methods, as well as phage display technology, all of which are known in the art. See for example, McCafferty et al, Nature 348:552-553 (1990) for the production of human antibodies and fragments thereof in vitro, from immunoglobulin variable domain gene repertoires from unimmunized donors. In this technique, human antibody variable domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, and displayed as functional antibody fragments on the surface of the phage particle.
- the filamentous particle contains a single-stranded DNA copy of the phage genome, selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties. In this way, the phage mimics some of the properties of the B cell.
- Phage display can be performed in a variety of formats, for their review, see e.g. Johnson and Chiswell, Current Opinion in Structural Biology 3:5564-571 (1993).
- Human antibodies may also be generated by in vitro activated B cells. See U.S. Patent Nos. 5,567,610 and 5,229,275, the Examples section of each of which is incorporated herein by reference.
- a therapeutic agent is an atom, molecule, or compound that is useful in the treatment of a disease.
- therapeutic agents include, but are not limited to, antibodies, antibody fragments, immunoconjugates, drugs, cytotoxic agents, pro-apopoptotic agents, toxins, nucleases (including DNAses and RNAses), hormones, immunomodulators, chelators, boron compounds, photoactive agents or dyes, radionuclides, oligonucleotides, interference RNA, siRNA, RNAi, anti-angiogenic agents, chemotherapeutic agents, cyokines,
- chemokines prodrugs, enzymes, binding proteins or peptides or combinations thereof.
- An immunoconjugate is an antibody, antigen-binding antibody fragment, antibody complex or antibody fusion protein that is conjugated to a therapeutic agent. Conjugation may be covalent or non-covalent. Preferably, conjugation is covalent.
- the term antibody fusion protein is a recombinantly-produced antigen- binding molecule in which one or more natural antibodies, single-chain antibodies or antibody fragments are linked to another moiety, such as a protein or peptide, a toxin, a cytokine, a hormone, etc.
- the fusion protein may comprise two or more of the same or different antibodies, antibody fragments or single-chain antibodies fused together, which may bind to the same epitope, different epitopes on the same antigen, or different antigens.
- An immunomodulator is a therapeutic agent that when present, alters, suppresses or stimulates the body's immune system.
- an immunomodulator of use stimulates immune cells to proliferate or become activated in an immune response cascade, such as macrophages, dendritic cells, B-cells, and/or T-cells.
- an immune response cascade such as macrophages, dendritic cells, B-cells, and/or T-cells.
- an immunomodulator may suppress proliferation or activation of immune cells.
- An example of an immunomodulator as described herein is a cytokine, which is a soluble small protein of approximately 5-20 kDa that is released by one cell population (e.g., primed T-lymphocytes) on contact with specific antigens, and which acts as an intercellular mediator between cells.
- cytokines include lymphokines, monokines, interleukins, and several related signaling molecules, such as tumor necrosis factor (TNF) and interferons.
- TNF tumor necrosis factor
- Chemokines are a subset of cytokines.
- Certain interleukins and interferons are examples of cytokines that stimulate T cell or other immune cell proliferation.
- Exemplary interferons include interferon-a, interferon- ⁇ , interferon- ⁇ and interferon- ⁇ .
- CPT is an abbreviation for camptothecin, and as used in the present application CPT represents camptothecin itself or an analog or derivative of camptothecin, such as SN-38.
- Non-limiting methods and compositions for preparing immunoconjugates comprising a camptothecin therapeutic agent attached to an antibody or antigen-binding antibody fragment are described below.
- the solubility of the drug is enhanced by placing a defined polyethyleneglycol (PEG) moiety (i.e., a PEG containing a defined number of monomelic units) between the drug and the antibody, wherein the defined PEG is a low molecular weight PEG, preferably containing 1-30 monomeric units, more preferably containing 1-12 monomeric units.
- PEG polyethyleneglycol
- a first linker connects the drug at one end and may terminate with an acetylene or an azide group at the other end.
- This first linker may comprise a defined PEG moiety with an azide or acetylene group at one end and a different reactive group, such as carboxylic acid or hydroxyl group, at the other end.
- Said bifunctional defined PEG may be attached to the amine group of an amino alcohol, and the hydroxyl group of the latter may be attached to the hydroxyl group on the drug in the form of a carbonate.
- non- azide(or acetylene) moiety of said defined bifunctional PEG is optionally attached to the N- terminus of an L-amino acid or a polypeptide, with the C-terminus attached to the amino group of amino alcohol, and the hydroxy group of the latter is attached to the hydroxyl group of the drug in the form of carbonate or carbamate, respectively.
- a second linker comprising an antibody-coupling group and a reactive group complementary to the azide (or acetylene) group of the first linker, namely acetylene (or azide), may react with the drag-(first linker) conjugate via acetylene-azide cycloaddition reaction to furnish a final bifunctional drug product that is useful for conjugating to disease- targeting antibodies.
- the antibody-coupling group is preferably either a thiol or a thiol- reactive group.
- bifunctional CPT is conjugated to an antibody without prior deprotection of this protecting group.
- the protecting group is readily deprotected under physiological pH conditions after the bioconjugate is administered.
- the azide part may be on L2 with the acetylene part on L3.
- L2 may contain acetylene, with L3 containing azide.
- 'Click chemistry' refers to a copper (+l)-catalyzed cycloaddition reaction between an acetylene moiety and an azide moiety (Kolb HC and Sharpless KB, Drug Discov Today 2003; 8: 1 128-37), although alternative forms of click chemistry are known and may be used. Click chemistry takes place in aqueous solution at near-neutral pH conditions, and is thus amenable for drug conjugation. The advantage of click chemistry is that it is a copper (+l)-catalyzed cycloaddition reaction between an acetylene moiety and an azide moiety (Kolb HC and Sharpless KB, Drug Discov Today 2003; 8: 1 128-37), although alternative forms of click chemistry are known and may be used. Click chemistry takes place in aqueous solution at
- a conjugate comprises an antibody or antibody fragment
- another type of targeting moiety such as an aptamer, avimer, affibody or peptide ligand, may be substituted.
- An exemplary preferred embodiment is directed to a conjugate of a drug derivative and an antibody of the general formula 2,
- MAb is a disease-targeting antibody
- L2 is a component of the cross-linker comprising an antibody-coupling moiety and one or more of acetylene (or azide) groups
- LI comprises a defined PEG with azide (or acetylene) at one end, complementary to the acetylene (or azide) moiety in L2, and a reactive group such as carboxylic acid or hydroxyl group at the other end
- AA is an L-amino acid
- m is an integer with values of 0, 1, 2, 3, or 4
- A' is an additional spacer, selected from the group of ethanolamine, 4-hydroxybenzyl alcohol, 4-aminobenzyl alcohol, or substituted or unsubstituted ethylenediamine.
- the L amino acids of 'AA' are selected from alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine. If the A' group contains hydroxyl, it is linked to the hydroxyl group or amino group of the drug in the form of a carbonate or carbamate, respectively.
- A' is a substituted ethanolamine derived from an L-amino acid, wherein the carboxylic acid group of the amino acid is replaced by a hydroxymethyl moiety.
- A' may be derived from any one of the following L-amino acids: alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine.
- m is 1 and represented by a derivatized L-lysine, A' is L-valinol, and the drug is exemplified by SN- 38.
- the structure is shown in formula 4.
- an amide bond is first formed between the carboxylic acid of an amino acid such as lysine and the amino group of valinol, using orthogonal protecting groups for the lysine amino groups.
- the protecting group on the N-terminus of lysine is removed, keeping the protecting group on the side chain of lysine intact, and the N-terminus is coupled to the carboxyl group on the defined PEG with azide (or acetylene) at the other end.
- the small MW SN-38 product namely valinol-SN-38 carbonate, generated after intracellular proteolysis, has the additional pathway of liberation of intact SN-38 through intramolecular cyclization involving the amino group of valinol and the carbonyl of the carbonate.
- A' of the general formula 2 is A-OH, whereby A- OH is a collapsible moiety such as 4-aminobenzyl alcohol or a substituted 4-aminobenzyl alcohol substituted with a Q-CJO alkyl group at the benzylic position, and the latter, via its amino group, is attached to an L-amino acid or a polypeptide comprising up to four L-amino acid moieties; wherein the N-terminus is attached to a cross-linker terminating in the antibody-binding group.
- A- OH is a collapsible moiety such as 4-aminobenzyl alcohol or a substituted 4-aminobenzyl alcohol substituted with a Q-CJO alkyl group at the benzylic position, and the latter, via its amino group, is attached to an L-amino acid or a polypeptide comprising up to four L-amino acid moieties; wherein the N-terminus is attached to a cross-linker
- the structure is represented below (formula 5, referred to as MAb-CLX-SN-38).
- Single amino acid of AA is selected from any one of the following L- amino acids: alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine.
- the substituent R on 4-aminobenzyl alcohol moiety is hydrogen or an alkyl group selected from CI -CIO alkyl groups.
- AA comprises a polypeptide moiety, preferably a di, tri or tetrapeptide, that is cleavable by intracellular peptidase. Examples are: Ala-Leu, Leu-Ala- Leu, and Ala-Leu-Ala-Leu (Trouet et al., 1982).
- the LI component of the conjugate contains a defined polyethyleneglycol (PEG) spacer with 1-30 repeating monomeric units, hi a further preferred embodiment, PEG is a defined PEG with 1-12 repeating monomeric units.
- PEG polyethyleneglycol
- the introduction of PEG may involve using heterobifunctionalized PEG derivatives which are available commercially.
- the heterobifunctional PEG may contain an azide or acetylene group.
- An example of a heterobifunctional defined PEG containing 8 repeating monomeric units, with 'NHS' being succinimidyl, is given below in formula 8: (8)
- L2 has a plurality of acetylene (or azide) groups, ranging from 2-40, but preferably 2-20, and more preferably 2-5, and a single antibody-binding moiety.
- a representative SN-38 conjugate of an antibody containing multiple drug molecules and a single antibody-binding moiety is shown below.
- the 'L2' component of this structure is appended to 2 acetylenic groups, resulting in the attachment of two azide-appended SN-38 molecules.
- the bonding to MAb is represented as a succinimide.
- the thiols on the antibody are generated on the lysine groups of the antibody using a thiolating reagent.
- Methods for introducing thiol groups onto antibodies by modifications of MAb's lysine groups are well known in the art (Wong in Chemistry of protein conjugation and cross-linking, CRC Press, Inc., Boca Raton, FL (1991), pp 20-22).
- mild reduction of interchain disulfide bonds on the antibody (Willner et al, Bioconjugate Chem.
- reducing agents such as dithiothreitol (DTT) can generate 7-to-10 thiols on the antibody; which has the advantage of incorporating multiple drug moieties in the interchain region of the MAb away from the antigen-binding region.
- DTT dithiothreitol
- attachment of SN-38 to reduced disulfide sulfhydryl groups results in formation of an antibody-SN-38 immunoconjugate with 6 SN-38 moieties covalently attached per antibody molecule.
- Other methods of providing cysteine residues for attachment of drugs or other therapeutic agents are known, such as the use of cysteine engineered antibodies (see U.S. Patent No. 7,521,541, the Examples section of which is incorporated herein by reference.)
- the chemotherapeutic moiety is selected from the group consisting of doxorubicin (DOX), epirubicin, morpholinodoxorubicin (morpholino- DOX), cyanomorpholino-doxorubicin (cyanomorpholino-DOX), 2-pyrrolino-doxorubicin (2- PDOX), Pro-2PDOX, CPT, 10-hydroxy camptothecin, SN-38, topotecan, lurtotecan, 9- aminocamptothecin, 9-nitrocamptothecin, taxanes, geldanamycin, ansamycins, and epothilones.
- the chemotherapeutic moiety is SN-38.
- the antibody links to at least one chemotherapeutic moiety; preferably 1 to about 12 chemotherapeutic moieties; most preferably about 6 to about 12 chemotherapeutic moieties.
- the linker component 'L2' comprises a thiol group that reacts with a thiol-reactive residue introduced at one or more lysine side chain amino groups of said antibody.
- the antibody is pre-derivatized with a thiol- reactive group such as a maleimide, vinylsulfone, bromoacetamide, or iodoacetamide by procedures well described in the art.
- CPT drug-linkers can be prepared wherein CPT additionally has a 10-hydroxyl group.
- This process involves, but is not limited to, the protection of the 10-hydroxyl group as a t- butyloxycarbonyl (BOC) derivative, followed by the preparation of the penultimate intermediate of the drug-linker conjugate.
- BOC t- butyloxycarbonyl
- removal of BOC group requires treatment with strong acid such as trifluoroacetic acid (TFA).
- TFA trifluoroacetic acid
- the CPT 20-0- linker carbonate, containing protecting groups to be removed is also susceptible to cleavage, thereby giving rise to unmodified CPT.
- An alternative approach involves protecting the CPT analog's 10-hydroxy position with a group other than 'BOC, such that the the final product is ready for conjugation to antibodies without a need for deprotecting the 10-OH protecting group.
- the 10-hydroxy protecting group which converts the 10-OH into a phenolic carbonate or a phenolic ester, is readily deprotected by physiological pH conditions or by esterases after in vivo
- a 10-hydroxy protecting group on SN-38 can be 'COR' where R can be a substituted alkyl such as "N(CH 3 ) 2 -(CH 2 ) consult-" where n is 1-10 and wherein the terminal amino group is optionally in the form of a quaternary salt for enhanced aqueous solubility, or a simple alkyl residue such as "CH 3 -(CH 2 ) n -" where n is 0-10, or it can be an alkoxy moiety such as "CH 3 -(CH 2 )n-0-" where n is 0-10, or "N(CH 3 ) 2 -(CH 2 ) n -0-" where n is 2-10, or "R 1 0-(CH 2 -CH 2 -0) n -CH 2 -CH 2 -0-" where Ri is ethyl or methyl and n is an integer with values of 0-10.
- 10-hydroxy derivatives are readily prepared by treatment with the chloroformate of the chosen reagent, if the final derivative is to be a carbonate.
- the 10-hydroxy-containing camptothecin such as SN-38 is treated with a molar equivalent of the chloroformate in dimethylformamide using triethylamine as the base. Under these conditions, the 20-OH position is unaffected.
- the acid chloride of the chosen reagent is used.
- cross-linker [Ll]-[AA] m -[A-OH]
- the cross-linker [Ll]-[AA] m -[A-OH]
- the antibody is a monoclonal antibody (MAb).
- the antibody may be a multivalent and/or multispecific MAb.
- the antibody may be a murine, chimeric, humanized, or human monoclonal antibody, and said antibody may be in intact, fragment (Fab, Fab', F(ab) 2 , F(ab') 2 ), or sub-fragment (single-chain constructs) form, or of an IgGl, IgG2a, IgG3, IgG4, IgA isotype, or submolecules therefrom.
- the antibody binds to an antigen or epitope of an antigen expressed on a cancer or malignant cell.
- the cancer cell is preferably a cell from a hematopoietic tumor, carcinoma, sarcoma, melanoma or a glial tumor.
- a preferred malignancy to be treated according to the present invention is a malignant solid tumor or hematopoietic neoplasm.
- the intracellularly-cleavable moiety may be cleaved after it is internalized into the cell upon binding by the MAb-drug conjugate to a receptor thereof, and particularly cleaved by esterases and peptidases.
- monoclonal antibodies can be obtained by injecting mice with a composition comprising an antigen, removing the spleen to obtain B- lymphocytes, fusing the B-lymphocytes with myeloma cells to produce hybridomas, cloning the hybridomas, selecting positive clones which produce antibodies to the antigen, culturing the clones that produce antibodies to the antigen, and isolating the antibodies from the hybridoma cultures.
- MAbs can be isolated and purified from hybridoma cultures by a variety of well-established techniques. Such isolation techniques include affinity chromatography with Protein-A or Protein-G Sepharose, size-exclusion chromatography, and ion-exchange chromatography. See, for example, Coligan at pages 2.7.1-2.7.12 and pages 2.9.1-2.9.3. Also, see Baines et al, "Purification of Immunoglobulin G (IgG)," in METHODS ⁇
- Antibodies of use may be commercially obtained from a wide variety of known sources.
- a variety of antibody secreting hybridoma lines are available from the American Type Culture Collection (ATCC, Manassas, VA).
- a large number of antibodies against various disease targets, including but not limited to tumor-associated antigens, have been deposited at the ATCC and/or have published variable region sequences and are available for use in the claimed methods and compositions. See, e.g., U.S. Patent Nos. 7,312,318; 7,282,567; 7,151,164; 7,074,403; 7,060,802;
- antibody sequences or antibody-secreting hybridomas against almost any disease-associated antigen may be obtained by a simple search of the ATCC, NCBI and/or USPTO databases for antibodies against a selected disease-associated target of interest.
- the antigen binding domains of the cloned antibodies may be amplified, excised, ligated into an expression vector, transfected into an adapted host cell and used for protein production, using standard techniques well known in the art.
- Isolated antibodies may be conjugated to therapeutic agents, such as camptothecins, using the techniques disclosed herein.
- a chimeric antibody is a recombinant protein in which the variable regions of a human antibody have been replaced by the variable regions of, for example, a mouse antibody, including the complementarity-determining regions (CDRs) of the mouse antibody. Chimeric antibodies exhibit decreased immunogenicity and increased stability when administered to a subject. Methods for constructing chimeric antibodies are well known in the art (e.g., Leung et al., 1994, Hybridoma 13:469).
- a chimeric monoclonal antibody may be humanized by transferring the mouse CDRs from the heavy and light variable chains of the mouse immunoglobulin into the
- Humanized monoclonal antibodies may be used for therapeutic treatment of subjects. Techniques for production of humanized monoclonal antibodies are well known in the art. (See, e.g., Jones et al., 1986, Nature, 321:522; Riechmann et al., Nature, 1988, 332:323; Verhoeyen et al., 1988, Science, 239:1534; Carter et al., 1992, Proc. Nat'lAcad. Sci. USA, 89:4285; Sandhu, Crit. Rev.
- an antibody may be a human monoclonal antibody. Such antibodies may be obtained from transgenic mice that have been engineered to produce specific human antibodies in response to antigenic challenge, as discussed below.
- Human Antibodies [084] Methods for producing fully human antibodies using either combinatorial approaches or transgenic animals transformed with human immunoglobulin loci are known in the art (e.g., Mancini et al., 2004, New Microbiol. 27:315-28; Conrad and Scheller, 2005, Comb. Chem. High Throughput Screen. 8:117-26; Brekke and Loset, 2003, Curr. Opin. Phamacol. 3:544-50; each incorporated herein by reference). Such fully human antibodies are expected to exhibit even fewer side effects than chimeric or humanized antibodies and to function in vivo as essentially endogenous human antibodies. In certain embodiments, the claimed methods and procedures may utilize human antibodies produced by such techniques.
- the phage display technique may be used to generate human antibodies (e.g., Dantas-Barbosa et al., 2005, Genet. Mol. Res. 4:126-40, incorporated herein by reference).
- Human antibodies may be generated from normal humans or from humans that exhibit a particular disease state, such as cancer (Dantas-Barbosa et al., 2005).
- the advantage to constructing human antibodies from a diseased individual is that the circulating antibody repertoire may be biased towards antibodies against disease-associated antigens.
- RNAs were converted to cDNAs and used to make Fab cDNA libraries using specific primers against the heavy and light chain immunoglobulin sequences (Marks et al., 1991, J. Mol. Biol. 222:581-97, incorporated herein by reference).
- bacteriophage genome to make the phage display library.
- libraries may be screened by standard phage display methods.
- This technique is exemplary only and any known method for making and screening human antibodies or antibody fragments by phage display may be utilized.
- transgenic animals that have been genetically engineered to produce human antibodies may be used to generate antibodies against essentially any immunogenic target, using standard immunization protocols as discussed above.
- Methods for obtaining human antibodies from transgenic mice are described by Green et al., Nature Genet. 7: 13 (1994), Lonberg et al., Nature 368:856 (1994), and Taylor et al., Int. Immun. 6:579 (1994).
- a non-limiting example of such a system is the XENOMOUSE® (e.g., Green et al., 1999, J. Immunol. Methods 231:11-23, incorporated herein by reference) from Abgenix (Fremont, CA).
- the mouse antibody genes have been inactivated and replaced by functional human antibody genes, while the remainder of the mouse immune system remains intact.
- the XENOMOUSE® was transformed with germline-configured YACs (yeast artificial chromosomes) that contained portions of the human IgH and Ig kappa loci, including the majority of the variable region sequences, along accessory genes and regulatory sequences.
- the human variable region repertoire may be used to generate antibody producing B cells, which may be processed into hybridomas by known techniques.
- XENOMOUSE® immunized with a target antigen will produce human antibodies by the normal immune response, which may be harvested and/or produced by standard techniques discussed above.
- a variety of strains of XENOMOUSE® are available, each of which is capable of producing a different class of antibody.
- Transgenically produced human antibodies have been shown to have therapeutic potential, while retaining the
- compositions and methods are not limited to use of the XENOMOUSE® system but may utilize any transgenic animal that has been genetically engineered to produce human antibodies.
- Some embodiments of the claimed methods and/or compositions may concern antibody fragments.
- Such antibody fragments may be obtained, for example, by pepsin or papain digestion of whole antibodies by conventional methods.
- antibody fragments may be produced by enzymatic cleavage of antibodies with pepsin to provide a 5S fragment denoted F(ab') 2 .
- This fragment may be further cleaved using a thiol reducing agent and, optionally, a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 3.5S Fab' monovalent fragments.
- an enzymatic cleavage using pepsin produces two monovalent Fab fragments and an Fc fragment.
- Fv fragments comprise an association of VH and VL chains. This association can be noncovalent, as described in Inbar et al., 1972, Proc. Nat'l. Acad. Sci. USA, 69:2659.
- the variable chains may be linked by an intermolecular disulfide bond or cross-linked by chemicals such as glutaraldehyde. See Sandhu, 1992, Crit. Rev. Biotech., 12:437.
- the Fv fragments comprise VH and VL chains connected by a peptide linker.
- These single-chain antigen binding proteins are prepared by constructing a structural gene comprising DNA sequences encoding the VH and VL domains, connected by an oligonucleotides linker sequence. The structural gene is inserted into an expression vector that is subsequently introduced into a host cell, such as E. coli. The recombinant host cells synthesize a single polypeptide chain with a linker peptide bridging the two V domains. Methods for producing scFvs are well-known in the art.
- an antibody fragment is a single-domain antibody (dAb), sometimes referred to as a single chain antibody.
- Techniques for producing single-domain antibodies are well known in the art (see, e.g., Cossins et al., Protein Expression and Purification, 2007, 51 :253-59; Shuntao et al., Molec Immunol 2006, 43: 1912- 19; Tanha et al., J. Biol. Chem. 2001 , 276:24774-780).
- Other types of antibody fragments may comprise one or more complementarity-determining regions (CDRs).
- CDR peptides (“minimal recognition units") can be obtained by constructing genes encoding the CDR of an antibody of interest.
- Such genes are prepared, for example, by using the polymerase chain reaction to synthesize the variable region from RNA of antibody-producing cells. See Larrick et al., 1991 , Methods: A Companion to Methods in Enzymology 2: 106; Ritter et al. (eds.), 1995, MONOCLONAL ANTIBODIES: PRODUCTION, ENGINEERING AND CLINICAL APPLICATION, pages 166-179 (Cambridge University Press); Birch et al., (eds.), 1995, MONOCLONAL
- the sequences of antibodies may be varied to optimize the physiological characteristics of the conjugates, such as the half-life in serum.
- Methods of substituting amino acid sequences in proteins are widely known in the art, such as by site-directed mutagenesis (e.g. Sambrook et al., Molecular Cloning, A laboratory manual, 2 nd Ed, 1989).
- the variation may involve the addition or removal of one or more glycosylation sites in the Fc sequence (e.g., U.S. Patent No. 6,254,868, the Examples section of which is incorporated herein by reference).
- specific amino acid substitutions in the Fc sequence may be made (e.g., Hornick et al., 2000, J Nucl Med 41 :355-62; Hinton et al., 2006, J Immunol 176:346-56; Petkova et al. 2006, Int Immunol 18: 1759-69; U.S. Patent No.
- antibodies are used that recognize and/or bind to antigens that are expressed at high levels on target cells and that are expressed predominantly or exclusively on diseased cells versus normal tissues. More preferably, the antibodies internalize rapidly following binding.
- An exemplary rapidly internalizing antibody is the LL1 (anti-CD74) antibody, with a rate of internalization of approximately 8 x 10 6 antibody molecules per cell per day (e.g., Hansen et al., 1996, Biochem J. 320:293-300).
- a "rapidly internalizing" antibody may be one with an internalization rate of about 1 x 10 6 to about 1 x 10 7 antibody molecules per cell per day.
- Antibodies of use in the claimed compositions and methods may include MAbs with properties as recited above.
- Exemplary antibodies of use for therapy of, for example, cancer include but are not limited to LL1 (anti- CD74), LL2 or RFB4 (anti-CD22), veltuzumab (hA20, anti-CD20), rituxumab (anti-CD20), obinutuzumab (GA101 , anti-CD20), lambrolizumab (anti-PD-1 receptor), nivolumab (anti- PD-1 receptor), ipilimumab (anti-CTLA-4), RS7 (anti-epithelial glycoprotein- 1 (EGP-1, also known as TROP-2)), PAM4 or KC4 (both anti-mucin), MN-14 (anti-carcinoembryonic antigen (CEA, also known as CD66e or CEACAM5), MN-15 or MN-3 (anti-CEACAM6), Mu-9 (anti-colon-specific
- hPAM4 U.S. Patent No. 7,282,567
- hA20 U.S. Patent No. 7,251,164
- hA19 U.S. Patent No. 7,109,304
- hIMMU-31 U.S. Patent No. 7,300,655
- hLLl U.S. Patent No. 7,312,318,
- hLL2 U.S. Patent No. 7,074,403
- hMu-9 U.S. Patent No. 7,387,773
- hL243 U.S. Patent No.
- Other useful antigens that may be targeted using the described conjugates include carbonic anhydrase IX, B7, CCCL19, CCCL21, CSAp, WR-2/neu, BrE3, CDl, CD la, CD2, CD3, CD4, CD5, CD8, CDl 1 A, CD14, CD15, CD16, CD18, CD19, CD20 (e.g., C2B8, hA20, 1F5 MAbs), CD21, CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD44, CD45, CD46, CD52, CD54, CD55, CD59, CD64, CD67, CD70, CD74, CD79a, CD80, CD83, CD95, CD126, CD133, CD138, CD147, CD154, CEACAM5, CEACAM6, CTLA-4, alpha-fetoprotein (AFP), VEGF (e.g., AVASTIN®, fibronectin
- CD Cluster Designation
- the CD66 antigens consist of five different glycoproteins with similar structures, CD66a-e, encoded by the carcinoembryonic antigen (CEA) gene family members, BCG, CGM6, NCA, CGM1 and CEA, respectively. These CD66 antigens (e.g., CEACAM6) are expressed mainly in granulocytes, normal epithelial cells of the digestive tract and tumor cells of various tissues. Also included as suitable targets for cancers are cancer testis antigens, such as NY-ESO-1 (Theurillat et al., Int. J. Cancer 2007; 120(11):2411-7), as well as CD79a in myeloid leukemia (Kozlov et al., Cancer Genet.
- CEACAM6 carcinoembryonic antigen
- Macrophage migration inhibitory factor is an important regulator of innate and adaptive immunity and apoptosis. It has been reported that CD74 is the endogenous receptor for MIF (Leng et al., 2003, J Exp Med 197:1467-76).
- the therapeutic effect of antagonistic anti-CD74 antibodies on MIF-mediated intracellular pathways may be of use for treatment of a broad range of disease states, such as cancers of the bladder, prostate, breast, lung, colon and chronic lymphocytic leukemia (e.g., Meyer-Siegler et al., 2004, BMC Cancer 12:34; Shachar & Haran, 201 1, Leuk Lymphoma 52:1446-54); autoimmune diseases such as rheumatoid arthritis and systemic lupus erythematosus (Morand & Leech, 2005, Front Biosci 10:12-22; Shachar & Haran, 2011, Leak Lymphoma 52: 1446-54); kidney diseases such as renal allograft rejection (Lan, 2008, Nephron Exp Nephrol.
- a broad range of disease states such as cancers of the bladder, prostate, breast, lung, colon and chronic lymphocytic leukemia (e.g., Meyer-Siegler et al., 2004, BMC
- Anti-TNF-a antibodies are known in the art and may be of use to treat immune diseases, such as autoimmune disease, immune dysfunction (e.g., graft- versus-host disease, organ transplant rejection) or diabetes.
- Known antibodies against TNF-a include the human antibody CDP571 (Ofei et al., 2011, Diabetes 45:881-85); murine antibodies MTNFAI, M2TNFAI, M3TNFAI, M3TNFABI, M302B and M303 (Thermo Scientific, Rockford, IL); infliximab (Centocor, Malvern, PA); certolizumab pegol (UCB, Brussels, Belgium); and adalimumab (Abbott, Abbott Park, IL).
- antibodies of use for therapy of immune dysregulatory or autoimmune disease include, but are not limited to, anti-B-cell antibodies such as veltuzumab, epratuzumab, milatuzumab or hL243; tocilizumab (anti-IL-6 receptor); basiliximab (anti-CD25); daclizumab (anti-CD25); efalizumab (anti-CD 1 1 a); muromonab-CD3 (anti-CD3 receptor); anti-CD40L (UCB, Brussels, Belgium); natalizumab (anti-a4 integrin) and omalizumab (anti-IgE).
- anti-B-cell antibodies such as veltuzumab, epratuzumab, milatuzumab or hL243; tocilizumab (anti-IL-6 receptor); basiliximab (anti-CD25); daclizumab (anti-CD25); efalizumab (anti-CD 1 1
- Type-1 and Type-2 diabetes may be treated using known antibodies against B-cell antigens, such as CD22 (epratuzumab and hRFB4), CD74 (milatuzumab), CD19 (hA19), CD20 (veltuzumab) or HLA-DR (hL243) (see, e.g., Winer et al., 2011, Nature Med 17:610- 18).
- Anti-CD3 antibodies also have been proposed for therapy of type 1 diabetes (Cernea et al., 2010, Diabetes Metab Rev 26:602-05).
- the pharmaceutical composition of the present invention may be used to treat a subject having a metabolic disease, such amyloidosis, or a neurodegenerative disease, such as Alzheimer's disease.
- a metabolic disease such as amyloidosis
- a neurodegenerative disease such as Alzheimer's disease.
- Bapineuzumab is in clinical trials for Alzheimer's disease therapy.
- Other antibodies proposed for therapy of Alzheimer's disease include Alz 50 (Ksiezak- Reding et al., 1987, J Biol Chem 263:7943-47), gantenerumab, and solanezumab.
- Infliximab an anti-TNF-a antibody, has been reported to reduce amyloid plaques and improve cognition.
- compositions and methods include cardiovascular diseases, such as fibrin clots,
- Antibodies to fibrin e.g., scFv(59D8); T2Gls; MH1 are known and in clinical trials as imaging agents for disclosing said clots and pulmonary emboli, while anti-granulocyte antibodies, such as MN-3, MN-15, anti-NCA95, and anti-CD 15 antibodies, can target myocardial infarcts and myocardial ischemia.
- fibrin e.g., scFv(59D8); T2Gls; MH1
- anti-granulocyte antibodies such as MN-3, MN-15, anti-NCA95, and anti-CD 15 antibodies
- Anti-macrophage, anti-low-density lipoprotein (LDL), anti-MBF, and anti-CD74 (e.g., hLLl) antibodies can be used to target atherosclerotic plaques.
- Abciximab anti-glycoprotein Ilb/IIIa
- Anti-CD3 antibodies have been reported to reduce development and progression of atherosclerosis (Steffens et al., 2006, Circulation 114:1977-84). Antibodies against oxidized LDL induced a regression of established atherosclerosis in a mouse model (Ginsberg, 2007, J Am Coll Cardiol 52:2319- 21). Anti-ICAM-1 antibody was shown to reduce ischemic cell damage after cerebral artery occlusion in rats (Zhang et al., 1994, Neurology 44:1747-51).
- OKT anti-T-cell monoclonal antibodies available from Ortho Pharmaceutical Company which bind to normal T- lymphocytes; the monoclonal antibodies produced by the hybridomas having the ATCC accession numbers HB44, HB55, HB12, HB78 and HB2; G7E11, W8E7, NKP15 and G022 (Becton Dickinson); NEN9.4 (New England Nuclear); and FMC11 (Sera Labs).
- a description of antibodies against fibrin and platelet antigens is contained in Knight, Semin. Nucl. Med., 20:52-67 (1990).
- antibodies are used that internalize rapidly and are then re-expressed, processed and presented on cell surfaces, enabling continual uptake and accretion of circulating conjugate by the cell.
- An example of a most-preferred antibodies are used that internalize rapidly and are then re-expressed, processed and presented on cell surfaces, enabling continual uptake and accretion of circulating conjugate by the cell.
- an anti-CD74 MAb invariant chain, class II-specific chaperone, Ii
- the CD74 antigen is highly expressed on B-cell lymphomas (including multiple myeloma) and leukemias, certain T-cell lymphomas, melanomas, colonic, lung, and renal cancers, glioblastomas, and certain other cancers (Ong et al., Immunology 98:296-302 (1999)).
- a review of the use of CD74 antibodies in cancer is contained in Stein et al., Clin Cancer Res. 2007 Sep 15;13(18 Pt 2):5556s-5563s,
- the diseases that are preferably treated with anti-CD74 antibodies include, but are not limited to, non-Hodgkin's lymphoma, Hodgkin's disease, melanoma, lung, renal, colonic cancers, glioblastome multiforme, histiocytomas, myeloid leukemias, and multiple myeloma.
- Continual expression of the CD74 antigen for short periods of time on the surface of target cells, followed by internalization of the antigen, and re-expression of the antigen enables the targeting LL1 antibody to be internalized along with any chemotherapeutic moiety it carries. This allows a high, and therapeutic, concentration of LL1 -chemotherapeutic drug conjugate to be accumulated inside such cells. Internalized LL1 -chemotherapeutic drug conjugates are cycled through lysosomes and endosomes, and the chemotherapeutic moiety is released in an active form within the target cells.
- the therapeutic conjugates can be used against pathogens, since antibodies against pathogens are known.
- antibodies and antibody fragments which specifically bind markers produced by or associated with infectious lesions, including viral, bacterial, fungal and parasitic infections, for example caused by pathogens such as bacteria, rickettsia, mycoplasma, protozoa, fungi, and viruses, and antigens and products associated with such microorganisms have been disclosed, inter alia, in Hansen et al., U.S. Pat. No. 3,927,193 and Goldenberg U.S. Pat. Nos.
- the pathogens are selected from the group consisting of HIV virus, Mycobacterium tuberculosis, Streptococcus agalactiae, methicillin-resistant Staphylococcus aureus, Legionella pneumophilia, Streptococcus pyogenes, Escherichia coli, Neisseria gonorrhoeae, Neisseria meningitidis, Pneumococcus, Cryptococcus neoformans, Histoplasma capsulatum, Hemophilis influenzae B, Treponema pallidum, Lyme disease spirochetes, Pseudomonas aeruginosa, Mycobacterium leprae, Brucella abortus, rabies virus, influenza virus, cytomegalovirus, herpes simplex virus I, herpes simplex virus II, human serum parvo-like virus, respiratory syncytial virus, varicella
- Toxoplasma gondii Trypanosoma rangeli, Trypanosoma cruzi, Trypanosoma rhodesiensei, Trypanosoma brucei, Schistosoma mansoni, Schistosoma japonicum, Babesia bovis, Elmeria tenella, Onchocerca volvulus, Leishmania tropica, Trichinella spiralis, Theileria parva, Taenia hydatigena, Taenia ovis, Taenia saginata, Echinococcus granulosus, Mesocestoides corti, Mycoplasma arthritidis, M. hyorhinis, M. orale, M. arginini, Acholeplasma laidlawii, M. salivarium and M. pneumoniae, as disclosed in U.S. Patent No. 6,440,416, the Examples section of which is incorporated herein by reference.
- drug conjugates of the present invention comprising anti-gpl20 and other such anti-HIV antibodies can be used as therapeutics for HIV in AIDS patients; and drug conjugates of antibodies to Mycobacterium tuberculosis are suitable as therapeutics for drug-refractive tuberculosis.
- Fusion proteins of anti-gpl20 MAb (anti HIV MAb) and a toxin, such as Pseudomonas exotoxin have been examined for antiviral properties (Van Oigen et al., J Drug Target, 5:75-91, 1998). Attempts at treating HIV infection in AIDS patients failed, possibly due to insufficient efficacy or unacceptable host toxicity.
- the CPT drug conjugates of the present invention advantageously lack such toxic side effects of protein toxins, and are therefore advantageously used in treating HIV infection in AIDS patients.
- These drag conjugates can be given alone or in combination with other antibiotics or therapeutic agents that are effective in such patients when given alone.
- Candidate anti-HIV antibodies include the P4/D10 anti-envelope antibody described by Johansson et al. (AIDS. 2006 Oct 3;20(15):1911-5), as well as the anti-HIV antibodies described and sold by Polymun (Vienna, Austria), also described in U.S. Patent 5,831,034, U.S. Patent 5,911,989, and Vcelar et al., AIDS 2007; 21(16):2161-2170 and Joos et al, Antimicrob. Agents Chemother. 2006; 50(5): 1773-9, all incorporated herein by reference.
- a preferred targeting agent for HIV is various combinations of these antibodies in order to overcome resistance.
- Antibodies of use to treat autoimmune disease or immune system dysfunctions are known in the art and may be conjugated to SN-38 using the disclosed methods and compositions.
- Antibodies of use to treat autoimmune/immune dysfunction disease may bind to exemplary antigens including, but not limited to, BCL-1, BCL-2, BCL-6, CDla, CD2, CD3, CD4, CD5, CD7, CD8, CD10, CDl lb, CDl lc, CD13, CD14, CD15, CD16, CD19, CD20, CD21, CD22, CD23, CD25, CD33, CD34, CD38, CD40, CD40L, CD41a, CD43, CD45, CD55, TNF-alpha, interferon and HLA-DR.
- Antibodies that bind to these and other target antigens, discussed above, may be used to treat autoimmune or immune dysfunction diseases.
- Autoimmune diseases that may be treated with immunoconjugates may include acute idiopathic thrombocytopenic purpura, chronic idiopathic thrombocytopenic purpura, dermatomyositis, Sydenham's chorea, myasthenia gravis, systemic lupus erythematosus, lupus nephritis, rheumatic fever, polyglandular syndromes, bullous pemphigoid, diabetes mellitus, Henoch-Schonlein purpura, post-streptococcal nephritis, erythema nodosum, Takayasu's arteritis, ANCA-associated vasculitides, Addison's disease, rheumatoid arthritis, multiple sclerosis, sarcoidosis, ulcerative co
- Bispecific antibodies are useful in a number of biomedical applications. For instance, a bispecific antibody with binding sites for a tumor cell surface antigen and for a T-cell surface receptor can direct the lysis of specific tumor cells by T cells. Bispecific antibodies recognizing gliomas and the CD3 epitope on T cells have been successfully used in treating brain tumors in human patients (Nitta, et al. Lancet. 1990; 355:368-371). A preferred bispecific antibody is an anti-CD3 X anti-CD 19 antibody.
- an anti-CD3 antibody or fragment thereof may be attached to an antibody or fragment against another B-cell associated antigen, such as anti-CD3 X anti-CD20, anti-CD3 X anti-CD22, anti-CD3 X anti-HLA-DR or anti-CD3 X anti-CD74.
- another B-cell associated antigen such as anti-CD3 X anti-CD20, anti-CD3 X anti-CD22, anti-CD3 X anti-HLA-DR or anti-CD3 X anti-CD74.
- the techniques and compositions for therapeutic agent conjugation disclosed herein may be used with bispecific or multispecific antibodies as the targeting moieties.
- Bispecific antibodies can be produced by the quadroma method, which involves the fusion of two different hybridomas, each producing a monoclonal antibody recognizing a different antigenic site (Milstein and Cuello, Nature, 1983; 305:537- 540).
- Another method for producing bispecific antibodies uses heterobifunctional cross- linkers to chemically tether two different monoclonal antibodies (Staerz, et al. Nature, 1985; 314:628-631 ; Perez, et al. Nature, 1985; 316:354-356).
- Bispecific antibodies can also be produced by reduction of each of two parental monoclonal antibodies to the respective half molecules, which are then mixed and allowed to reoxidize to obtain the hybrid structure (Staerz and Bevan. Proc Natl Acad Sci U SA. 1986; 83: 1453-1457).
- Another alternative involves chemically cross-linking two or three separately purified Fab' fragments using appropriate linkers. (See, e.g.,
- Other methods include improving the efficiency of generating hybrid hybridomas by gene transfer of distinct selectable markers via retrovirus-derived shuttle vectors into respective parental hybridomas, which are fused subsequently (DeMonte, et al. Proc Natl Acad Sci U SA. 1990, 87:2941-2945); or transfection of a hybridoma cell line with expression plasmids containing the heavy and light chain genes of a different antibody.
- Cognate VH and VL domains can be joined with a peptide linker of appropriate composition and length (usually consisting of more than 12 amino acid residues) to form a single-chain Fv (scFv) with binding activity.
- a peptide linker of appropriate composition and length usually consisting of more than 12 amino acid residues
- Methods of manufacturing scFvs are disclosed in U.S. Pat. No. 4,946,778 and U.S. Pat. No. 5,132,405, the Examples section of each of which is incorporated herein by reference. Reduction of the peptide linker length to less than 12 amino acid residues prevents pairing of VH and VL domains on the same chain and forces pairing of VH and VL domains with complementary domains on other chains, resulting in the formation of functional multimers.
- Polypeptide chains of VH and VL domains that are joined with linkers between 3 and 12 amino acid residues form predominantly dimers (termed diabodies). With linkers between 0 and 2 amino acid residues, trimers (termed triabody) and tetramers (termed tetrabody) are favored, but the exact patterns of oligomerization appear to depend on the composition as well as the orientation of V-domains (Vn-linker-V L or VL- linker-Vn), in addition to the linker length.
- the technique utilizes complementary protein binding domains, referred to as anchoring domains (AD) and dimerization and docking domains (DDD), which bind to each other and allow the assembly of complex structures, ranging from dimers, trimers, tetramers, quintamers and hexamers. These form stable complexes in high yield without requirement for extensive purification.
- DNL technique allows the assembly of monospecific, bi specific or multispecific antibodies. Any of the techniques known in the art for making bispecific or multispecific antibodies may be utilized in the practice of the presently claimed methods.
- a conjugate as disclosed herein may be part of a composite, multispecific antibody.
- Such antibodies may contain two or more different antigen binding sites, with differing specificities.
- the multispecific composite may bind to different epitopes of the same antigen, or alternatively may bind to two different antigens.
- Some of the more preferred target combinations include theose listed in Table 1. This is a list of examples of preferred combinations, but is not intended to be exhaustive.
- TNF- ⁇ Proinflammatory effector receptor especially IL-6R IL-13R, and IL-15R
- TNF- ⁇ Coagulation factor especially TF or thrombin
- TNF- ⁇ Complement factor especially C3, C5, C3a, or C5a
- TNF- ⁇ Complement regulatory protein especially CD46, CD55, CD59, and
- TNF- ⁇ Cancer associated antigen or receptor TNF- ⁇ Cancer associated antigen or receptor
- LPS Proinflammatory effector cytokine especially MIF, HMGB-1,
- TNF-a TNF-a, IL-l, or IL-6
- LPS Proinflammatory effector chemokine especially MCP-1, RANTES, MIP- 1A, or MIP-lB
- LPS Proinflammatory effector receptor especially IL-6R IL-13R, and IL-15R
- LPS Coagulation factor especially TF or thrombin
- LPS Complement factor especially C3, C5, C3a, or C5a
- LPS Complement regulatory protein especially CD46, CD55, CD59, and
- TF or thrombin Proinflammatory effector cytokine, especially MIF, HMGB-1,
- TNF-a TNF-a, IL-1, or IL-6
- TF or thrombin Proinflammatory effector chemokine especially MCP-1, RANTES, MIP- 1A, ⁇ ⁇ - ⁇
- TF or thrombin Proinflammatory effector receptor especially IL-6R DL-13R, and IL-15R
- TF or thrombin Complement factor especially C3, C5, C3a, or C5a
- TF or thrombin Complement regulatory protein especially CD46, CD55, CD59, and
- CD20 + CD22 antibodies CD74 + CD20 antibodies, CD74 + CD22 antibodies, CEACAM5 (CEA) + CEACAM6 (NCA) antibodies, insulin-like growth factor (ILGF) + CEACAM5 antibodies, EGP-1 (e.g., RS-7) + ILGF antibodies, CEACAM5 + EGFR antibodies, IL6 + CEACAM6 antibodies.
- CEA CEA
- NCA CEACAM6
- EGP-1 e.g., RS-7 + ILGF antibodies
- CEACAM5 + EGFR antibodies IL6 + CEACAM6 antibodies.
- Such antibodies need not only be used in combination, but can be combined as fusion proteins of various forms, such as IgG, Fab, scFv, and the like, as described in U.S. Patent Nos. 6,083,477; 6,183,744 and 6,962,702 and U.S. Patent Application Publication Nos. 20030124058; 20030219433; 20040001825; 20040202666;
- a bivalent or multivalent antibody is formed as a DOCK- AND-LOCKTM (DNLTM) complex (see, e.g., U.S. Patent Nos. 7,521,056; 7,527,787;
- the technique takes advantage of the specific and high-affinity binding interactions that occur between a dimerization and docking domain (DDD) sequence of the regulatory (R) subunits of cAMP-dependent protein kinase (PKA) and an anchor domain (AD) sequence derived from any of a variety of AKAP proteins (Baillie et /., FEBS Letters. 2005; 579: 3264.
- DDD dimerization and docking domain
- R regulatory subunits of cAMP-dependent protein kinase
- AD anchor domain
- the DDD and AD peptides may be attached to any protein, peptide or other molecule. Because the DDD sequences spontaneously dimerize and bind to the AD sequence, the technique allows the formation of complexes between any selected molecules that may be attached to DDD or AD sequences.
- the standard DNLTM complex comprises a trimer with two DDD-linked molecules attached to one AD-linked molecule
- variations in complex structure allow the formation of dimers, trimers, tetramers, pentamers, hexamers and other multimers.
- the DNLTM complex may comprise two or more antibodies, antibody fragments or fusion proteins which bind to the same antigenic determinant or to two or more different antigens.
- the DNLTM complex may also comprise one or more other effectors, such as proteins, peptides, immunomodulators, cytokines, interleukins, interferons, binding proteins, peptide ligands, carrier proteins, toxins, ribonucleases such as onconase, inhibitory oligonucleotides such as siRNA, antigens or xenoantigens, polymers such as PEG, enzymes, therapeutic agents, hormones, cytotoxic agents, anti-angiogenic agents, pro-apoptotic agents or any other molecule or aggregate.
- effectors such as proteins, peptides, immunomodulators, cytokines, interleukins, interferons, binding proteins, peptide ligands, carrier proteins, toxins, ribonucleases such as onconase, inhibitory oligonucleotides such as siRNA, antigens or xenoantigens, polymers such as PEG, enzymes, therapeutic agents, hormones,
- PKA which plays a central role in one of the best studied signal transduction pathways triggered by the binding of the second messenger cAMP to the R subunits, was first isolated from rabbit skeletal muscle in 1968 (Walsh et al., J. Biol, Chem. 1968;243:3763).
- the structure of the holoenzyme consists of two catalytic subunits held in an inactive form by the R subunits (Taylor, J. Biol. Chem. 1989;264:8443). Isozymes of PKA are found with two types of R subunits (RI and RII), and each type has a and ⁇ isoforms (Scott, Pharmacol. Ther. 1991 ;50:123).
- the four isoforms of PKA regulatory subunits are RIa, Rr ⁇ Rlla and RIi .
- the R subunits have been isolated only as stable dimers and the dimerization domain has been shown to consist of the first 44 amino-terminal residues of Rlla (Newlon et al., Nat. Struct. Biol. 1999; 6:222).
- similar portions of the amino acid sequences of other regulatory subunits are involved in dimerization and docking, each located near the N-terminal end of the regulatory subunit.
- Binding of cAMP to the R subunits leads to the release of active catalytic subunits for a broad spectrum of serine/threonine kinase activities, which are oriented toward selected substrates through the compartmentalization of PKA via its docking with AKAPs (Scott et al, J. Biol. Chem. 1990;265;21561)
- AKAP microtubule-associated protein-2
- the amino acid sequences of the AD are quite varied among individual AKAPs, with the binding affinities reported for RII dimers ranging from 2 to 90 nM (Alto et al, Proc. Natl. Acad. Sci. USA. 2003; 100:4445). AKAPs will only bind to dimeric R subunits.
- the AD binds to a hydrophobic surface formed by the 23 amino-terminal residues (Colledge and Scott, Trends Cell Biol. 1999; 6:216).
- the dimerization domain and AKAP binding domain of human Rlla are both located within the same N-terminal 44 amino acid sequence (Newlon et al, Nat. Struct. Biol. 1999;6:222; Newlon et al, EMBO J. 2001 ;20: 1651), which is termed the DDD herein.
- Entity B is constructed by linking an AD sequence to a precursor of B, resulting in a second component hereafter referred to as b.
- the dimeric motif of DDD contained in a 2 will create a docking site for binding to the AD sequence contained in b, thus facilitating a ready association of a 2 and b to form a binary, trimeric complex composed of a 2 b.
- This binding event is made irreversible with a subsequent reaction to covalently secure the two entities via disulfide bridges, which occurs very efficiently based on the principle of effective local concentration because the initial binding interactions should bring the reactive thiol groups placed onto both the DDD and AD into proximity (Chmura et al, Proc. Natl. Acad. Sci. USA.
- fusion proteins A variety of methods are known for making fusion proteins, including nucleic acid synthesis, hybridization and/or amplification to produce a synthetic double-stranded nucleic acid encoding a fusion protein of interest.
- double-stranded nucleic acids may be inserted into expression vectors for fusion protein production by standard molecular biology techniques (see, e.g. Sam brook et al., Molecular Cloning, A laboratory manual, 2 nd Ed, 1989).
- the AD and/or DDD moiety may be attached to either the N- terminal or C-terminal end of an effector protein or peptide.
- site of attachment of an AD or DDD moiety to an effector moiety may vary, depending on the chemical nature of the effector moiety and the part(s) of the effector moiety involved in its physiological activity.
- Site-specific attachment of a variety of effector moieties may be performed using techniques known in the art, such as the use of bivalent cross-linking reagents and/or other chemical conjugation techniques.
- an antibody or antibody fragment may be incorporated into a DNLTM complex by, for example, attaching a DDD or AD moiety to the C-terminal end of the antibody heavy chain, as described in detail below.
- the DDD or AD moiety more preferably the AD moiety, may be attached to the C-terminal end of the antibody light chain (see, e.g., U.S. Patent Appl. Serial No. 13/901,737, filed 5/24/13, the Examples section of which is incorporated herein by reference.)
- DNLTM constructs For different types of DNLTM constructs, different AD or DDD sequences may be utilized. Exemplary DDD and AD sequences are provided below. DDDl
- SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA SEQ ID NO: l
- DDDl and DDD2 are based on the DDD sequence of the human Rlla isoform of protein kinase A.
- the DDD and AD moieties may be based on the DDD sequence of the human RIa form of protein kinase A and a corresponding AKAP sequence, as exemplified in DDD3, DDD3C and AD3 below.
- AD and/or DDD moieties may be utilized in construction of the DNLTM complexes.
- Rlla DDD sequence is the basis of DDDl and DDD2 disclosed above.
- the four human PKA DDD sequences are shown below.
- the DDD sequence represents residues 1-44 of Rlla, 1-44 of RIip, 12-61 of RIa and 13-66 of Rip. (Note that the sequence of DDDl is modified slightly from the human PKA Rlla DDD moiety.)
- PKA RIa PKA RIa
- SHIQIPPGLTELLQGYTVEVGQQPPDLVDFAVEYFTRLREARRQ (SEQ ID NO: 10)
- DDD moiety sequences are shown in SEQ ID NO: 12 to SEQ ID NO:31 below.
- the skilled artisan will realize that an almost unlimited number of alternative species within the genus of DDD moieties can be constructed by standard techniques, for example using a commercial peptide synthesizer or well known site-directed mutagenesis techniques.
- the effect of the amino acid substitutions on AD moiety binding may also be readily determined by standard binding assays, for example as disclosed in Alto et al. (2003, Proc Natl Acad Sci USA 100:4445-50).
- THIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA SEQ ID NO: 12
- SKIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA SEQ ID NO: 13
- SRIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA SEQ ID NO: 14
- SHINIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA SEQ ID NO: 15
- SHIQIPPALTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA SEQ ID NO: 16
- SHIQDPPGLSELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA SEQ ID NO: 17
- SHIQffPGLTDLLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA SEQ ID NO: 18
- SHIQIPPGLTELLNGYTVEVLRQQPPDLVEFAVEYFTRLREARA SEQ
- Alto et al. (2003, Proc Natl Acad Sci USA 100:4445-50) performed a bioinformatic analysis of the AD sequence of various AKAP proteins to design an RII selective AD sequence called AKAP-IS (SEQ ID NO:3), with a binding constant for DDD of 0.4 nM.
- the AKAP-IS sequence was designed as a peptide antagonist of AKAP binding to PKA.
- Residues in the AKAP-IS sequence where substitutions tended to decrease binding to DDD are underlined in SEQ ID NO:3 below.
- the skilled artisan will realize that in designing sequence variants of the AD sequence, one would desirably avoid changing any of the underlined residues, while conservative amino acid substitutions might be made for residues that are less critical for DDD binding.
- Table 3 shows potential conservative amino acid substitutions in the sequence of AKAP-IS (AD1, SEQ ID NO: 3), similar to that shown for DDD1 (SEQ ID NO: l) in Table 2 above.
- the SuperAKAP-IS sequence may be substituted for the AKAP-IS AD moiety sequence to prepare DNLTM constructs.
- Other alternative sequences that might be substituted for the AKAP-IS AD sequence are shown in SEQ ID NO:51-53. Substitutions relative to the AKAP-IS sequence are underlined. It is anticipated that, as with the AD2 sequence shown in SEQ ID NO:4, the AD moiety may also include the additional N-terminal residues cysteine and glycine and C-terminal residues glycine and cysteine.
- Figure 2 of Gold et al. disclosed additional DDD-binding sequences from a variety of AKAP proteins, shown below.
- LAWKIAKMIVSDVMQQ (SEQ ID NO:63)
- AKAP10-pep NTDEAQEELAWKIAKMrVSD QQA (SEQ ID NO: 80)
- AKAP12-pep NGILELETKSSKLVQNIIQTAVDQF (SEQ ID NO:82)
- Carr et al. (2001, J Biol Chem 276: 17332-38) examined the degree of sequence homology between different AKAP-binding DDD sequences from human and non-human proteins and identified residues in the DDD sequences that appeared to be the most highly conserved among different DDD moieties. These are indicated below by underlining with reference to the human PKA RHa DDD sequence of SEQ ID NO: 1. Residues that were particularly conserved are further indicated by italics. The residues overlap with, but are not identical to those suggested by Kinderman et al. (2006) to be important for binding to AKAP proteins.
- Immunogenicity of therapeutic antibodies is associated with increased risk of infusion reactions and decreased duration of therapeutic response (Baert et al., 2003, N Engl J Med 348:602-08).
- the extent to which therapeutic antibodies induce an immune response in the host may be determined in part by the allotype of the antibody (Stickler et al., 2011, Genes and Immunity 12:213-21).
- Antibody allotype is related to amino acid sequence variations at specific locations in the constant region sequences of the antibody.
- the allotypes of IgG antibodies containing a heavy chain ⁇ -type constant region are designated as Gm allotypes (1976, J Immunol 117: 1056-59).
- Glml For the common IgGl human antibodies, the most prevalent allotype is Glml (Stickler et al., 2011, Genes and Immunity 12:213-21). However, the Glm3 allotype also occurs frequently in Caucasians (Id.). It has been reported that Glml antibodies contain allotypic sequences that tend to induce an immune response when administered to non-Glml (nGlml) recipients, such as Glm3 patients (Id). Non-Glml allotype antibodies are not as immunogenic when administered to Glml patients (Id).
- the human Glml allotype comprises the amino acids aspartic acid at Kabat position 356 and leucine at Kabat position 358 in the CH3 sequence of the heavy chain IgGl .
- the nGlml allotype comprises the amino acids glutamic acid at Kabat position 356 and methionine at Kabat position 358.
- Both Glml and nGlml allotypes comprise a glutamic acid residue at Kabat position 357 and the allotypes are sometimes referred to as DEL and EEM allotypes.
- a non-limiting example of the heavy chain constant region sequences for Glml and nGlml allotype antibodies is shown for the exemplary antibodies rituximab (SEQ ID NO:85) and veltuzumab (SEQ ID NO:86).
- veltuzumab and rituximab are, respectively, humanized and chimeric IgGl antibodies against CD20, of use for therapy of a wide variety of hematological malignancies.
- Table 6 compares the allotype sequences of rituximab vs.
- rituximab (Glml7,l) is a DEL allotype IgGl, with an additional sequence variation at Kabat position 214 (heavy chain CHI) of lysine in rituximab vs. arginine in veltuzumab.
- veltuzumab is less immunogenic in subjects than rituximab (see, e.g., Morchhauser et al., 2009, J Clin Oncol 27:3346-53; Goldenberg et al., 2009, Blood 113:1062-70; Robak & Robak, 2011, BioDrugs 25:13-25), an effect that has been attributed to the difference between humanized and chimeric antibodies.
- the difference in allotypes between the EEM and DEL allotypes likely also accounts for the lower immunogenicity of veltuzumab.
- the allotype of the antibody In order to reduce the immunogenicity of therapeutic antibodies in individuals of nGlml genotype, it is desirable to select the allotype of the antibody to correspond to the Glm3 allotype, characterized by arginine at Kabat 214, and the nGlml, 2 null-allotype, characterized by glutamic acid at Kabat position 356, methionine at Kabat position 358 and alanine at Kabat position 431. Surprisingly, it was found that repeated subcutaneous administration of Glm3 antibodies over a long period of time did not result in a significant immune response.
- the human IgG4 heavy chain in common with the Glm3 allotype has arginine at Kabat 214, glutamic acid at Kabat 356, methionine at Kabat 359 and alanine at Kabat 431. Since immunogenicity appears to relate at least in part to the residues at those locations, use of the human IgG4 heavy chain constant region sequence for therapeutic antibodies is also a preferred embodiment. Combinations of Glm3 IgGl antibodies with IgG4 antibodies may also be of use for therapeutic administration.
- the disclosed methods and compositions may involve production and use of proteins or peptides with one or more substituted amino acid residues.
- the DDD and/or AD sequences used to make DNLTM constructs may be modified as discussed above.
- amino acid substitutions typically involve the replacement of an amino acid with another amino acid of relatively similar properties (i.e., conservative amino acid substitutions).
- conservative amino acid substitutions The properties of the various amino acids and effect of amino acid substitution on protein structure and function have been the subject of extensive study and knowledge in the art.
- the hydropathic index of amino acids may be considered (Kyte & Doolittle, 1982, J. Mol. Biol, 157:105-132).
- the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules.
- Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics (Kyte & Doolittle, 1982), these are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (- 0.7); serine (-0.8); tryptophan (-0.9); tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine (-3.9); and arginine (-4.5).
- the use of amino acids whose hydropathic indices are within ⁇ 2 is preferred, within ⁇ 1 are more preferred, and within ⁇ 0.5 are even more preferred.
- Amino acid substitution may also take into account the hydrophilicity of the amino acid residue (e.g., U.S. Pat. No. 4,554,101). Hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0); glutamate (+3.0); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5 .+-.1); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4). Replacement of amino acids with others of similar hydrophilicity is preferred.
- amino acid side chain For example, it would generally not be preferred to replace an amino acid with a compact side chain, such as glycine or serine, with an amino acid with a bulky side chain, e.g., tryptophan or tyrosine.
- a compact side chain such as glycine or serine
- an amino acid with a bulky side chain e.g., tryptophan or tyrosine.
- tryptophan or tyrosine The effect of various amino acid residues on protein secondary structure is also a
- arginine and lysine glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
- amino acid substitutions include whether or not the residue is located in the interior of a protein or is solvent exposed.
- conservative substitutions would include: Asp and Asn; Ser and Thr; Ser and Ala; Thr and Ala; Ala and Gly; lie and Val; Val and Leu; Leu and Ile; Leu and Met; Phe and Tyr; Tyr and Trp.
- conservative substitutions would include: Asp and Asn; Asp and Glu; Glu and Gin; Glu and Ala; Gly and Asn; Ala and Pro; Ala and Gly; Ala and Ser; Ala and Lys; Ser and Thr; Lys and Arg; Val and Leu; Leu and Ile; He and Val; Phe and Tyr.
- amino acid substitutions In determining amino acid substitutions, one may also consider the existence of intermolecular or intramolecular bonds, such as formation of ionic bonds (salt bridges) between positively charged residues (e.g., His, Arg, Lys) and negatively charged residues (e.g., Asp, Glu) or disulfide bonds between nearby cysteine residues.
- ionic bonds salt bridges
- positively charged residues e.g., His, Arg, Lys
- negatively charged residues e.g., Asp, Glu
- disulfide bonds between nearby cysteine residues.
- the binding moieties described herein may comprise one or more avimer sequences.
- Avimers are a class of binding proteins somewhat similar to antibodies in their affinities and specificities for various target molecules. They were developed from human extracellular receptor domains by in vitro exon shuffling and phage display. (Silverman et al., 2005, Nat. Biotechnol. 23: 1493-94; Silverman et al., 2006, Nat. Biotechnol. 24:220).
- the resulting multidomain proteins may comprise multiple independent binding domains, that may exhibit improved affinity (in some cases sub-nanomolar) and specificity compared with single-epitope binding proteins.
- avimers may be attached to, for example, DDD and/or AD sequences for use in the claimed methods and compositions. Additional details concerning methods of construction and use of avimers are disclosed, for example, in U.S. Patent Application Publication Nos.
- compositions and/or methods may concern binding peptides and/or peptide mimetics of various target molecules, cells or tissues.
- Binding peptides may be identified by any method known in the art, including but not limiting to the phage display technique.
- Various methods of phage display and techniques for producing diverse populations of peptides are well known in the art.
- U.S. Pat. Nos. 5,223,409; 5,622,699 and 6,068,829 disclose methods for preparing a phage library.
- the phage display technique involves genetically manipulating bacteriophage so that small peptides can be expressed on their surface (Smith and Scott, 1985, Science 228: 1315-1317; Smith and Scott, 1993, Meth. Enzymol. 21:228-257).
- larger protein domains such as single-chain antibodies may also be displayed on the surface of phage particles (Arap et al., 1998, Science 279:377-380).
- Targeting amino acid sequences selective for a given organ, tissue, cell type or target molecule may be isolated by panning (Pasqualini and Ruoslahti, 1996, Nature 380:364-366; Pasqualini, 1999, The Quart. J. Nucl. Med. 43: 1,59-162).
- a library of phage containing putative targeting peptides is administered to an intact organism or to isolated organs, tissues, cell types or target molecules and samples containing bound phage are collected.
- Phage that bind to a target may be eluted from a target organ, tissue, cell type or target molecule and then amplified by growing them in host bacteria.
- the phage may be propagated in host bacteria between rounds of panning. Rather than being lysed by the phage, the bacteria may instead secrete multiple copies of phage that display a particular insert. If desired, the amplified phage may be exposed to the target organs, tissues, cell types or target molecule again and collected for additional rounds of panning. Multiple rounds of panning may be performed until a population of selective or specific binders is obtained.
- the amino acid sequence of the peptides may be determined by sequencing the DNA corresponding to the targeting peptide insert in the phage genome. The identified targeting peptide may then be produced as a synthetic peptide by standard protein chemistry techniques (Arap et al, 1998, Smith et ai, 1985).
- a subtraction protocol may be used to further reduce background phage binding.
- the purpose of subtraction is to remove phage from the library that bind to targets other than the target of interest.
- the phage library may be prescreened against a control cell, tissue or organ. For example, tumor- binding peptides may be identified after prescreening a library against a control normal cell line. After subtraction the library may be screened against the molecule, cell, tissue or organ of interest.
- Other methods of subtraction protocols are known and may be used in the practice of the claimed methods, for example as disclosed in U.S Patent Nos. 5,840,841, 5,705,610, 5,670,312 and 5,492,807.
- a targeting moiety of use may be an aptamer.
- Methods of constructing and determining the binding characteristics of aptamers are well known in the art. For example, such techniques are described in U.S. Patent Nos. 5,582,981, 5,595,877 and 5,637,459, the Examples section of each incorporated herein by reference. Methods for preparation and screening of aptamers that bind to particular targets of interest are well known, for example U.S. Pat. No. 5,475,096 and U.S. Pat. No. 5,270,163, the Examples section of each incorporated herein by reference.
- Aptamers may be prepared by any known method, including synthetic, recombinant, and purification methods, and may be used alone or in combination with other ligands specific for the same target. In general, a minimum of approximately 3 nucleotides, preferably at least 5 nucleotides, are necessary to effect specific binding. Aptamers of sequences shorter than 10 bases may be feasible, although aptamers of 10, 20, 30 or 40 nucleotides may be preferred.
- Aptamers may be isolated, sequenced, and/or amplified or synthesized as
- aptamers of interest may comprise modified oligomers. Any of the hydroxyl groups ordinarily present in aptamers may be replaced by phosphonate groups, phosphate groups, protected by a standard protecting group, or activated to prepare additional linkages to other nucleotides, or may be conjugated to solid supports.
- One or more phosphodiester linkages may be replaced by alternative linking groups, such as P(0)0 replaced by P(0)S, P(0)NR 2 , P(0)R, P(0)OR', CO, or CNR 2 , wherein R is H or alkyl (1-20C) and R' is alkyl (1-20C); in addition, this group may be attached to adjacent nucleotides through O or S. Not all linkages in an oligomer need to be identical.
- Affibodies and Fynomers are examples of alternative linking groups, such as P(0)0 replaced by P(0)S, P(0)NR 2 , P(0)R, P(0)OR', CO, or CNR 2 , wherein R is H or alkyl (1
- Certain alternative embodiments may utilize affibodies in place of antibodies.
- Affibodies are commercially available from Affibody AB (Solna, Sweden). Affibodies are small proteins that function as antibody mimetics and are of use in binding target molecules. Affibodies were developed by combinatorial engineering on an alpha helical protein scaffold (Nord et al., 1995, Protein Eng 8:601-8; Nord et al., 1997, Nat Biotechnol 15:772-77). The affibody design is based on a three helix bundle structure comprising the IgG binding domain of protein A (Nord et al., 1995; 1997).
- Affibodies with a wide range of binding affinities may be produced by randomization of thirteen amino acids involved in the Fc binding activity of the bacterial protein A (Nord et al., 1995; 1997). After randomization, the PCR amplified library was cloned into a phagemid vector for screening by phage display of the mutant proteins.
- the phage display library may be screened against any known antigen, using standard phage display screening techniques (e.g., Pasqualini and Ruoslahti, 1996, Nature 380:364-366; Pasqualini, 1999, Quart. J. Nucl. Med. 43: 159-162), in order to identify one or more affibodies against the target antigen.
- Fynomers can also bind to target antigens with a similar affinity and specificity to antibodies. Fynomers are based on the human Fyn SH3 domain as a scaffold for assembly of binding molecules. The Fyn SH3 domain is a fully human, 63 amino acid protein that can be produced in bacteria with high yields. Fynomers may be linked together to yield a multispecific binding protein with affinities for two or more different antigen targets.
- Fynomers are commercially available from COVAGEN AG (Zurich, Switzerland).
- the preferred conjugation protocol is based on a thiol-maleimide, a thiol- vinylsulfone, a thiol-bromoacetamide, or a thiol-iodoacetamide reaction that is facile at neutral or acidic pH. This obviates the need for higher pH conditions for conjugations as, for instance, would be necessitated when using active esters. Further details of exemplary conjugation protocols are described below in the Examples section.
- the invention relates to a method of treating a subject, comprising administering a therapeutically effective amount of a therapeutic conjugate as described herein to a subject.
- Diseases that may be treated with the therapeutic conjugates described herein include, but are not limited to B-cell malignancies (e.g., non-Hodgkin's lymphoma, mantle cell lymphoma, multiple myeloma, Hodgkin's lymphoma, diffuse large B cell lymphoma, Burkitt lymphoma, follicular lymphoma, acute lymphocytic leukemia, chronic lymphocytic leukemia, hairy cell leukemia) using, for example an anti-CD22 antibody such as the hLL2 MAb (epratuzumab, see U.S.
- B-cell malignancies e.g., non-Hodgkin's lymphoma, mantle cell lymphoma, multiple myeloma, Hodgkin's lymphom
- Patent No. 6,183,744 against another CD22 epitope (hRFB4) or antibodies against other B cell antigens, such as CD19, CD20, CD21, CD22, CD23, CD37, CD40, CD40L, CD52, CD74, CD80 or HLA-DR.
- Other diseases include, but are not limited to, adenocarcinomas of endodermally-derived digestive system epithelia, cancers such as breast cancer and non-small cell lung cancer, and other carcinomas, sarcomas, glial tumors, myeloid leukemias, etc.
- antibodies against an antigen e.g., an oncofetal antigen, produced by or associated with a malignant solid tumor or hematopoietic neoplasm, e.g., a gastrointestinal, stomach, colon, esophageal, liver, lung, breast, pancreatic, liver, prostate, ovarian, testicular, brain, bone or lymphatic tumor, a sarcoma or a melanoma, are advantageously used.
- Such therapeutics can be given once or repeatedly, depending on the disease state and tolerability of the conjugate, and can also be used optionally in combination with other therapeutic modalities, such as surgery, external radiation, radioimmunotherapy, immunotherapy, chemotherapy, antisense therapy, interference RNA therapy, gene therapy, and the like. Each combination will be adapted to the tumor type, stage, patient condition and prior therapy, and other factors considered by the managing physician.
- the term "subject” refers to any animal (i.e., vertebrates and invertebrates) including, but not limited to mammals, including humans. It is not intended that the term be limited to a particular age or sex. Thus, adult and newborn subjects, as well as fetuses, whether male or female, are encompassed by the term. Doses given herein are for humans, but can be adjusted to the size of other mammals, as well as children, in accordance with weight or square meter size.
- therapeutic conjugates comprising an anti-EGP-1 (anti- TROP-2) antibody such as the hRS7 MAb can be used to treat carcinomas such as carcinomas of the esophagus, pancreas, lung, stomach, colon and rectum, urinary bladder, breast, ovary, uterus, kidney and prostate, as disclosed in U.S. Patent No. 7,238,785;
- An hRS7 antibody is a humanized antibody that comprises light chain complementarity- determining region (CDR) sequences CDRl (KASQDVSIAVA, SEQ ID NO:90); CDR2 (SASYRYT, SEQ ID NO:91); and CDR3 (QQHYITPLT, SEQ ID NO:92) and heavy chain CDR sequences CDRl (NYGMN, SEQ ID NO:93); CDR2 (WINTYTGEPTYTDDFKG, SEQ ID NO:94) and CDR3 (GGFGSSYWYFDV, SEQ ID NO:95)
- CDR light chain complementarity- determining region
- therapeutic conjugates comprising an anti- CEACAM5 antibody (e.g., hMN-14, labretuzumab) and/or an anti-CEACAM6 antibody (e.g., hMN-3 or hMN-15) may be used to treat any of a variety of cancers that express CEACAM5 and/or CEACAM6, as disclosed in U.S. Patent Nos. 7,541,440; 7,951,369;
- Solid tumors that may be treated using anti-CEACAM5, anti-CEACAM6, or a combination of the two include but are not limited to breast, lung, pancreatic, esophageal, medullary thyroid, ovarian, colon, rectum, urinary bladder, mouth and stomach cancers.
- a majority of carcinomas, including gastrointestinal, respiratory, genitourinary and breast cancers express CEACAM5 and may be treated with the subject immunoconjugates.
- An hMN-14 antibody is a humanized antibody that comprises light chain variable region CDR sequences CDRl (KASQDVGTSVA; SEQ ID NO:96), CDR2 (WTSTRHT; SEQ ID NO:97), and CDR3 (QQYSLYRS; SEQ ID NO:98), and the heavy chain variable region CDR sequences CDRl (TYWMS; SEQ ID NO:99), CDR2 (EIHPDSSTINYAPSLKD; SEQ ID NO: 100) and CDR3 (LYFGFPWFAY; SEQ ID NO: 101).
- An hMN-3 antibody is a humanized antibody that comprises light chain variable region CDR sequences CDRl (RSSQSIVHSNGNTYLE, SEQ ID NO: 102), CDR2 (KVSNRFS, SEQ ID NO: 103) and CDR3 (FQGSHVPPT, SEQ ID NO: 104) and the heavy chain CDR sequences CDRl (NYGMN, SEQ ID NO: 105), CDR2 (WINTYTGEPTYADDFKG, SEQ ID NO: 106) and CDR3 (KGWMDFNSSLDY, SEQ ID NO:107).
- CDRl light chain variable region CDR sequences CDRl
- CDR2 KVSNRFS, SEQ ID NO: 103
- FQGSHVPPT FQGSHVPPT
- An hMN-15 antibody is a humanized antibody that comprises light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: 108); GTSTLAS (SEQ ID NO: 109); and QQWSYNPPT (SEQ ID NO:l 10); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO: 111);
- FIANKANGHTTDYSPSVKG (SEQ ID NO: 112); and DMGIRWNFDV (SEQ ID NO: 113).
- therapeutic conjugates comprising an anti-CD74 antibody
- an anti-CD74 antibody e.g., hLLl , milatuzumab, disclosed in U.S. Patent Nos. 7,074,403; 7,312,318; 7,772,373; 7,919,087 and 7,931,903, the Examples section of each incorporated herein by reference
- CD74 e.g., hLLl , milatuzumab, disclosed in U.S. Patent Nos. 7,074,403; 7,312,318; 7,772,373; 7,919,087 and 7,931,903, the Examples section of each incorporated herein by reference
- CD74 e.g., hLLl , milatuzumab, disclosed in U.S. Patent Nos. 7,074,403; 7,312,318; 7,772,373; 7,919,087 and 7,931,903, the Examples section of each incorporated herein by reference
- hLLl antibody is a humanized antibody comprising the light
- therapeutic conjugates comprising an anti-CD22 antibody (e.g., hLL2, epratuzumab, disclosed in U.S. Patent Nos. 5,789,554; 6,183,744; 6,187,287; 6,306,393; 7,074,403 and 7,641,901, the Examples section of each incorporated herein by reference, or the chimeric or humanized RFB4 antibody) may be used to treat any of a variety of cancers that express CD22, including but not limited to indolent forms of B- cell lymphomas, aggressive forms of B-cell lymphomas, chronic lymphatic leukemias, acute lymphatic leukemias, non-Hodgkin's lymphoma, Hodgkin's lymphoma, Burkitt lymphoma, follicular lymphoma or diffuse B-cell lymphoma.
- an anti-CD22 antibody e.g., hLL2, epratuzumab, disclosed in U.S. Patent Nos. 5,789,
- An hLL2 antibody is a humanized antibody comprising light chain CDR sequences CDRl (KSSQSVLYSANHKYLA, SEQ ID NO: 120), CDR2 (WASTRES, SEQ ID NO: 121), and CDR3 (HQYLSSWTF, SEQ ID NO: 122) and the heavy chain CDR sequences CDR1 (SYWLH, SEQ ID NO: 123), CDR2 ( YINPRND YTE YNQNFKD , SEQ ID NO:124), and CDR3 (RDITTFY, SEQ ID N0.125)
- therapeutic conjugates comprising anti-CSAp antibodies, such as the hMu-9 MAb, can be used to treat colorectal, as well as pancreatic and ovarian cancers as disclosed in U.S. Patent Nos. 6,962,702; 7,387,772; 7,414,121; 7,553,953;
- hPAM4 MAb can be used to treat pancreatic cancer or other solid tumors, as disclosed in U.S. Patent Nos. 7,238,786 and 7,282,567, the Examples section of each incorporated herein by reference.
- An hMu-9 antibody is a humanized antibody comprising light chain CDR sequences CDR1
- RSSQSIVHSNGNTYLE SEQ ID NO: 126
- CDR2 KVSNRFS, SEQ ID NO: 127
- CDR3 FQGSRVPYT, SEQ ID NO: 128)
- heavy chain variable CDR sequences CDR1 (EYVIT, SEQ ID NO:129), CDR2 (EIYPGSGSTSYNEKFK, SEQ ID NO:130), and CDR3 (EDL, SEQ ID NO: 131).
- An hPAM4 antibody is a humanized antibody comprising light chain variable region CDR sequence CDR1 (SASSSVSSSYLY, SEQ ID NO: 132); CDR2 (STSNLAS, SEQ ID NO:133); and CDR3 (HQWNRYPYT, SEQ ID NO:134); and heavy chain CDR sequences CDR1 (SYVLH, SEQ ID NO: 135); CDR2
- therapeutic conjugates comprising an and- AFP MAb, such as IMMU31
- an and- AFP MAb such as IMMU31
- IMMU31 can be used to treat hepatocellular carcinoma, germ cell tumors, and other AFP-producing tumors using humanized, chimeric and human antibody forms, as disclosed in U.S. Patent No. 7,300,655, the Examples section of which is incorporated herein by reference.
- An IMMU31 antibody is a humanized antibody comprising the heavy chain CDR sequences CDR1 (SYVIH, SEQ ID NO: 138), CDR2 (YIHPYNGGTKYNEKFKG, SEQ ID NO: 139) and CDR3 (SGGGDPFAY, SEQ ID NO: 140) and the light chain CDR1 (KASQDINKYIG, SEQ ID NO:141), CDR2 (YTSALLP, SEQ ID NO: 142) and CDR3 (LQYDDLWT, SEQ ID NO: 143).
- therapeutic conjugates comprising an anti-HLA-DR MAb, such as hL243, can be used to treat lymphoma, leukemia, cancers of the skin, esophagus, stomach, colon, rectum, pancreas, lung, breast, ovary, bladder, endometrium, cervix, testes, kidney, liver, melanoma or other HLA-DR-producing tumors, as disclosed in U.S. Patent No. 7,612,180, the Examples section of which is incorporated herein by reference.
- An hL243 antibody is a humanized antibody comprising the heavy chain CDR sequences CDRl (NYGMN, SEQ ID NO: 144), CDR2 (WINTYTREPTYADDFKG, SEQ ID NO: 145), and CDR3 (DITAVVPTGFDY, SEQ ID NO: 146) and light chain CDR sequences CDRl (RASENIYSNLA, SEQ ID NO:147), CDR2 (AASNLAD, SEQ ID NO: 148), and CDR3 (QHFWTTPWA, SEQ ID NO: 149).
- therapeutic conjugates comprising an anti-CD20 MAb, such as veltuzumab (hA20), 1F5, obinutuzumab (GA101), or rituximab, can be used to treat lymphoma, leukemia, immune thrombocytopenic purpura, systemic lupus
- An hA20 (veltuzumab) antibody is a humanized antibody comprising the light chain CDR sequences CDRL1 (RASSSVSYIH, SEQ ID NO: 150), CDRL2 (ATSNLAS, SEQ ID NO: 151) and CDRL3 (QQWTSNPPT, SEQ ID NO: 152) and heavy chain CDR sequences CDRH1 (SYNMH, SEQ ID NO: 153), CDRH2
- therapeutic conjugates comprising an anti-CD19 MAb, such as hA19, can be used to treat B-cell related lymphomas and leukemias, such as non-Hodgkin's lymphoma, chronic lymphocytic leukemia or acute lymphoblastic leukemia.
- B-cell related lymphomas and leukemias such as non-Hodgkin's lymphoma, chronic lymphocytic leukemia or acute lymphoblastic leukemia.
- autoimmune diseases such as acute or chronic immune thrombocytopenia, dermatomyositis, Sydenham's chorea, myasthenia gravis, systemic lupus erythematosus, lupus nephritis, rheumatic fever, polyglandular syndromes, bullous pemphigoid, diabetes mellitus, Henoch-Schonlein purpura, post-streptococcal nephritis, erythema nodosum, Takayasu's arteritis, Addison's disease, rheumatoid arthritis, multiple sclerosis, sarcoidosis, ulcerative colitis, erythema multiforme, IgA nephropathy, polyarteritis nodosa, ankylosing spondylitis, Goodpasture's syndrome, thromboangitis ubiterans, Sjogren's syndrome, primary erythema multiforme,
- An hA19 antibody is a humanized antibody comprising the light chain CDR sequences CDR1
- K AS QS VD YDGDS YLN (SEQ ID NO: 156); CDR2 DASNLVS (SEQ ID NO: 157); and CDR3 QQSTEDPWT (SEQ ID NO: 158) and the heavy chain CDR sequences CDR1 SYWMN (SEQ ID NO: 159); CDR2 QIWPGDGDTNYNGKFKG (SEQ ID NO: 160) and CDR3 RETTTVGRYYYAMDY (SEQ ID NO: 161).
- therapeutic conjugates comprising anti-tenascin antibodies can be used to treat hematopoietic and solid tumors, and conjugates comprising antibodies to tenascin can be used to treat solid tumors, preferably brain cancers like glioblastomas.
- the antibodies that are used in the treatment of human disease are human or humanized (CDR-grafted) versions of antibodies; although murine and chimeric versions of antibodies can be used.
- Same species IgG molecules as delivery agents are mostly preferred to minimize immune responses. This is particularly important when considering repeat treatments.
- a human or humanized IgG antibody is less likely to generate an anti-IgG immune response from patients.
- Antibodies such as hLLl and hLL2 rapidly internalize after binding to internalizing antigen on target cells, which means that the chemotherapeutic drug being carried is rapidly internalized into cells as well.
- antibodies that have slower rates of internalization can also be used to effect selective therapy.
- the therapeutic conjugates can be used against pathogens, since antibodies against pathogens are known.
- antibodies and antibody fragments which specifically bind markers produced by or associated with infectious lesions, including viral, bacterial, fungal and parasitic infections, for example caused by pathogens such as bacteria, rickettsia, mycoplasma, protozoa, fungi, and viruses, and antigens and products associated with such microorganisms have been disclosed, inter alia, in Hansen et al., U.S. Pat. No. 3,927,193 and Goldenberg U.S. Pat. Nos.
- the pathogens are selected from the group consisting of HIV virus, Mycobacterium tuberculosis, Streptococcus agalactiae, methicillin-resistant Staphylococcus aureus, Legionella pneumophilia, Streptococcus pyogenes, Escherichia coli, Neisseria gonorrhoeae, Neisseria meningitidis, Pneumococcus, Cryptococcus neoformans, Histoplasma capsulatum, Hemophilis influenzae B, Treponema pallidum, Lyme disease spirochetes, Pseudomonas aeruginosa, Mycobacterium leprae, Brucella abortus, rabies virus, influenza virus, cytomegalovirus, herpes simplex virus I, herpes simplex virus II, human serum parvo-like virus, respiratory syncytial virus, varicella-zoster
- Toxoplasma gondii Trypanosoma rangeli, Trypanosoma cruzi, Trypanosoma rhodesiensei, Trypanosoma brucei, Schistosoma mansoni, Schistosoma japanicum, Babesia bovis, Elmeria tenella, Onchocerca volvulus, Leishmania tropica, Trichinella spiralis, Theileria parva, Taenia hydatigena, Taenia ovis, Taenia saginata, Echinococcus granulosus, Mesocestoides corti, Mycoplasma arthritidis, M. hyorhinis, M. orale, M. arginini, Acholeplasma laidlawii, M. salivarium and M. pneumoniae, as disclosed in U.S. Patent No. 6,440,416, the Examples section of which is incorporated herein by reference.
- drug conjugates of the present invention comprising anti-g l20 and other such anti-HIV antibodies can be used as therapeutics for HIV in AIDS patients; and drug conjugates of antibodies to Mycobacterium tuberculosis are suitable as therapeutics for drug-refractive tuberculosis.
- Fusion proteins of anti-gpl20 MAb (anti HIV MAb) and a toxin, such as Pseudomonas exotoxin have been examined for antiviral properties (Van Oigen et al., J Drug Target, 5:75-91, 1998). Attempts at treating HIV infection in AIDS patients failed, possibly due to insufficient efficacy or unacceptable host toxicity.
- the drug conjugates of the present invention advantageously lack such toxic side effects of protein toxins, and are therefore advantageously used in treating HIV infection in AIDS patients. These drug conjugates can be given alone or in combination with other antibiotics or therapeutic agents that are effective in such patients when given alone.
- Candidate anti-HIV antibodies include the P4/D10 anti-envelope antibody described by Johansson et al. (AIDS. 2006 Oct 3;20(15):1911-5), as well as the anti-HIV antibodies described and sold by Polymun (Vienna, Austria), also described in U.S. Patent 5,831,034, U.S. Patent 5,911,989, and Vcelar et al., AIDS 2007; 21(16):2161-2170 and Joos et al., Antimicrob. Agents Chemother. 2006; 50(5): 1773-9, all incorporated herein by reference.
- a preferred targeting agent for HIV is various combinations of these antibodies in order to overcome resistance.
- a more effective incorporation into cells and pathogens can be accomplished by using multivalent, multispecific or multivalent, monospecific antibodies.
- multivalent, multispecific or multivalent, monospecific antibodies are found in U.S. Patent Nos. 7,387,772; 7,300,655; 7,238,785; and 7,282,567, the Examples section of each of which is incorporated herein by reference.
- These multivalent or multispecific antibodies are particularly preferred in the targeting of cancers and infectious organisms (pathogens), which express multiple antigen targets and even multiple epitopes of the same antigen target, but which often evade antibody targeting and sufficient binding for immunotherapy because of insufficient expression or availability of a single antigen target on the cell or pathogen.
- pathogens cancers and infectious organisms
- said antibodies show a higher binding and residence time on the target, thus affording a higher saturation with the drug being targeted in this invention.
- the therapeutic conjugates can be used to treat autoimmune disease or immune system dysfunction (e.g., graft-versus-host disease, organ transplant rejection).
- Antibodies of use to treat autoimmune/immune dysfunction disease may bind to exemplary antigens including, but not limited to, BCL-1, BCL-2, BCL-6, CDla, CD2, CD3, CD4, CD5, CD7, CD8, CD10, CDl lb, CDl lc, CD13, CD14, CD15, CD16, CD19, CD20, CD21, CD22, CD23, CD25, CD33, CD34, CD38, CD40, CD40L, CD41a, CD43, CD45, CD55, CD56, CCD57, CD59, CD64, CD71, CD74, CD79a, CD79b, CD117, CD138, FMC-7 and HLA-DR.
- Antibodies that bind to these and other target antigens, discussed above, may be used to treat autoimmune or immune dysfunction diseases.
- Autoimmune diseases that may be treated with immunoconjugates may include acute idiopathic thrombocytopenic purpura, chronic idiopathic thrombocytopenic purpura, dermatomyositis, Sydenham's chorea, myasthenia gravis, systemic lupus erythematosus, lupus nephritis, rheumatic fever, polyglandular syndromes, bullous pemphigoid, diabetes mellitus, Henoch-Schonlein purpura, post-streptococcal nephritis, erythema nodosum, Takayasu's arteritis, ANCA-associated vasculitides, Addison's disease, rheumatoid arthritis, multiple sclerosis, sarcoidosis, ulcerative colitis, erythema multiforme, IgA nephropathy, polyarteritis nodosa, an
- thyrotoxicosis scleroderma, chronic active hepatitis, polymyositis/dermatomyositis, polychondritis, bullous pemphigoid, pemphigus vulgaris, Wegener's granulomatosis, membranous nephropathy, amyotrophic lateral sclerosis, tabes dorsalis, giant cell arteritis/polymyalgia, pernicious anemia, rapidly progressive glomerulonephritis, psoriasis or fibrosing alveolitis.
- a therapeutic agent used in combination with the camptothecin conjugate of this invention may comprise one or more isotopes.
- Radioactive isotopes useful for treating diseased tissue include, but are not limited to- 1 1 'in, 177 Lu, 212 Bi, 213 Bi, 21 'At, 62 Cu, 67 Cu, *>Y, 125 I, 131 I, 32 P, 33 P, 47 Sc, u l Ag, 67 Ga, 142 Pr, 153 Sm, 161 Tb, 166 Dy, 166 Ho, 186 Re, 188 Re, 189 Re, 212 Pb, 223 Ra, 225 Ac, 59 Fe, 75 Se, 77 As, 89 Sr, 99 Mo, 105 Rh, ,09 Pd, I4 Pr, I49 Pm, I69 Er, 194 Ir, 198 Au, 199 Au, 227 Th and 21 'Pb.
- the therapeutic radionuclide preferably has a decay-energy in the range of 20 to 6,000 keV, preferably in the ranges 60 to 200 keV for an Auger emitter, 100-2,500 keV for a beta emitter, and 4,000- 6,000 keV for an alpha emitter.
- Maximum decay energies of useful beta-particle-emitting nuclides are preferably 20-5,000 keV, more preferably 100-4,000 keV, and most preferably 500-2,500 keV. Also preferred are radionuclides that substantially decay with Auger-emitting particles.
- beta-particle-emitting nuclides are preferably ⁇ 1 ,000 keV, more preferably ⁇ 100 keV, and most preferably ⁇ 70 keV. Also preferred are radionuclides that substantially decay with generation of alpha-particles.
- Such radionuclides include, but are not limited to: Dy-152, At-211, Bi-212, Ra-223, Rn-219, Po- 215, Bi-211, Ac-225, Fr-221, At-217, Bi-213, Th-227 and Fm-255. Decay energies of useful alpha-particle-emitting radionuclides are preferably 2,000-10,000 keV, more preferably 3,000-8,000 keV, and most preferably 4,000-7,000 keV.
- radioisotopes of use include n C, I3 N, l5 0, 75 Br, 198 Au, 224 Ac, I26 I, I33 I, 77 Br, u3m
- Radionuclides and other metals may be delivered, for example, using chelating groups attached to an antibody or conjugate.
- Macrocyclic chelates such as NOTA, DOTA, and TETA are of use with a variety of metals and radiometals, most particularly with
- radionuclides of gallium, yttrium and copper are radionuclides of gallium, yttrium and copper, respectively.
- metal-chelate complexes can be made very stable by tailoring the ring size to the metal of interest.
- Other ring-type chelates, such as macrocyclic polyethers for complexing 223 Ra, may be used.
- Therapeutic agents of use in combination with the camptothecin conjugates described herein also include, for example, chemotherapeutic drugs such as vinca alkaloids,
- cancer chemotherapeutic drugs include nitrogen mustards, alkyl sulfonates, nitrosoureas, triazenes, folic acid analogs, pyrimidine analogs, purine analogs, platinum coordination complexes, hormones, and the like. Suitable chemotherapeutic agents are described in REMINGTON'S
- Exemplary drugs of use include, but are not limited to, 5-fluorouracil, afatinib, aplidin, azaribine, anastrozole, anthracyclines, axitimb, AVL-101, AVL-291, bendamustine, bleomycin, bortezomib, bosutinib, bryostatin-1, busulfan, calicheamycin, camptothecin, carboplatin, 10-hydroxycamptothecin, carmustine, Celebrex, chlorambucil, cisplatin (CDDP), Cox-2 inhibitors, irinotecan (CPT-11), SN-38, carboplatin, cladribine, camptothecans, crizotinib, cyclophosphamide, cytarabine, dacarbazine, dasatinib, dinaciclib, docetaxel, dactinomycin, daunorubicin, dox
- therapeutic naked antibodies as are known in the art may be used in combination with the described conjugates. Exemplary therapeutic naked antibodies are described above.
- Therapeutic agents that may be used in concert with the camptothecin conjugates also may comprise toxins conjugated to targeting moieties.
- Toxins that may be used in this regard include ricin, abrin, ribonuclease (RNase), DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, gelonin, diphtheria toxin, Pseudomonas exotoxin, and Pseudomonas endotoxin.
- RNase ribonuclease
- DNase I DNase I
- Staphylococcal enterotoxin-A Staphylococcal enterotoxin-A
- pokeweed antiviral protein pokeweed antiviral protein
- gelonin gelonin
- diphtheria toxin diphtheria toxin
- Pseudomonas exotoxin Pseudomonas endotoxin.
- Immunomodulators of use may be selected from a cytokine, a stem cell growth factor, a lymphotoxin, an hematopoietic factor, a colony stimulating factor (CSF), an interferon (IFN), erythropoietin, thrombopoietin and a combination thereof. Specifically useful are
- lymphotoxins such as tumor necrosis factor (TNF), hematopoietic factors, such as interleukin (IL), colony stimulating factor, such as granulocyte-colony stimulating factor (G-CSF) or granulocyte macrophage-colony stimulating factor (GM-CSF), interferon, such as
- interferons-a, - ⁇ , - ⁇ or - ⁇ interferons-a, - ⁇ , - ⁇ or - ⁇ , and stem cell growth factor, such as that designated "S I factor”.
- cytokines include growth hormones such as human growth hormone, N- methionyl human growth hormone, and bovine growth hormone; parathyroid hormone;
- thyroxine insulin; proinsulin; relaxin; prorelaxin; glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH); hepatic growth factor; prostaglandin, fibroblast growth factor; prolactin; placental lactogen, OB protein; tumor necrosis factor-a and - 6; mullerian-inhibiting substance; mouse gonadotropin-associated peptide; inhibin; activin; vascular endothelial growth factor;
- FSH follicle stimulating hormone
- TSH thyroid stimulating hormone
- LH luteinizing hormone
- hepatic growth factor prostaglandin, fibroblast growth factor
- prolactin prolactin
- placental lactogen OB protein
- tumor necrosis factor-a and - 6 tumor necrosis factor-a and - 6
- mullerian-inhibiting substance mouse gonadotropin-associated peptide
- inhibin activin
- integrin thrombopoietin
- TPO nerve growth factors
- nerve growth factors such as NGF- ⁇ ; platelet-growth factor; transforming growth factors (TGFs) such as TGF- a and TGF- ⁇ ; insulin-like growth factor- 1 and -II; erythropoietin (EPO); osteoinductive factors; interferons such as interferon-a, - ⁇ , and - ⁇ ; colony stimulating factors (CSFs) such as macrophage-CSF (M-CSF); interleukins (ILs) such as IL-1, IL-la, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-1 1 , IL-12; IL- 13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-21 , IL-25, LIF, kit-ligand or FLT-3, angiostatin, thrombos
- cytokine includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native sequence cytokines.
- Chemokines of use include RANTES, MCAF, MIP1 -alpha, MIPl-Beta and IP-10.
- the subject immunoconjugates comprising a camptothecin conjugated to an antibody or antibody fragment
- chemotherapeutic agent radiation therapy, chemokine, cytokine, immunomodulator, enzyme, hormone, oligonucleotide, RNAi or siRNA.
- additional therapeutic agents may be administered separately, in combination with, or attached to the subject antibody-drug immunoconjugates.
- Suitable routes of administration of the conjugates include, without limitation, oral, parenteral, subcutaneous, rectal, transmucosal, intestinal administration, intramuscular, intramedullary, intrathecal, direct intraventricular, intravenous, intravitreal, intraperitoneal, intranasal, or intraocular injections.
- the preferred routes of administration are parenteral.
- Immunoconjugates can be formulated according to known methods to prepare pharmaceutically useful compositions, whereby the immunoconjugate is combined in a mixture with a pharmaceutically suitable excipient.
- a pharmaceutically suitable excipient Sterile phosphate-buffered saline is one example of a pharmaceutically suitable excipient.
- Other suitable excipients are well-known to those in the art. See, for example, Ansel et al., PHARMACEUTICAL DOSAGE FORMS AND DRUG DELIVERY SYSTEMS, 5th Edition (Lea & Febiger 1990), and Gennaro (ed.), REMINGTON'S PHARMACEUTICAL SCIENCES, 18th Edition (Mack Publishing
- the immunoconjugate is formulated in Good's biological buffer (pH 6-7), using a buffer selected from the group consisting of N-(2-acetamido)-2- aminoethanesulfonic acid (ACES); N-(2-acetamido)iminodiacetic acid (ADA); N,N-bis(2- hydroxyethyl)-2-aminoethanesulfonic acid (BES); 4-(2-hydroxyethyl)piperazine-l- ethanesulfonic acid (HEPES); 2-(N-morpholino)ethanesulfonic acid (MES); 3-(N- morpholino)propanesulfonic acid (MOPS); 3-(N-morpholinyl)-2-hydroxypropanesulfonic acid (MOPSO); and piperazine-N,N'-bis(2-ethanesulfonic acid) [Pipes].
- a buffer selected from the group consisting of N-(2-acetamido)-2- aminoethane
- More preferred buffers are MES or MOPS, preferably in the concentration range of 20 to 100 mM, more preferably about 25 mM. Most preferred is 25 mM MES, pH 6.5.
- the formulation may further comprise 25 mM trehalose and 0.01 % v/v polysorbate 80 as excipients, with the final buffer concentration modified to 22.25 mM as a result of added excipients.
- the preferred method of storage is as a lyophilized formulation of the conjugates, stored in the temperature range of -20 °C to 2 °C, with the most preferred storage at 2 °C to 8 °C.
- the immunoconjugate can be formulated for intravenous administration via, for example, bolus injection, slow infusion or continuous infusion.
- the antibody of the present invention is infused over a period of less than about 4 hours, and more preferably, over a period of less than about 3 hours.
- the first 25-50 mg could be infused within 30 minutes, preferably even 15 min, and the remainder infused over the next 2-3 hrs.
- Formulations for injection can be presented in unit dosage form, e.g., in ampoules or in multi- dose containers, with an added preservative.
- compositions can take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the active ingredient can be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- Control release preparations can be prepared through the use of polymers to complex or adsorb the immunoconjugate.
- biocompatible polymers include matrices of poly(ethylene-co-vinyl acetate) and matrices of a polyanhydride copolymer of a stearic acid dimer and sebacic acid. Sherwood et al., Bio/T echnology 10: 1446 (1992). The rate of release of an immunoconjugate from such a matrix depends upon the molecular weight of the immunoconjugate, the amount of immunoconjugate within the matrix, and the size of dispersed particles. Saltzman et al., Biophys. J. 55: 163 (1989);
- the dosage of an administered immunoconjugate for humans will vary depending upon such factors as the patient's age, weight, height, sex, general medical condition and previous medical history. It may be desirable to provide the recipient with a dosage of immunoconjugate that is in the range of from about 1 mg/kg to 24 mg/kg as a single intravenous infusion, although a lower or higher dosage also may be administered as circumstances dictate.
- Preferred dosages may include, but are not limited to, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 6 mg/kg, 7 mg/kg, 8 mg/kg, 9 mg/kg, 10 mg/kg, 11 mg kg, 12 mg/kg, 13 mg kg, 14 mg/kg, 15 mg/kg, 16 mg/kg, 17 mg/kg, 18 mg/kg, 19 mg/kg, 20 mg kg, 22 mg/kg and 24 mg/kg. Any amount in the range of 1 to 24 mg/kg may be used.
- the dosage is preferably administered multiple times, once or twice a week.
- a minimum dosage schedule of 4 weeks, more preferably 8 weeks, more preferably 16 weeks or longer may be used.
- the schedule of administration may comprise administration once or twice a week, on a cycle selected from the group consisting of: (i) weekly; (ii) every other week; (iii) one week of therapy followed by two, three or four weeks off; (iv) two weeks of therapy followed by one, two, three or four weeks off; (v) three weeks of therapy followed by one, two, three, four or five week off; (vi) four weeks of therapy followed by one, two, three, four or five week off; (vii) five weeks of therapy followed by one, two, three, four or five week off; and (viii) monthly.
- the cycle may be repeated 4, 6, 8, 10, 12, 16 or 20 times or more.
- an immunoconjugate may be administered as one dosage every 2 or 3 weeks, repeated for a total of at least 3 dosages. Or, twice per week for 4-6 weeks. If the dosage is lowered to approximately 200-300 mg/m 2 (340 mg per dosage for a 1.7-m patient, or 4.9 mg/kg for a 70 kg patient), it may be administered once or even twice weekly for 4 to 10 weeks. Alternatively, the dosage schedule may be decreased, namely every 2 or 3 weeks for 2-3 months. It has been determined, however, that even higher doses, such as 12 mg/kg once weekly or once every 2-3 weeks can be administered by slow i.v. infusion, for repeated dosing cycles. The dosing schedule can optionally be repeated at other intervals and dosage may be given through various parenteral routes, with appropriate adjustment of the dose and schedule.
- the immunoconjugates are of use for therapy of cancer.
- cancers include, but are not limited to, carcinoma, lymphoma, glioblastoma, melanoma, sarcoma, and leukemia, myeloma, or lymphoid malignancies.
- squamous cell cancer e.g., epithelial squamous cell cancer
- Ewing sarcoma e.g., Ewing sarcoma
- Wilms tumor astrocytomas
- lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma multiforme, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, hepatocellular carcinoma, neuroendocrine tumors, medullary thyroid cancer, differentiated thyroid carcinoma, breast cancer, ovarian cancer, colon cancer, rectal cancer, endometrial cancer or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulvar cancer, anal carcinoma, penile carcinoma, as well as head-and-neck cancer.
- squamous cell cancer e.g.,
- cancer includes primary malignant cells or tumors (e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor) and secondary malignant cells or tumors (e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor).
- primary malignant cells or tumors e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor
- secondary malignant cells or tumors e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor.
- cancers or malignancies include, but are not limited to: Acute Childhood Lymphoblastic Leukemia, Acute Lymphoblastic Leukemia, Acute Lymphocytic Leukemia, Acute Myeloid Leukemia, Adrenocortical Carcinoma, Adult (Primary)
- Lymphoma Central Nervous System Lymphoma, Cerebellar Astrocytoma, Cerebral
- Ependymoma Epithelial Cancer, Esophageal Cancer, Ewing's Sarcoma and Related Tumors, Exocrine Pancreatic Cancer, Extracranial Germ Cell Tumor, Extragonadal Germ Cell Tumor, Extrahepatic Bile Duct Cancer, Eye Cancer, Female Breast Cancer, Gaucher's Disease, Gallbladder Cancer, Gastric Cancer, Gastrointestinal Carcinoid Tumor, Gastrointestinal Tumors, Germ Cell Tumors, Gestational Trophoblastic Tumor, Hairy Cell Leukemia, Head and Neck Cancer, Hepatocellular Cancer, Hodgkin's Lymphoma, Hypergammaglobulinemia, Hypopharyngeal Cancer, Intestinal Cancers, Intraocular Melanoma, Islet Cell Carcinoma, Islet Cell Pancreatic Cancer, Kaposi's Sarcoma, Kidney Cancer, Laryngeal Cancer, Lip and Oral Cavity Cancer, Liver Cancer, Lung Cancer, Lymphoproliferative Disorders,
- Macroglobulinemia Male Breast Cancer, Malignant Mesothelioma, Malignant Thymoma, Medulloblastoma, Melanoma, Mesothelioma, Metastatic Occult Primary Squamous Neck Cancer, Metastatic Primary Squamous Neck Cancer, Metastatic Squamous Neck Cancer, Multiple Myeloma, Multiple Myeloma Plasma Cell Neoplasm, Myelodysplastic Syndrome, Myelogenous Leukemia, Myeloid Leukemia, Myeloproliferative Disorders, Nasal Cavity and Paranasal Sinus Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Hodgkin's
- compositions described and claimed herein may be used to treat malignant or premalignant conditions and to prevent progression to a neoplastic or malignant state, including but not limited to those disorders described above.
- Such uses are indicated in conditions known or suspected of preceding progression to neoplasia or cancer, in particular, where non-neoplastic cell growth consisting of hyperplasia, metaplasia, or most particularly, dysplasia has occurred (for review of such abnormal growth conditions, see Robbins and Angell, Basic Pathology, 2d Ed., W. B. Saunders Co., Philadelphia, pp. 68-79 (1976)).
- Dysplasia is frequently a forerunner of cancer, and is found mainly in the epithelia. It is the most disorderly form of non-neoplastic cell growth, involving a loss in individual cell uniformity and in the architectural orientation of cells. Dysplasia characteristically occurs where there exists chronic irritation or inflammation.
- Dysplastic disorders which can be treated include, but are not limited to, anhidrotic ectodermal dysplasia, anterofacial dysplasia, asphyxiating thoracic dysplasia, atriodigital dysplasia, bronchopulmonary dysplasia, cerebral dysplasia, cervical dysplasia, chondroectodermal dysplasia, cleidocranial dysplasia, congenital ectodermal dysplasia, craniodiaphysial dysplasia, craniocarpotarsal dysplasia, craniometaphysial dysplasia, dentin dysplasia, diaphysial dysplasia, ectodermal dysplasia, enamel dysplasia, encephalo-ophthalmic dysplasia, dysplasia epiphysialis hemimelia, dysplasia epiphysialis multiplex, dysplasia epiphysialis punctata, epi
- pseudoachondroplastic spondyloepiphysial dysplasia retinal dysplasia, septo-optic dysplasia, spondyloepiphysial dysplasia, and ventriculoradial dysplasia.
- Additional pre-neoplastic disorders which can be treated include, but are not limited to, benign dysproliferative disorders (e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps or adenomas, and esophageal dysplasia), leukoplakia, keratoses, Bowen's disease, Farmer's Skin, solar cheilitis, and solar keratosis.
- benign dysproliferative disorders e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps or adenomas, and esophageal dysplasia
- leukoplakia keratoses
- Bowen's disease keratoses
- Farmer's Skin Farmer's Skin
- solar cheilitis solar keratosis
- the method of the invention is used to inhibit growth, progression, and/or metastasis of cancers, in particular those listed above.
- Additional hyperproliferative diseases, disorders, and/or conditions include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias; e.g., acute lymphocytic leukemia, acute myelocytic leukemia [including myeloblastic, promyelocyte, myelomonocytic, monocytic, and erythroleukemia]) and chronic leukemias (e.g., chronic myelocytic [granulocytic] leukemia and chronic lymphocytic leukemia), polycythemia vera, lymphomas (e.g., Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myxosarcoma, liposar
- lymphangioendotheliosarcoma synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, meduUoblastoma, craniopharyngioma, ependymoma, pinealoma,
- Autoimmune diseases that may be treated with immunoconjugates may include acute and chronic immune thrombocytopenias, dermatomyositis, Sydenham's chorea, myasthenia gravis, systemic lupus erythematosus, lupus nephritis, rheumatic fever, polyglandular syndromes, bullous pemphigoid, diabetes mellitus, Henoch-Schonlein purpura, poststreptococcal nephritis, erythema nodosum, Takayasu's arteritis, ANCA-associated vasculitides, Addison's disease, rheumatoid arthritis, multiple sclerosis, sarcoidosis, ulcerative colitis, erythema multiforme, IgA nephropathy, polyarteritis nodosa, ankylosing spondylitis, Goodpasture's syndrome, thrombo
- kits containing components suitable for treating diseased tissue in a patient may contain at least one conjugated antibody or other targeting moiety as described herein. If the composition containing components for administration is not formulated for delivery via the alimentary canal, such as by oral delivery, a device capable of delivering the kit components through some other route may be included.
- a device capable of delivering the kit components through some other route may be included.
- the kit components may be packaged together or separated into two or more containers.
- the containers may be vials that contain sterile, lyophilized formulations of a composition that are suitable for reconstitution.
- a kit may also contain one or more buffers suitable for reconstitution and/or dilution of other reagents.
- Other containers that may be used include, but are not limited to, a pouch, tray, box, tube, or the like. Kit components may be packaged and maintained sterilely within the containers.
- Another component that can be included is instructions to a person using a kit for its use.
- DCC dicyclohexylcarbodiimide
- NHS N- hydroxysuccinimide
- DMAP 4-dimethylaminopyridine
- EEDQ 2-ethoxy- 1 -ethoxycarbonyl- 1,2-dihydroquinoline
- MMT monomethoxytrityl
- PABOH -aminobenzyl alcohol
- PEG polyethylene glycol
- SMCC succinimidyl 4-(N-maleimidomethyl)cyclohexane-l- carboxylate
- TBAF tetrabutylammonium fluoride
- TBDMS tert-butyldimethylsilyl chloride.
- Extractive work-up refers to extraction with chloroform, dichloromethane or ethyl acetate, and washing optionally with saturated bicarbonate, water, and with saturated sodium chloride. Flash chromatography was done using 230-400 mesh silica gel and methanol-dichloromethane gradient, using up to 15% v/v methanol -dichloromethane, unless otherwise stated.
- Reverse phase HPLC was performed by Method A using a 7.8 x 300 mm C18 HPLC column, fitted with a precolumn filter, and using a solvent gradient of 100% solvent A to 100% solvent B in 10 minutes at a flow rate of 3 mL per minute and maintaining at 100% solvent B at a flow rate of 4.5 mL per minute for 5 or 10 minutes; or by Method B using a 4.6x30 mm Xbridge CI 8, 2.5 ⁇ , column, fitted with a precolumn filter, using the solvent gradient of 100% solvent A to 100% of solvent B at a flow rate of 1.5 mL per minutes for 4 min and 100 % of solvent B at a flow rate of 2 mL per minutes for 1 minutes.
- Solvent A was 0.3% aqueous ammonium acetate, pH 4.46 while solvent B was 9:1 acetonitrile-aqueous ammonium acetate (0.3%), pH 4.46.
- HPLC was monitored by a dual in-line absorbance detector set at 360 nm and 254 nm.
- CL6-SN-38 is represented in Scheme-1.
- Commercially available 0-(2-azidoethyl)-0'- (N-diglycolyl-2-aminoethyl)heptaethyleneglycol ('PEG-N 3 '; 227 mg) was activated with DCC (100 mg), NHS (56 mg), and a catalytic amount of DMAP in 10 mL of
- the maleimide-containing acetylenic reagent namely 4-(N-maleimidomethyl)-N-(2- propynyl)cyclohexane-l-carboxamide, required for click cycloaddition, was prepared by reacting 0.107 g of SMCC and 0.021 mL of propargylamine (0.018 g; 1.01 equiv.) in dichloromethane using 1.1 equiv. of diisopropylethylamine. After 1 h, the solvent was removed and the product was purified by flash chromatography to obtain 83 mg of the product (colorless powder).
- Electrospray mass spectrum showed peaks at m/e 275 (M+H) and a base peak at m/e 192 in the positive ion mode, consistent with the structure calculated for C 15 Hi 8 N 2 0 3 : 275.1390 (M+H), found: 275.1394 (exact mass).
- This intermediate (200 mg) was deprotected with diethylamine (10 mL), and the product (135 mg) was obtained in ⁇ 90% purity after flash chromatography. HPLC: tR 10.91 min; electrospray mass spectrum: M+Na at m/z 527.
- This product (135 mg) was coupled with the commercially available 0-(2-azidoethyl)-0'-(N-diglycolyl-2- aminoethyl)heptaethyleneglycol ('PEG-N3' ; 150 mg, 1.1 equiv.) in presence of EEDQ (72 mg, 1.1 equiv.) in 10 mL of dichloromethane, and stirred overnight at ambient temperature.
- This intermediate (240 mg) was reacted with 1O-0-TBDMS-SN-38-2O-0- chloroformate, the latter generated from 1O-0-TBDMS-SN-38 (122 mg) using triphosgene and DMAP.
- the coupling reaction was done in 5 mL of dichloromethane for 10 min, and the reaction mixture was purified by flash chromatography to obtain 327 mg of product as pale yellow foam.
- This Example shows that the 10-OH group of SN-38 is protected as a carbonate or an ester, instead of as 'BOC, such that the the final product is ready for conjugation to antibodies without need for deprotecting the 10-OH protecting group.
- This group is readily deprotected under physiological pH conditions after in vivo administration of the protein conjugate.
- 'R' can be a substituted alkyl such as (CH 2 ) n -N(CH 3 ) 2 where n is 2-10, or a simple alkyl such as (CH 2 )n-CH 3 where n is 0-10, or it can be an alkoxy moiety such as "CH 3 -(CH 2 )n-0-" where n is 0-10, or a substituted alkoxy moiety such as such as O- (CH 2 ) n -N(CH 3 ) 2 where n is 2-10 and wherein the terminal amino group is optionally in the form of a quaternary salt for enhanced aqueous solubility, or "R 1 0-(CH 2 -CH 2 -0) n -CH 2 -CH 2 - 0-" where Ri is ethyl or methyl and n is an integer with values of 0-10.
- R "-0-(CH 2 )2-OCH 3 ".
- These 10-hydroxy derivatives are readily prepared by treatment with the chloroformate of the chosen reagent, if the final derivative is to be a carbonate.
- the 10-hydroxy-containing camptothecin such as SN-38 is treated with a molar equivalent of the chloroformate in dimethylform amide using triethylamine as the base. Under these conditions, the 20-OH position is unaffected.
- the acid chloride of the chosen reagent is used. Such derivatizations are conveniently accomplished using advanced intermediates as illustrated for simple ethyl carbonates of Examples 3 and 4.
- Electrospray mass spectrum showed peaks at m/e 1753.3 (M+H), m/e 1751.6 (M- H), 1864.5 (M+TFA), consistent with structure.
- deprotection of the penultimate intermediate ( 0.22g ) with a mixture of dichloroacetic acid ( 0.3 mL) and anisole (0.03 mL) in methylene chloride (3 mL), followed by precipitation with ether yielded 0.18 g (97% yield) of CL2A-SN-38; (7) in Scheme-3) as light yellow powder.
- HPLC ret. time 1.88 min.
- Electrospray mass spectrum showed peaks at m/e 1480.7 (M+H), 1478.5 (M-H), consistent with structure.
- This intermediate ((1) in Scheme-4; 0.93g ) was added in situ to activated SN-38, and the latter ((2) in Scheme-4) was prepared by reacting SN-38 (0.3 g ) with p-nitrophenylchloroformate (0.185 g) and DIEA (0.293 mL) in DMF for 1 h. After removing solvent, the residue was purified on deactivated silica gel to obtain 0.442 g as white solid.
- This intermediate (0.442 g) was deprotected with a mixture of trifluoroacetic acid (1 mL) and anisole (0.1 mL) in methylene chloride (5 mL), followed by precipitation with ether to obtain 0.197 g of the product ((3) in Scheme-4) as white solid.
- This intermediate ((3); 0.197g) was coupled with activated azide-containing-dipeptide incorporated-PEG-linker ((5) in Scheme-4), which activation was done by reacting PEG-linker ((4) in Scheme-4; 0.203 g) with bis(4-nitrophenyl) carbonate (0.153 g) and DIEA (0.044 mL) in methylene chloride (8 mL).
- the anti-CEACAM5 humanized MAb, hMN-14 also known as labetuzumab
- the anti-CD22 humanized MAb, hLL2 also known as epratuzumab
- the anti-CD20 humanized MAb, hA20 also known as veltuzumab
- the anti-EGP-1 humanized MAb, hRS7, and anti- mucin humanized MAb, hPAM4 also known as clivatuzumab
- Each antibody was reduced with dithiothreitol (DTT), used in a 50-to-70-fold molar excess, in 40 mM PBS, pH 7.4, containing 5.4 niM EDTA, at 37 °C (bath) for 45 min.
- DTT dithiothreitol
- the reduced product was purified by size-exclusion chromatography and/or diafiltration, and was buffer- exchanged into a suitable buffer at pH 6.5.
- the thiol content was determined by Ellman's assay, and was in the 6.5-to-8.5 SH/IgG range.
- the antibodies were reduced with Tris (2-carboxyethyl) phosphine (TCEP) in phosphate buffer at pH in the range of 5-7, followed by in situ conjugation.
- TCEP Tris (2-carboxyethyl) phosphine
- the reduced MAb was reacted with ⁇ 10-to- 15-fold molar excess of 'CL6-SN-38' of Example 1, or 'CL7-SN-38' of Example 2, or 'CL6-SN-38-1O-0- C0 2 Et' of Example 3, or 'CL7-SN-38-10-O-CO 2 Et' of Example 4, CL2A-SN-38 of Example 6, or CL2E-SN-38 of Example 7 using DMSO at 7-15 % v/v as co-solvent, and incubating for 20 min at ambient temperature.
- the conjugate was purified by centrifuged SEC, passage through a hydrophobic column, and finally by ultrafiltration-diafiltration.
- the product was assayed for SN-38 by absorbance at 366 nm and correlating with standard values, while the protein concentration was deduced from absorbance at 280 nm, corrected for spillover of SN- 38 absorbance at this wavelength. This way, the SN-38/MAb substitution ratios were determined.
- the purified conjugates were stored as lyophilized formulations in glass vials, capped under vacuum and stored in a -20 °C freezer. SN-38 molar substitution ratios (MSR) obtained for some of these conjugates, which were typically in the 5-to-7 range, are shown in Table 7.
- Example 9 In vivo therapeutic efficacies in preclinical models of human pancreatic or colon carcinoma
- FIG. 1 shows a Capan 1 pancreatic tumor model, wherein specific CL2A-SN-38 conjugates of hRS7 (anti-EGP-1), hPAM4 (anti-mucin), and hMN-14 (anti-CEACAM5) antibodies showed better efficacies than control hA20-CL2A-SN-38 conjugate (anti-CD20) and untreated control.
- Example 10 In vivo therapy of lung metastases of GW-39 human colonic tumors in nude mice using hMN-14-[CLl-SN-38] and hMN-14-[CL2-SN-38]
- a lung metastatic model of colonic carcinoma was established in nude mice by i.v. injection of GW-39 human colonic tumor suspension, and therapy was initiated 14 days later.
- Specific anti-CEACAM5 antibody conjugates, hMN14-CLl-SN-38 and hMN14-CL2-SN-38, as well as nontargeting anti-CD22 MAb control conjugates, hLL2-CLl-SN-38 and hLL2- CL2-SN-38 and equidose mixtures of hMN14 and SN-38 were injected at a dose schedule of q4dx8, using different doses.
- FIG. 4 shows selective therapeutic effects due to hMN-14 conjugates.
- mice treated with hMN14-CLl -SN-38 or hMN14-CL2-SN-38 showed a median survival of greater than 107 days.
- mice treated with the control conjugated antibodies hLL2-CLl -SN-38 and hLL2-CL2-SN-38, which do not specifically target lung cancer cells showed median survival of 56 and 77 days, while mice treated with unconjugated hMN14 IgG and free SN- 38 showed a median survival of 45 days, comparable to the untreated saline control of 43.5 days.
- ADC SN-38-anti-TROP-2 antibody-drug conjugate
- CL2-SN-38 and CL2A-SN-38 were conjugated to the anti- TROP-2-hum ani zed antibody, hRS7.
- the immunoconjugates were characterized in vitro for stability, binding, and cytotoxicity. Efficacy was tested in five different human solid tumor- xenograft models that expressed TROP-2 antigen. Toxicity was assessed in mice and in Cynomolgus monkeys.
- the hRS7 conjugates of the two SN-38 derivatives were equivalent in drug substitution ( ⁇ 6), cell binding (K d ⁇ 1.2 nmol/L), cytotoxicity (IC 5( , ⁇ 2.2 nmol/L), and serum stability in vitro (t/ 1 ⁇ 4 ⁇ 20 hours). Exposure of cells to the ADC demonstrated signaling pathways leading to PARP cleavage, but differences versus free SN-38 in p53 and p21 upregulation were noted.
- Cynomolgus monkeys infused with 2 x 0.96 mg/kg exhibited only transient decreases in blood counts, although, importantly, the values did not fall below normal ranges.
- human cancer xenograft models including non-small cell lung carcinoma, pancreatic, colorectal, and squamous cell lung carcinomas, all at nontoxic doses (e.g., ⁇ 3.2 mg/kg cumulative SN-38 equivalent dose).
- TROP-2 is widely expressed in many epithelial cancers, but also some normal tissues, and therefore a dose escalation study in Cynomolgus monkeys was performed to assess the clinical safety of this conjugate. Monkeys tolerated 24 mg SN-38 equivalents kg with only minor, reversible, toxicities. Given its tumor-targeting and safety profile, hRS7-SN-38 may provide an improvement in the management of solid tumors responsive to irinotecan.
- TROP-2 Human trophoblast cell-surface antigen (TROP-2), also known as GA733-1 (gastric antigen 733-1 ), EGP-1 (epithelial glycoprotein- 1), and TACSTD2 (tumor-associated calcium signal transducer), is expressed in a variety of human carcinomas and has prognostic significance in some, being associated with more aggressive disease (see, e.g., Alberti et al., 1992, Hybridoma 11 :539-45; Stein et al., 1993, Int J Cancer 55:938-46; Stein et al., 1994, Int J Cancer Suppl. 8:98-102).
- GA733-1 gastric antigen 733-1
- EGP-1 epidermal glycoprotein- 1
- TACSTD2 tumor-associated calcium signal transducer
- TROP-2 has been reconstituted by human pancreatic cancer cell line transfected with murine TROP-2.
- TROP-2 antigen's distribution in many epithelial cancers makes it an attractive therapeutic target.
- Stein and colleagues (1993, Int J Cancer 55:938-46) characterized an antibody, designated RS7-3G11 (RS7), that bound to EGP-1, which was present in a number of solid tumors, but the antigen was also expressed in some normal tissues, usually in a lower intensity, or in restricted regions.
- ADC antibody-drug conjugates
- CL2 (designated CL2) to be more effective in preventing or arresting the growth of human colonic and pancreatic cancer xenografts than other linkages with more or less stability.
- SN-38 coupled to nontargeting, plasma extending agents such as polyethylene glycol (PEG) or micelles
- PEG polyethylene glycol
- immunoconjugates and irinotecan are shown in SN-38 equivalents. Based on a mean SN- 38/IgG substitution ratio of 6, a dose of 500 ⁇ g ADC to a 20-g mouse (25 mg/kg) contains 0.4 mg/kg of SN-38. Irinotecan doses are likewise shown as SN-38 equivalents (i.e., 40 mg irinotecan/kg is equivalent to 24 mg/kg of SN-38).
- NCr female athymic nude (nu/nu) mice, 4 to 8 weeks old, and male Swiss-Webster mice, 10 weeks old, were purchased from Taconic Farms. Tolerability studies were performed in Cynomolgus monkeys (Macaca fascicularis; 2.5-4 kg male and female) by SNBL USA, Ltd. Animals were implanted subcutaneously with different human cancer cell lines. Tumor volume (TV) was determined by
- hRS7-CL2A-SN-38 and control ADC were reconstituted and diluted as required in sterile saline. All reagents were administered intraperitoneally (0.1 mL), except irinotecan, which was administered intravenously.
- the dosing regimen was influenced by our prior investigations, where the ADC was given every 4 days or twice weekly for varying lengths of time (Moon et al., 2008, J Med Chem 51:6916-26; Govindan et al., 2009, Clin Cancer Res 15:6052-61). This dosing frequency reflected a consideration of the conjugate's serum half-life in vitro, to allow a more continuous exposure to the ADC.
- mice [0248] Pharmacokinetics and biodistribution.
- m In-radiolabeled hRS7-CL2A-SN-38 and hRS7 IgG were injected into nude mice bearing s.c. SK-MES-1 tumors ( ⁇ 0.3 cm 3 ).
- One group was injected intravenously with 20 ⁇ (250 ⁇ g protein) of l u In-hRS7-CL2A-SN-38, whereas another group received 20 ⁇ (250 ⁇ g protein) of H 1 In-hRS7 IgG.
- mice 5 per timepoint
- mice were anesthetized, bled via intracardiac puncture, and then euthanized.
- mice were sorted into 4 groups each to receive 2-mL i.p. injections of either a sodium acetate buffer control or 3 different doses of hRS7-CL2A-SN-38 (4, 8, or 12 mg/kg of SN-38) on days 0 and 3 followed by blood and serum collection, as described in Results.
- Cynomolgus monkeys (3 male and 3 female; 2.5-4.0 kg) were administered 2 different doses of hRS7-CL2A-SN- 38. Dosages, times, and number of monkeys bled for evaluation of possible hematologic toxicities and serum chemistries are described in the Results.
- hRS7-CL2A and hRS7-CL2-SN-38 were compared in mice bearing COLO 205 or Capan-1 tumors (not shown), using 0.4 mg or 0.2 mg kg SN-38 twice weekly x 4 weeks, respectively, and with starting tumors of 0.25 cm 3 size in both studies. Both the hRS7-CL2A and CL2-SN-38 conjugates significantly inhibited tumor growth compared to untreated
- SN-38 is known to activate several signaling pathways in cells, leading to apoptosis.
- Our initial studies examined the expression of 2 proteins involved in early signaling events (p21 Wafl/Cipl and p53) and 1 late apoptotic event [cleavage of poly-ADP-ribose polymerase (PAPvP)] in vitro (not shown).
- PAPvP poly-ADP-ribose polymerase
- the MTD of irinotecan (24 mg SN-38/kg, q2dx5) was as effective as hRS7-CL2-SN-38, because mouse serum can more efficiently convert irinotecan to SN-38 than human serum, but the SN-38 dose in irinotecan (2,400 ⁇ g cumulative) was 37.5-fold greater than with the conjugate (64 ⁇ g total).
- mice bearing BxPC-3 human pancreatic tumors (FIG. 5D)
- tumor uptake in a group of animals that first received a predose of 0.2 mg/kg (250 ⁇ g protein) of the hRS7 ADC 3 days before the injection of the 1 "in-labeled antibody was examined.
- Predosing had no appreciable impact on blood clearance or tissue uptake (not shown).
- ALT levels were also above the normal range (>77 U/L) within 7 days of treatment (not shown) and with evidence of normalization by Day 15. Livers from all these mice did not show histologic evidence of tissue damage (not shown). In terms of renal function, only glucose and chloride levels were somewhat elevated in the treated groups. At 2 x 8 mg/kg, 5 of 7 mice had slightly elevated glucose levels (range of 273-320 mg dL, upper end of normal 263 mg dL) that returned to normal by 15 days postinjection.
- chloride levels were slightly elevated, ranging from 116 to 127 mmol/L (upper end of normal range 115 mmol/L) in the 2 highest dosage groups (57% in the 2 x 8 mg/kg group and 100% of the mice in the 2 x 12 mg/kg group), and remained elevated out to 15 days postinjection.
- This also could be indicative of gastrointestinal toxicity, because most chloride is obtained through absorption by the gut; however, at termination, there was no histologic evidence of tissue damage in any organ system examined (not shown).
- mice do not express TROP-2 bound by hRS7, a more suitable model was required to determine the potential of the hRS7 conjugate for clinical use.
- Immunohistology studies revealed binding in multiple tissues in both humans and Cynomolgus monkeys (breast, eye, gastrointestinal tract, kidney, lung, ovary, fallopian tube, pancreas, parathyroid, prostate, salivary gland, skin, thymus, thyroid, tonsil, ureter, urinary bladder, and uterus; not shown). Based on this cross-reactivity, a tolerability study was performed in monkeys.
- Histopathology of the animals necropsied on day 11 (8 days after last injection) showed microscopic changes in hematopoietic organs (thymus, mandibular and mesenteric lymph nodes, spleen, and bone marrow), gastrointestinal organs (stomach, duodenum, jejunum, ileum, cecum, colon, and rectum), female reproductive organs (ovary, uterus, and vagina), and at the injection site. These changes ranged from minimal to moderate and were fully reversed at the end of the recovery period (day 32) in all tissues, except in the thymus and gastrointestinal tract, which were trending towards full recovery at this later timepoint.
- TROP-2 is a protein expressed on many epithelial tumors, including lung, breast, colorectal, pancreas, prostate, and ovarian cancers, making it a potentially important target for delivering cytotoxic agents.
- the RS7 antibody internalizes when bound to TROP-2 (Shih et al., 1995, Cancer Res 55:5857s-63s), which enables direct intracellular delivery of cytotoxics.
- SN-38 is a potent topoisomerase-I inhibitor, with IC 50 values in the nanomolar range in several cell lines. It is the active form of the prodrug, irinotecan, that is used for the treatment of colorectal cancer, and which also has activity in lung, breast, and brain cancers. We reasoned that a directly targeted SN-38, in the form of an ADC, would be a significantly improved therapeutic over CPT-11, by overcoming the latter's low and patient-variable bioconversion to active SN-38.
- hRS7-SN-38 Treatment of tumor-bearing mice with hRS7-SN-38 (either with CL2-SN-38 or CL2A-SN-38) significantly inhibited tumor growth in 5 different tumor models. In 4 of them, tumor regressions were observed, and in the case of Calu-3, all mice receiving the highest dose of hRS7-SN-38 were tumor-free at the conclusion of study. Unlike in humans, irinotecan is very efficiently converted to SN-38 by a plasma esterase in mice, with a greater than 50% conversion rate, and yielding higher efficacy in mice than in humans. When irinotecan was administered at 10-fold higher or equivalent SN-38 levels, hRS7-SN-38 was significantly better in controlling tumor growth.
- Biodistribution studies in the SK-MES-1 model also showed that if tumor antigen becomes saturated as a consequence of successive dosing, tumor uptake of the specific conjugate is reduced, which yields therapeutic results similar to that found with an irrelevant conjugate.
- SN-38 induces significant damage to a cell's DNA, with upregulation of p53 and p2i WAF1 Cipl resulting in caspase activation and cleavage of PARP.
- both p53 and p21 WAF1 Ci P' were upregulated above basal levels.
- PARP cleavage was also evident in both cell lines, confirming an apoptotic event in these cells. Of interest was the higher
- TROP-2 recognized by hRS7 is not expressed in mice, it was critically important to perform toxicity studies in monkeys that have a similar tissue expression of
- TROP-2 as humans. Monkeys tolerated 0.96 mg/kg/dose ( ⁇ 12 mg/m 2 ) with mild and reversible toxicity, which extrapolates to a human dose of ⁇ 0.3 mg/kg/dose ( ⁇ 11 mg/m ).
- NK012 patients with solid tumors tolerated 28 mg/m 2 of SN-38 every 3 weeks with Grade 4 neutropenia as dose-limiting toxicity (Hamaguchi et al., 2010, Clin Cancer Res 16:5058-66).
- Phase I clinical trials with ENZ-2208 revealed dose- limiting febrile neutropenia, with a recommendation to administer 10 mg/m 2 every 3 weeks or 16 mg/m 2 if patients were administered G-CSF.
- Emab-SN-38 was more efficacious than a nonbinding, irrelevant IgG-SN-38 conjugate in vivo, eliminating a majority of well-established Ramos xenografts at nontoxic doses. In vitro and in vivo studies showed that Emab-SN-38 could be combined with unconjugated veltuzumab for a more effective treatment. Thus, Emab-SN-38 is active in lymphoma and leukemia at doses well below toxic levels and therefore represents a new promising agent with therapeutic potential alone or combined with anti-CD20 antibody therapy. (Sharkey et al., 2011, Mol Cancer Ther 11:224-34.)
- radioimmunoconjugates 90 Y-ibritumomab tiuxetan, 1 1 I-tositumomab
- a drug conjugate gemtuzumab ozogamicin
- FDA Food and Drug Administration
- Another antibody-drug conjugate (ADC), brentuximab vedotin (SGN-35; anti-CD30- auristatin E) recently received accelerated approval by the FDA for Hodgkin lymphoma and anaplastic large-cell lymphomas.
- ADC antibody-drug conjugate
- SGN-35 anti-CD30- auristatin E
- Antibodies against all of these targets are logical choices for carriers of drugs, because they are internalizing. Internalization and specificity of CD22 have made it a particularly important target for leukemia and lymphomas, with at least 3 different anti-CD22 conjugates in clinical investigation, including CMC-544 (acid-labile-conjugated calicheamicin), an anti- CD22-maytansine conjugate (stably linked MCC-DM1), and CAT-3888 (formally BL22; a Pseudomonas exotoxin single-chain fusion protein). The active agent in all of these conjugates has subnanomolar potency (i.e., so called ultra-toxics). [0281] We recently developed methods to conjugate antibodies with SN-38, a topoisomerase I inhibitor with low nanomolar potency that is derived from the prodrug, irinotecan
- CL2 was modified recently, eliminating the phenylalanine in the cathepsin B-cleavable dipeptide to simplify and improve manufacturing yields.
- the new derivative, designated CL2A retains the pH-sensitive carbonate linkage to the SN-38, but it is no longer selectively cleaved by cathepsin B. Nevertheless, it has identical serum stability and in vivo activity as the original CL2 linker (Cardillo et al., 201 1, Clin Cancer Res 17:3157-69). Because significant efficacy without toxicity was found with the slowly internalizing anti-CEACAM5-SN-38, we postulated that its activity was aided by the slow release of SN-38 from the antibody after it localized in a tumor. Thus, the main objective in this report was to evaluate the therapeutic prospects of conjugates prepared using the CL2A linker with two antibodies that are highly specific for B-cell cancers but differ in their antigen expression and internalization properties.
- Epratuzumab is a rapidly internalizing (e.g., >50% within 1 hour), humanized anti-CD22 IgGl that has been evaluated extensively in lymphoma and leukemia in an unconjugated or conjugated form.
- Veltuzumab is a humanized anti-CD20 antibody that is also being studied clinically but internalizes slowly (e.g., ⁇ 10% in 1 hour).
- CD20 is usually expressed at much higher levels than CD22 in non-Hodgkin lymphoma, whereas CD22 is preferentially expressed in acute lymphoblastic leukemia (ALL) but not in multiple myeloma. Both antibodies are effective in patients as unconjugated agents, but only veltuzumab is active in murine xenograft models (Stein et al., 2004, Clin Cancer Resus, etc.
- Epratuzumab and veltuzumab are humanized anti-CD22 and anti-CD20 IgGl monoclonal antibodies, respectively.
- Labetuzumab (Lmab) a humanized anti-CEACAM5 IgGl
- RS7 a humanized anti-TROP-2 antibody (both from Immunomedics, Inc.) were used as nonbinding, irrelevant controls.
- Emab-SN-38, Vmab-SN-38, and Lmab-SN-38 refer to conjugates prepared using the CL2A linker that was described above.
- Cytotoxicity was determined using the MTS dye reduction assay (Promega). Dose- response curves [with/without goat anti-human Fey F(ab') 2 ; Jackson ImmunoResearch] were generated from the mean of triplicate determinations, and IC 5 o-values were calculated using PRISM® GraphPad software (v5), with statistical comparisons using an F test on the best fit curves for the data. Significance was set at P ⁇ 0.05.
- mice were observed daily, using hind leg paralysis or other signs of morbidity as surrogate survival endpoints. All treatments were given intraperitoneally in ⁇ 0.2 mL. The specific dosages and frequency are given in the Results section. Because mice convert irinotecan to SN-38 efficiently, irinotecan dosing was adjusted on the basis of SN-38 equivalents; SN-38 mole equivalents are based on 1.6% of ADC mass and 60% of irinotecan mass.
- Efficacy was expressed in a Kaplan-Meier curve, using time to progression (TTP) as surrogate survival endpoints as indicated above.
- TTP time to progression
- Statistical analysis was conducted by a log- rank test using PRISM® GraphPad software (significance, P ⁇ 0.05).
- Emab-SN-38 and Vmab-SN-38 had similar potencies as the nonbinding, Lmab-SN-38 anti-CEACAM5 conjugate, which was likely due to dissociation of approximately 90% of SN-38 during the 4- day MTS assay.
- Other in vitro procedures using shorter exposure times were also ineffective in discriminating differences in the potencies of conjugates.
- Annexin V staining after a 1-day exposure failed to find differences between untreated and treated cells (not shown). Upregulation of p21 and PARP cleavage was also examined as early and late markers of apoptosis, respectively. Ramos did not express p21.
- Table 9 Expression of CD20 and CD22 by FACScan and in vitro cytotoxicity by MTS assay of SN-38 and specific Emab anti-CD22-SN-38, Vmab anti-CD20-SN-38, and Lmab anti-CEACAM5-SN-38 conjugates against several hematopoietic tumor cell lines
- Emab-CL2E-SN-38 consistently was approximately two times more potent than the nonbinding Lmab-anti- CEACAM5-CL2E-SN-38 conjugate (not shown). We concluded that it was unlikely that the more stably linked conjugate would be appropriate for a slowly internalizing veltuzumab conjugate and therefore continued our investigation only with CL2A-linked SN-38 conjugates.
- Emab-SN-38 dose-response and specificity.
- a dose-response relationship was seen for the specific Emab-SN-38 and irrelevant Lmab-SN-38 conjugates, but Emab-SN-38 had significantly better growth control at 2 of the 3 levels tested, and with a strong tend favoring the specific conjugate at the intermediate dose (FIG. 7).
- 0.25 mg of Emab-SN-38 ablated a majority of the tumors; here, 7 of 10 animals were tumor-free at the end of the 12- week monitoring period, with no change in body weight.
- Emab-SN-38 combined with unconjugated Vmab anti-CD20.
- 5 animals bearing subcutaneous Ramos tumors averaging approximately 0.3 cm 3 were given veltuzumab (0.1 mg), 0.1 mg of Emab-SN-38, or Emab-SN-38 + Vmab (all agents given twice weekly for 4 weeks).
- the median TTP to 2.0 cm 3 was 22, 14, and more than 77 days, respectively
- the Emab-SN-38 conjugate given at nontoxic dose levels was not significantly better than unconjugated anti-CD20 therapy, but the addition of Emab-SN-38 to unconjugated anti-CD20 therapy appeared to improve the response without toxicity. It is important to emphasize that the SN-38 conjugates are given at levels far less than their maximum tolerated dose, and therefore these results should not be interpreted that the unconjugated anti-CD20 therapy is equal to that of the Emab-SN-38 conjugate.
- veltuzumab alone 35 g twice weekly x 4 weeks was effective in this model.
- the median survival increased to 91 days in the first study, with 2 cures (day 161), and to 77 days in the second, but with no survivors after 89 days (veltuzumab alone vs. saline-treated, P ⁇ 0.001 in both studies).
- Unconjugated epratuzumab (0.3 mg/dose) combined with irinotecan and veltuzumab had the same median survival as veltuzumab alone, suggesting that neither epratuzumab nor irinotecan contributed to the net response.
- conjugates prepared with agents that are themselves potent in the picomolar range can have an increased risk for toxicity, as the recent decision to withdraw gemtuzumab ozogamicin, the anti-CD33- calicheamicin conjugate, from the market suggests (Ravandi, 2011, J Clin Oncol 29:349-51).
- the success of an ADC may depend on identifying appropriate chemistries to bind the drag and antibody together, as well as defining a suitable target that is sufficiently expressed to allow an adequate and selective delivery of the cytotoxic agent.
- both conjugates had similar antitumor activity against Ramos tumors, which flow cytometry had indicated expressed nearly 15-fold more CD20 than CD22.
- This lent support to selecting the Emab anti-CD22-SN-38 conjugate especially because it could be combined with unconjugated Vmab anti-CD20 therapy without concern that either agent would interfere with the binding of the other agent.
- an anti-CD20- SN-38 conjugate were used, the total IgG protein dose given likely would be below a level typically needed for effective unconjugated anti-CD20 antibody treatments, as the dose- limiting toxicity would be driven by the SN-38 content.
- Emab-SN-38 conjugate was as effective as the anti-CD20 conjugate
- selecting the Emab-SN-38 conjugate is a logical choice because it allows for a more effective combination therapy, even in tumors where one or both of the antigens are low in expression.
- Emab-SN-38 was active at a cumulative dose of 0.6 mg in mice bearing Ramos (75 ⁇ g twice weekly for 4 weeks), which extrapolates to a human dose of just 2.5 mg/kg. Thus, Emab-SN-38 should have an ample therapeutic window in patients. Furthermore, an effective and safe dose of the anti-TROP-2-SN-38 conjugate was combined with a maximum tolerated dose of a 90 Y-labeled antibody without an appreciable increase in toxicity but with improved efficacy (Sharkey et al., 2011, Mol Cancer Ther 10:1072-81). Thus, the safety and efficacy profile of these SN-38 antibody conjugates are very favorable for other combination therapies.
- Emab-SN-38 The specific therapeutic activity of Emab-SN-38 appeared to improve in cell lines with higher CD22 expression. For example, in Ramos, specific therapeutic effects of Emab- SN-38 alone were recorded at 2 of the 3 different dose levels examined, and a sizeable number of tumors were completely ablated. In contrast, in WSU-FSCCL that had about 2.5- fold lower expression of CD22, Emab-SN-38 improved survival significantly compared with the irrelevant anti-CEACAM5-SN-38 conjugate in 1 of 2 studies. However, it is important to emphasize that when used in combination with unconjugated anti-CD20 therapy, Emab-SN- 38 amplifies the therapeutic response. Thus, the combination of these two treatments could augment the response even in situations where CD22 is not highly expressed.
- Emab anti-CD22-SN-38 conjugate was equally active at nontoxic doses in vivo as a similar anti-CD20-SN-38 conjugate, despite the fact that CD20 expression was more than a log-fold higher than CD22.
- Therapeutic responses benefited by the combination of Emab-SN-38 with unconjugated Vmab anti-CD20 therapy, even when CD22 expression was low, suggesting that the combination therapy could improve responses in a number of B-cell malignancies when both antigens are present
- the current studies suggest that this combination is very potent in diverse lymphoma and leukemia preclinical models, yet appears to have less host toxicity.
- CD74 is an attractive target for antibody-drug conjugates (ADC), because it internalizes and recycles after antibody binding. CD74 mostly is associated with
- ADCs prepared with the humanized anti-CD74 antibody, milatuzumab, for the therapy CD74- expressing solid tumors was examined.
- Milatuzumab-doxorubicin and two milatuzumab-SN- 38 conjugates were prepared with cleavable linkers (CL2A and CL2E), differing in their stability in serum and how they release SN-38 in the lysosome.
- CD74 expression was determined by flow cytometry and immunohistology.
- Milatuzumab-doxorubicin was most effective in the lymphoma model, while in A-375 and Capan-1 , only the milatuzumab-CL2A-SN-38 showed a therapeutic benefit.
- milatuzumab-CL2A- SN-38 had similar efficacy in Capan-1 as anti-TROP-2 CL2A-SN-38, but in NCI-N87, the anti-CEACAM6 and anti-TROP-2 conjugates were superior.
- Studies in 2 hepatoma cell lines at a single dose level showed significant benefit over saline-treated animals, but not against an irrelevant IgG conjugate.
- CD74 is a suitable target for ADCs in some solid tumor xenografts, with efficacy largely influenced by uniformity of CD74 expression, and with CL2A-linked SN-38 conjugates providing the best therapeutic responses.
- CD74 referred to as invariant chain or Ii, is a type II transmembrane glycoprotein that associates with HLA-DR and inhibits the binding of antigenic peptides to the class II antigen presentation structure. It serves as a chaperone molecule, directing the invariant chain complexes to endosomes and lysosomes, an accessory molecule in the maturation of B cells, using a pathway mediated by NF-kB, and in T-cell responses via interactions with CD44 (Naujokas et al., 1993, Cell 74:257-68), and it is a receptor for the pro-inflammatory cytokine, macrophage migration inhibitory factor (Leng et al., 2003, / Exp Med 197: 1467- 76), which is involved in activating cell proliferation and survival pathways.
- invariant chain or Ii is a type II transmembrane glycoprotein that associates with HLA-DR and inhibits the binding of antigenic peptides to the class II anti
- CD74 is primarily expressed in B cells, monocytes, macrophages, dendritic cells, Langerhans cells, subsets of activated T cells, and thymic epithelium (not shown), and it is expressed in over 90% of B-cell tumors (Burton et al., 2004, Clin Cancer Res 10:6606-11; Stein et al., 2004, Blood 104:3705-11).
- B-cell tumors Busrton et al., 2004, Clin Cancer Res 10:6606-11; Stein et al., 2004, Blood 104:3705-11.
- Early studies had conflicting data on whether CD74 is present on the membrane, in part because the antibodies to the invariant chain were specific for the cytoplasmic portion of the molecule, but also because there are relatively few copies on the surface, and its half-life on the cell surface is very short.
- CD74 internalization is highly dynamic, with the antibody being moved quickly from the surface and unloaded inside the cell, followed by CD74 re-expression on the surface.
- CD74 also is expressed in non-hematopoietic cancers, such as gastric, renal, urinary bladder, non-small cell lung cancers, certain sarcomas, and glioblastoma (e.g., Gold et al., 2010, Int J Clin Exp Pathol 4: 1-12), and therefore it may be a therapeutic target for solid tumors expressing this antigen. Since a milatuzumab-doxorubicin conjugate was highly active in models of hematological cancers, it was a logical choice for this assessment. However, we recently developed procedures for coupling the highly potent topoisomerase I inhibitor, SN-38, to antibodies.
- SN-38 is the active form of irinotecan, whose pharmacology and metabolism are well known. These conjugates have nanomolar potency in solid tumor cell lines, and were found to be active with antibodies that were not actively internalized. Prior studies indicated a preference for a linker (CL2A) that allowed SN-38 to dissociate from the conjugate in serum with a half-life of ⁇ 1 day, rather than other linkers that were either more or less stable in serum. However, given milatuzumab's exceptional
- Milatuzumab (anti-CD74 MAb), epratuzumab (anti-CD22), veltuzumab (anti-CD20), labetuzumab (anti-CEACAM5), hMN15 (anti- CEACAM6), and hRS7 (anti-TROP-2) are humanized IgG t monoclonal antibodies.
- CL2A and CL2E linkers and their SN-38 derivatives were prepared and conjugated to antibodies as described in the Examples above.
- the milatuzumab-doxorubicin conjugates were prepared as previously described (Griffiths et al., 2003, Clin Cancer Res 9:6567-71).
- mice Female nude mice (4-8 weeks old) or female SCID mice (7 weeks old) were purchased from Taconic (Germantown, NY) and used after a 1-week quarantine. All agents, including saline controls, were administered intraperitoneally twice-weekly for 4 weeks. Specific doses are given in Results. Toxicity was assessed by weekly weight measurements. For the Raji Burkitt lymphoma model, SCID mice were injected
- mice were observed daily for signs of distress and paralysis, and were euthanized when either hind-limb paralysis developed, >15% loss of initial weight, or if otherwise moribund (surrogate survival endpoints).
- Subcutaneous tumors were measure by caliper in two dimensions, and the tumor volume (TV) calculated as L xw /2, where L is the longest diameter and w is the shortest. Measurements were made at least once weekly, with animals terminated when tumors grew to 1.0 cm 3 (i.e., surrogate survival end-point).
- Efficacy is expressed in Kaplan-Meier survival curves, using the surrogate end-points mentioned above for determining the median survival times. Analysis was performed by a log-rank (Mantel-Cox) test using Prism GraphPad software (LaJolla, CA), with significance at P ⁇ 0.05. Results
- CD74 expression in human tumor cell lines and xenografts Six cell lines derived from 4 different solid tumor types were identified as CD74-positive based primarily on the analysis of permeabilized cells (Table 10), since the MFI of membrane-only CD74 in the solid tumor cell lines very often was ⁇ 2-fold higher than the background MFI (except A-375 melanoma cell line). Surface CD74 expression in Raji was >5-fold higher than the solid tumor cell lines, but total CD74 in permeabilized Raji cells was similar to most of the solid tumor cell lines.
- doxorubicin-conjugated milatuzumab measured in the MC/CAR multiple myeloma cell line were 0.5 ⁇ 0.02 nM and 0.8 ⁇ 0.2 nM, respectively (Sapra et al., 2008, Clin Cancer Res 14: 1888-96).
- cathepsin B had no effect on the release of active SN-38 in the CL2A linker.
- CL2A has a cleavable benzyl carbonate bond, releasing active SN-38 at a rate similar to the CL2E linker at pH 5.0, with a half-life of ⁇ 10.2 h (not shown).
- the milatuzumab-doxorubicin conjugate which has a pH-sensitive acylhydrazone bond, had a half-life of 7 to 8 h at pH 5.0 (not shown).
- Milatuzumab- CL2A-SN-38 released 50% of free SN-38 in 21.55 ⁇ 0.17 h (not shown), consistent with other CL2A-SN-38 conjugates.
- the CL2E-SN-38 conjugate was highly inert, with a half-life extrapolated to -2100 h.
- the milatuzumab-doxorubicin conjugate released 50% of the doxorubicin in 98 h, which was similar to 2 other antibody-doxorubicin conjugates (not shown).
- Cytotoxicity A significant issue related to the evaluation of these conjugates was the relative potency of free doxorubicin and SN-38 in hematopoietic and solid tumor cell lines.
- SN-38 potency in 4 of the solid tumor cell lines that were later used for in vivo therapy studies ranged from 2.0 to 6 nM (not shown).
- Doxorubicin had a mixed response, with 3-4 nM potency in the Raji lymphoma and the A-375 melanoma cell lines, but it was nearly 10 times less potent against Capan-1, NCI-N87, and Hep G2 cell lines.
- Other studies comparing the potency of SN-38 to doxorubicin found: LS174T colon cancer, 18 vs. 18 (nM potency of SN-38 vs. doxorubicin, respectively); MDA-MB-231 breast cancer, 2 vs. 2 nM; SK-OV-4 ovarian cancer, 18 vs. 90 nM; Calu-3 lung adenocarcinoma, 32 vs.
- SN-38 was 5- to 20-fold more potent than doxorubicin in 4 of these 6 cell lines, with similar potency in LS174T and MDA-MB-231.
- the 3 conjugate forms were often some order of magnitude less potent than the free drug in vitro, since both drugs are expected to be transported readily into the cells, while drug conjugates require antibody binding to transport drug inside the cell (not shown).
- the CL2A-linked SN-38 conjugate is an exception, since more than 90% of the SN- 38 is released from the conjugate into the media over the 4-day assay period (Cardillo et al., 2011, Clin Cancer Res 17:3157-69; Sharkey et al., 2011, Mol Cancer Ther 11 :224-34).
- the conjugate was internalized rapidly, it would be difficult to discern differences between the free drug and the CL2A-linked drug.
- the stable CL2E-1 inked SN-38 performed comparatively well in the Raji cell line, compared to free SN-38, but it had substantially (7- to 16-fold) lower potency in the 4 solid tumor cell lines, suggesting the relatively low surface expression of CD74 may be playing a role in minimizing drug transport in these solid tumors.
- the milatuzumab-doxorubicin conjugate had substantial differences in its potency when compared to the free doxorubicin in all cell lines, which was of similar magnitude as the CL2E-SN-38 conjugates to free SN-38 in the solid tumor cell lines.
- the milatuzumab-CL2A-SN-38 conjugate was 9- to 60-times more potent than the milatuzumab-doxorubicin conjugate (not shown), but again, this result was influenced largely by the fact that the CL2A-linked conjugate releases most of its SN-38 into the media over the 4-day incubation period, whereas the doxorubicin conjugate would at most release 50% of its drug over this same time.
- the CL2E-linked milatuzumab was not examined in these other cell lines.
- the median survival was no better than the saline-treated animals (10.5 days).
- the MFI for surface-expressed TROP-2 and CEACAM6 were 795 and 1123, respectively, much higher than CD74 that was just 5 (see Table 10). Immunohistology showed a relatively intense cytoplasmic expression of CD74 in the xenograft of this cell line, but importantly it was scattered, appearing only in defined pockets within the tumor (not shown). CEACAM6 and TROP-2 were more uniformly expressed than CD74 (not shown), with CEACAM6 being more intensely present both cytoplasmically and on the membrane, and TROP-2 primarily found on the membrane. Thus, the improved survival with the anti-CEACAM6 and anti-TROP-2 conjugates most likely reflects both higher antigen density and more uniform expression in NCI-N87.
- CEACAM6 with isolated pockets of very intense membrane staining (not shown).
- non-binding veItuzumab-CL2A-SN- 38 conjugate provided a similar survival advantage as the milatuzumab conjugate.
- We previously observed therapeutic results with non-binding conjugates could be similar to the specific CL2A-linked conjugate, particularly at higher protein doses, but titration of the specific and control conjugates usually revealed selectively.
- neither of the specific conjugates provided a selective therapeutic advantage at these doses in this cell line.
- ADC antibody-drug conjugate
- HER2 is abundant on tumors expressing this antigen, the antibody is internalized, and the antibody itself has anti-tumor activity, all of which could combine to enhance therapeutic outcome.
- CD74 is expressed at a much lower level on the surface of cells, but its unique internalization and surface re-expression properties has allowed a milatuzumab anti-CD74 ADC to be effective in hematopoietic cancer xenograft models even with a moderately toxic drug, such as doxorubicin (Griffiths et al., 2003, Clin Cancer Res 9:6567-71 ; Sapra et al., 2005, Clin Cancer Res 11 :5257-64).
- doxorubicin is used more frequently in hematopoietic cancers, while SN-38 and other camptothecins are administered to patients with solid tumors, we decided to assess the utility of doxorubicin and SN-38 conjugates of milatuzumab in solid tumors.
- the milatuzumab-doxorubicin conjugate was effective in xenograft models of various hematological cancers, leading to its clinical testing
- antigen accessibility i.e., membrane vs. cytoplasm, physiological and "binding-site" barriers
- distribution among cells within a tumor are critical factors influencing every form of targeted therapy, particularly those that depend on adequate intracellular delivery of a product to individual cells (Thurber et al., 2008, Adv Drug Del Rev 60:1421-34).
- a targeted agent that slowly releases its payload after localizing in the tumor such as the CL2A-linked conjugates, would allow the drug to diffuse to non- targeted bystander cells, thereby enhancing its efficacy range.
- the CL2E-Iinked SN-38 conjugate had a promisingly similar IC50 as the CL2A conjugate in the Raji cell line, which was consistent with the view that if rapidly internalized, both conjugates would release the active form of SN-38 at approximately the same rate.
- the in vitro activity of the CL2A conjugate is influenced largely by the release of SN-38 into the media, and does not necessarily reflect uptake by the intact conjugate.
- the CL2E-linked conjugate was found to be much less potent in the solid tumor cell lines than the CL2A conjugate, this suggested that the lower surface expression of CD74 affected the internalization of SN-38 via milatuzumab binding.
- CD74 has multiple roles in cell biology; in antigen-presenting cells, it may have a more dominant role in processing antigenic peptides, where is solid tumors, its role might be related more to survival. These different roles could affect intracellular trafficking and processing. Alternatively, the lower efficacy of the CL2E-linked SN-38 could reflect drug inactivation by lactone ring-opening in SN-38, implicating the importance of the specific linker. Finally, in the solid tumor models, antigen accessibility appears to have a dominant role in defining milatuzumab-CL2A-SN-38's potency when measured against conjugates prepared with other internalizing (hRS7) or poorly internalizing antibodies (hMN15) that were more accessible (surface expressed) and abundant. We suspect this finding is universal for targeted therapies, but these studies have at least shown that the unique internalization properties of a CD74-targeted agent can provide significant efficacy even when surface expression of the target antigen is minimal.
- Example 14 Use of hRS7-SN-38 (IMMU-132) to treat therapy-refractive metastatic colonic cancer (mCRC)
- the patient was a 62-year-old woman with mCRC who originally presented with metastatic disease in January 2012. She had laparoscopic ileal transverse colectomy as the first therapy a couple of weeks after diagnosis, and then received 4 cycles of FOLFOX (leucovorin, 5-fluorouracil, oxaliplatin) chemotherapy in a neoadjuvant setting prior to right hepatectomy in March 2012 for removal of metastatic lesions in the right lobe of the liver. This was followed by an adjuvant FOLFOX regimen that resumed in June, 2012, for a total of 12 cycles of FOLFOX. In August, oxaliplatin was dropped from the regimen due to worsening neurotoxicity. Her last cycle of 5-FU was on 09/25/12.
- CT done in Jan 2013 showed metastases to liver. She was then assessed as a good candidate for enrollment to IMMU-132 (hRS7-SN-38) investigational study.
- Comorbidities in her medical history include asthma, diabetes mellitus, hypertension, hypercholesteremia, heart murmur, hiatal hernia, hypothyroidism, carpel tunnel syndrome, glaucoma, depression, restless leg syndrome, and neuropathy.
- Her surgical history includes tubo-ligation (1975), thyroidectomy (1983), cholescystectomy (2001), carpel tunnel release (2008), and glaucoma surgery.
- her target lesion was a 3.1 -cm tumor in the left lobe of the liver.
- Non-target lesions included several hypo-attenuated masses in the liver.
- Her baseline CEA was 781 ng/m.
- IMMU-132 was given on a once- weekly schedule by infusion for 2 consecutive weeks, then a rest of one week, this constituting a treatment cycle. These cycles were repeated as tolerated.
- the first infusion of IMMU-132 (8mg/kg) was started on Feb 15, 2013, and completed without notable events. She experienced nausea (Grade 2) and fatigue (Grade 2) during the course of the first cycle and has been continuing the treatment since then without major adverse events. She reported alopecia and constipation in March 2013.
- the first response assessment done (after 6 doses) on 04/08/2013 showed a shrinkage of target lesion by 29% by computed tomography (CT). Her CEA level decreased to 230 ng/ml on March 25, 2013.
- CT computed tomography
- Example 15 Use of hRS7-SN-38 (IMMU-132) to treat therapy-refractive metastatic breast cancer [0353]
- the patient was a 57-year-old woman with stage IV, triple-negative, breast cancer (ER/PR negative, HER-neu negative), originally diagnosed in 2005. She underwent a lumpectomy of her left breast in 2005, followed by Dose-Dense ACT in adjuvant setting in September 2005. She then received radiation therapy, which was completed in November. Local recurrence of the disease was identified when the patient palpated a lump in the contralateral (right) breast in early 2012, and was then treated with CMF (cyclophosphamide, methotrexate, 5-fluorouracil) chemotherapy.
- CMF cyclophosphamide, methotrexate, 5-fluorouracil
- Her disease recurred in the same year, with metastatic lesions in the skin of the chest wall. She then received a carboplatin + TAXOL® chemotherapy regimen, during which thrombocytopenia resulted. Her disease progressed and she was started on weekly doxorubicin, which was continued for 6 doses. The skin disease also was progressing. An FDG-PET scan on 09/26/12 showed progression of disease on the chest wall and enlarged, solid, axillary nodes. The patient was given oxycodone for pain control.
- XELODA® which was not tolerated well due to neuropathy in her hands and feet, as well as constipation.
- the skin lesions were progressive and then she was enrolled in the IMMU-132 trial after giving informed consent.
- the patient also had a medical history of hyperthyroidism and visual disturbances, with high risk of CNS disease (however, brain MRI was negative for CNS disease).
- her cutaneous lesions (target) in the right breast measured 4.4 cm and 2.0 cm in the largest diameter. She had another non-target lesion in the right breast and one enlarged lymph node each in the right and left axilla.
- the first IMMU-132 infusion (12 mg/kg) was started on March 12, 2013, which was tolerated well. Her second infusion was delayed due to Grade 3 absolute neutrophil count (ANC) reduction (0.9) on the scheduled day of infusion, one week later. After a week delay and after receiving NEULASTA®, her second IMMU-132 was administered, with a 25% dose reduction at 9 mg/kg. Thereafter she has been receiving IMMU-132 on schedule as per protocol, once weekly for 2 weeks, then one week off. Her first response assessment on May 17, 2013, after 3 therapy cycles, showed a 43% decrease in the sum of the long diameter of the target lesions, constituting a partial response by RECIST criteria. She is continuing treatment at the 9 mg/kg dose level. Her overall health and clinical symptoms improved considerably since she started treatment with IMMU-132.
- ANC absolute neutrophil count
- Example 16 Use of hRS7-SN-38 (IMMU-132) to treat refractory, metastatic, non-small cell lung cancer [0356] This is a 60-year-old man diagnosed with non-small cell lung cancer. The patient is given chemotherapy regimens of carboplatin, bevacizumab for 6 months and shows a response, and then after progressing, receives further courses of chemotherapy with carboplatin, etoposide, TAXOTERE®, gemcitabine over the next 2 years, with occasional responses lasting no more than 2 months. The patient then presents with a left mediastinal mass measuring 6.5 x 4 cm and pleural effusion.
- IMMU-132 After signing informed consent, the patient is given IMMU-132 at a dose of 18 mg kg every other week. During the first two injections, brief periods of neutropenia and diarrhea are experienced, with 4 bowel movements within 4 hours, but these resolve or respond to symptomatic medications within 2 days. After a total of 6 infusions of IMMU-132, CT evaluation of the index lesion shows a 22% reduction, just below a partial response but definite tumor shrinkage. The patient continues with this therapy for another two months, when a partial response of 45% tumor shrinkage of the sum of the diameters of the index lesion is noted by CT, thus constituting a partial response by RECIST criteria.
- Example 17 Use of hRS7-SN-38 (IMMU-132) to treat refractory, metastatic, small-cell lung cancer
- MRI of the brain also shows a 10% reduction of this metastasis. She continues her IMMU-132 dosing every 3 weeks for another 3 months, and continues to show objective and subjective improvement of her condition, with a 25% reduction of the left lung mass and a 21 % reduction of the brain metastasis.
- Example 18 Therapy of a gastric cancer patient with Stage IV metastatic disease with hRS7-SN-38 (IMMU-132)
- This patient is a 60-year-old male with a history of smoking and periods of excessive alcohol intake over a 40-year-period. He experiences weight loss, eating discomfort and pain not relieved by antacids, frequent abdominal pain, lower back pain, and most recently palpable nodes in both axilla. He seeks medical advice, and after a workup is shown to have an adenocarcinoma, including some squamous features, at the gastroesophageal junction, based on biopsy via a gastroscope.
- CT and FDG-PET Radiological studies (CT and FDG-PET) also reveal metastatic disease in the right and left axilla, mediastinal region, lumbar spine, and liver (2 tumors in the right lobe and 1 in the left, all measuring between 2 and 4 cm in diameter). His gastric tumor is resected and he is then put on a course of chemotherapy with epirubicin, cisplatin, and 5-fluorouracil. After 4 months and a rest period of 6 weeks, he is switched to docetaxel chemotherapy, which also fails to control his disease, based on progression confirmed by CT measurements of the metastatic tumors and some general deterioration.
- Example 19 Therapy of advanced colon cancer patient refractory to prior chemo-immunotherapy, using only IMMU-130 (labetuzumab-SN-38)
- the patient is a 50- year-old man with a history of stage-IV metastatic colonic cancer, first diagnosed in 2008 and given a colectomy and partial hepatectomy for the primary and metastatic colonic cancers, respectively. He then received chemotherapy, as indicated FIG. 8, which included irinotecan, oxaliplatin, FOLFIRINOX (5-fluoraracil, leucovorin, irinotecan, oxaliplatin), and bevacizumab, as well as bevacizumab combined with 5- fluorouracil/leucovorin, for almost 2 years.
- chemotherapy as indicated FIG. 8, which included irinotecan, oxaliplatin, FOLFIRINOX (5-fluoraracil, leucovorin, irinotecan, oxaliplatin), and bevacizumab, as well as bevacizumab combined with 5- fluorouracil/leucovorin, for almost 2 years.
- the nausea, diarrhea, and occasional vomiting lasted only 2-3 days, and his fatigue after the first infusion lasted 2 weeks. Otherwise, the patient tolerated the therapy well.
- this patient who had failed prior chemotherapy and immunotherapy, including irinotecan (parent molecule of SN-38), showed an objective response to the active metabolite of irintotecan (or camptotechin), SN-38, when targeted via the anti-CEACAM5 humanized antibody, labetuzumab (hMN-14).
- irinotecan CPT-11
- the SN-38 conjugated anti-CEACAM5 antibody proved effective in a colorectal cancer patient by inducing a partial response after the patient earlier failed to respond to his last irinotecan-containing therapy.
- the patient's plasma CEA titer reduction also corroborated the CT findings: it fell from the baseline level of 12.6 ng/mL to 2.1 ng/mL after the third therapy dose, and was between 1.7 and 3.6 ng/mL between doses 8 and 12.
- the normal plasma titer of CEA is usually considered to be between 2.5 and 5.0 ng/mL, so this therapy effected a normalization of his CEA titer in the blood.
- Example 20 Therapy of a patient with advanced colonic cancer with IMMU-130 [0364]
- This patient is a 75-year-old woman initially diagnosed with metastatic colonic cancer (Stage IV). She has a right partial hemicolectomy and resection of her small intestine and then receives FOLFOX, FOLFOX + bevacizumab, FOLFIRI + ramucirumab, and FOLFIRI + cetuximab therapies for a year and a half, when she shows progression of disease, with spread of disease to the posterior cul-de-sac, omentum, with ascites in her pelvis and a pleural effusion on the right side of her chest cavity.
- Her baseline CEA titer just before this therapy is 15 ng/mL. She is given 6 mg/kg IMMU-130 (anti-CEACAM5-SN-38) twice weekly for 2 consecutive weeks, and then one week rest (3-week cycle), for more than 20 doses, which is tolerated very well, without any major hematological or non-hematological toxicities.
- her plasma CEA titer shrinks modestly to 1.3 ng mL, but at the 8-week evaluation she shows a 21% shrinkage of the index tumor lesions, which increases to a 27% shrinkage at 13 weeks. Surprisingly, the patient's ascites and pleural effusion both decrease (with the latter disappearing) at this time, thus improving the patient's overall status remarkably. The patient continues her investigational therapy.
- Example 21 Gastric cancer patient with Stage IV metastatic disease treated with IMMU-130
- the patient is a 52-year-old male who sought medical attention because of gastric discomfort and pain related to eating for about 6 years, and with weight loss during the past 12 months. Palpation of the stomach area reveals a firm lump which is then gastroscoped, revealing an ulcerous mass at the lower part of his stomach. This is biopsied and diagnosed as a gastric adenocarcinoma. Laboratory testing reveals no specific abnormal changes, except that liver function tests, LDH, and CEA are elevated, the latter being 10.2 ng/mL. The patent then undergoes a total-body PET scan, which discloses, in addition to the gastric tumor, metastatic disease in the left axilla and in the right lobe of the liver (2 small metastases). The patient has his gastric tumor resected, and then has baseline CT measurements of his metastatic tumors. Four weeks after surgery, he receives 3 courses of combination
- His fourth infusion is postponed by one week, and then the weekly infusions are reinstituted, with no evidence of diarrhea or neutropenia for the next 4 injection.
- the patient then undergoes a CT study to measure his metastatic tumor sizes and to view the original area of gastric resection.
- the radiologist measures, according to RECIST criteria, a decrease of the sum of the metastatic lesions, compared to baseline prior to IMMU-130 therapy, of 23%. There does not seem to be any clear lesion in the area of the original gastric resection.
- the patient's CEA titer at this time is 7.2 ng/mL, which is much reduced from the pre-IMMU-130 baseline value of 14.5 ng mL.
- the patient continues on weekly IMMU-130 therapy at the same dose of 8.0 mg/kg, and after a total of 13 infusions, his CT studies show that one liver metastasis has disappeared and the sum of all metastatic lesions is decreased by 41%, constituting a partial response by RECIST.
- the patient's general condition improves and he resumes his usual activities while continuing to receive a maintenance therapy of 8 mg/kg IMMU-130 every third week for another 4 injections.
- the value is 4.8 ng/mL, which is within the normal range for a smoker, which is the case for this patient.
- Example 22 Therapy of relapsed triple-negative metastatic breast cancer with hMN-15-SN-38
- Example 23 Therapy of relapsed, generally refractive, metastatic colonic carcinoma with hMN-15-SN-38
- a 46-year-old woman has Stage IV metastatic colonic cancer, with a prior history of resection of the primary lesion that also had synchronous liver metastases to both lobes of the liver, as well as a single focus of spread to the right lung; these metastases measured, by CT, between 2 and 5 cm in diameter.
- Her plasma CEA titer at baseline prior to hMN-14-SN-38 therapy is 46 ng/mL, and her total index lesions measure a sum of 92 mm.
- Example 24 Colonic cancer patient with Stage IV metastatic disease treated with anti-CSAp-SN-38 conjugate
- This patient presents with colonic cancer metastases to the left lobe of the liver and to both lungs, after having a resection of a 9-cm sigmoid colon adenocarinoma, followed by chemo-immunotherapy with FOLIFIRI and cetuximab for 6 months, and then FOLFOX followed by bevacizumab for an additional period of about 9 months.
- FOLIFIRI and cetuximab chemo-immunotherapy with FOLIFIRI and cetuximab for 6 months
- FOLFOX followed by bevacizumab for an additional period of about 9 months.
- Her plasma CEA at this time is 52 ng/mL, and her general condition appears to have deteriorated, with abdominal pains, fatigue, and borderline anemia, suggesting possibly internal bleeding.
- This patient has triple-negative (does not express estrogen receptor, progesterone receptor or Her2/neu) metastatic breast cancer that is relapsed after several different therapies over the past 3 years. She presents with several small tumors in both lungs, as well as metastases to her C4, C5, T2, and T3 vertebrae, as well as the several ribs bilaterally. She is under standard therapy for her osteolytic lesions, and now begins treatment with hMN-15- SN-38 at a dose of 16 mg/kg once- weekly for 3 weeks, with a pause of one week, and then resumes this 3-weekly-cycle therapy two more times.
- CT scans are performed to evaluate response, and it is noted that 2 of the small lung metastases have disappeared while 1 of the larger lesions appears to have diminished by about 40%. The metastases to the vertebrae are still present, but the C4 and C5 lesions appear smaller by about 25%. Of the metastases to the ribs, 2 of 6 small lesions appear to be very much diminished in size, and are not certain as to being viable or small areas of scar or necrosis.
- the patient's tumor markers, as well as her LDH titers appear to show either stable or reduced levels, indicating that disease progression has been halted and there is also some evidence of disease reduction. Subjectively, the patient is feeling much better, with less fatigue and bone pain and improved breathing. She has experienced some minimal nausea and vomiting after each therapy, which resolved within a week. The only other side effect has been a transient thrombocytopenia, which also resolves within 7 days. She is being observed and will resume therapy cycles within 2 months.
- This patient has metastatic colonic cancer, with CT evidence of disease in the liver (5 cm lesion in right lobe and 3 cm lesion in left lobe), as well as 2 metastases (2- and 3-cm sizes) to the right lung.
- the primary cancer of the colon was previously resected and the patient had courses of post-operative therapy because of metachronous metastases to the liver and lungs.
- the liver metastases grow and the one lung metastasis becomes two, so the patient is a candidate for experimental chemoimmunotherapy.
- thrombocytopenia and leucopenia returning to normal ranges within 2 weeks after therapy, and several bouts of nausea and vomiting, controlled by anti-emetic medication. It is planned that the patient will resume these therapy cycles in about 2 months, following another workup for disease status.
- the patient was previously resected for a rectal carcinoma and receives pre- and postoperative radiochemotherapy as per conventional treatment. She has been free of tumor for four years, but now presents with 3 small metastatic lesions to the right liver lobe, discovered by routine CT and followup blood CEA values, which rise to 6.3 ng/mL from the 3.0 ng/mL post initial therapy. She is given an indwelling catheter and a continuous infusion of labetuzumab-SN-28 at a dose of 2 mg/kg over 17 days. She then receives a repeat continuous infusion therapy 5 weeks later, now for 3 weeks, at 1 mg/kg.
- the patient is a 50-year-old male who fails prior therapies for metastatic colon cancer.
- the first line of therapy is FOLFE INOX + AVASTIN® (built up in a stepwise manner) starting with IROX (Irinotecan+ Oxaliplatin) in the first cycle.
- IROX Irinotecan+ Oxaliplatin
- the patient has a CT that shows decrease in the size of liver metastases. This is followed by surgery to remove tumor tissue.
- Adjuvant chemotherapy is a continuation of the first line regimen (without the IROX part) that resulted in a transient recurrence-free period. After about a 1 year interval, a CT reveals the recurrence of liver metastases.
- Another CT shows a response in liver metastases. Then RF ablation of liver metastases is performed, followed by continuation of adjuvant chemotherapy with FOLFIRINOX + Cetuximab, followed by maintenance Cetuximab for approximately one year. Another CT scan shows no evidence of disease. A further scan shows possible lung nodules, which is confirmed. This leads to a wedge resection of the lung nodules. Subsequently FOLFIRI +Cetuximab is restarted and continued. Later CT scans show both lung and liver metastases.
- the patient At the time of administration of the hMN-14-SN-38 immunoconjugate, the patient has advanced metastatic colon cancer, with metastases of both lung and liver, which is unresponsive to irinotecan (camptothecin).
- the hMN-14-SN-38 immunoconjugate is administered at a dosage of 12 mg/kg, which is repeated every other week.
- the patient shows a partial response with reduction of metastatic tumors by RECIST criteria.
- This 44-year-old patient has a history of metastatic pancreatic carcinoma, with inoperable pancreas ductal adenocarcinoma in the pancreas head, and showing metastases to left and right lobes of the liver, the former measuring 3 x 4 cm and the latter measuring 2 x 3 cm.
- the patient is given a course of gemcitabine but shows no objective response.
- hPAM4-SN-38 i.v. at a dose of 8 mg/kg twice-weekly for 2 weeks, with one week off, and then repeated for another 2 cycles.
- CT studies are done one week later and show a total reduction in tumor mass (all sites) of 32% (partial response), alongside a drop in his blood CA19-9 titer from 220 at baseline to 75 at the time of radiological evaluation.
- the patient shows only grade 1 nausea and vomiting after each treatment with the antibody-drug conjugate, and a grade 2 neutropenia at the end of the last treatment cycle, which resolves 4 weeks later. No premedication for preventing infusion reactions is given.
- Example 30 Use of hL243-SN-38 to treat therapy-refractive metastatic colonic cancer (mCRC)
- the patient is a 67-year-old man who presents with metastatic colon cancer.
- the patient Following transverse colectomy shortly after diagnosis, the patient then receives 4 cycles of FOLFOX chemotherapy in a neoadjuvant setting prior to partial hepatectomy for removal of metastatic lesions in the left lobe of the liver. This is followed by an adjuvant FOLFOX regimen for a total of 10 cycles of FOLFOX.
- CT shows metastases to liver.
- His target lesion is a 3.0-cm tumor in the left lobe of the liver.
- Non-target lesions included several hypo-attenuated masses in the liver.
- Baseline CEA is 685 ng/mL.
- hL243-SN-38 (10 mg/kg) is given every other week for 4 months.
- the first response assessment done shows shrinkage of the target lesion by 26% by computed tomography (CT) and his CEA level decreases to 245 ng/mL.
- CT computed tomography
- the second response assessment after 12 doses, the target lesion has shrunk by 35%. His overall health and clinical symptoms are considerably improved.
- Example 31 Treatment of relapsed follicular lymphoma with IMMU-114-SN-38
- Example 32 Treatment of relapsed chronic lymphocytic leukemia with IMMU- 114-SN-38 [0383]
- IMMU- 114-SN-38 A 67-year-old man with a history of CLL, as defined by the International Workshop on Chronic Lymphocytic Leukemia and World Health Organization classifications, presents with relapsed disease after prior therapies with fludarabine, dexamethasone, and rituximab, as well as a regimen of CVP. He now has fever and night sweats associated with generalized lymph node enlargement, a reduced hemoglobin and platelet production, as well as a rapidly rising leukocyte count. His LDH is elevated and the beta-2-microglobulin is almost twice normal.
- the patient is given therapy with IMMU-1 14-SN-38 conjugate at a dosing scheme of 8 mg/kg weekly for 4 weeks, a rest of 2 weeks, and then the cycle repeated again. Evaluation shows that the patient's hematological parameters are improving and his circulating CLL cells appear to be decreasing in number. The therapy is then resumed for another 3 cycles, after which his hematological and lab values indicate that he has a partial response.
- Example 33 Use of hMN-15-SN-38 to treat refractory, metastatic, non-small cell lung cancer
- the patient is a 58-year-old man diagnosed with non-small cell lung cancer. He is initially given chemotherapy regimens of carboplatin, bevacizumab for 6 months and shows a response, and then after progressing, receives further courses of chemotherapy with carboplatin, etoposide, TAXOTERE®, gemcitabine over the next 2 years, with occasional responses lasting no more than 2 months. The patient then presents with a left mediastinal mass measuring 5.5 x 3.5 cm and pleural effusion.
- hMN-15-SN-38 After signing informed consent, the patient is given hMN-15-SN-38 at a dose of 12 mg/kg every other week. During the first two injections, brief periods of neutropenia and diarrhea are experienced, but these resolve or respond to symptomatic medications within 2 days. After a total of 6 infusions of hMN-15-SN-38, CT evaluation of the target lesion shows a 22% reduction. The patient continues with this therapy for another two months, when a partial response of 45% is noted by CT.
- Example 34 Treatment of follicular lymphoma patient with hA19-SN-38.
- a 60-year-old male presents with abdominal pain and the presence of a palpable mass.
- the patient has CT and FDG-PET studies confirming the presence of the mass with pathologic adenopathies in the mediastinum, axillary, and neck nodes. Lab tests are unremarkable except for elevated LDH and beta-2-microglobulin.
- Bone marrow biopsy discloses several paratrabecular and perivascular lymphoid aggregates. These are
- lymphocytic with expression of CD20, CD 19, and CD 10 by immunostaining.
- the final diagnosis is grade-2 follicular lymphoma, stage IVA, with a FLIPI score of 4.
- the longest diameter of the largest involved node is 7 cm.
- the patient is given a humanized anti-CD 19 monoclonal antibody IgG (hA19) conjugated with SN-38 (6 drug molecules per IgG).
- the dosing is 6 mg/kg weekly for 4 consecutive weeks, two weeks off, and then repeated cycles of 4 treatment weeks for every 6 weeks.
- bone marrow and imaging (CT) evaluations show a partial response, where the measurable lesions decrease by about 60% and the bone marrow is much less infiltrated.
- LDH and beta-2-microglobulin titers also decrease.
- Example 35 Treatment of relapsed precursor B-cell ALL with hA19-SN-38
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Cell Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Hematology (AREA)
- Medical Informatics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- Radiology & Medical Imaging (AREA)
- Pathology (AREA)
- Optics & Photonics (AREA)
- Physics & Mathematics (AREA)
- Heart & Thoracic Surgery (AREA)
- Surgery (AREA)
- High Energy & Nuclear Physics (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (29)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201380065210.2A CN104837508A (zh) | 2012-12-13 | 2013-07-23 | 功效改进且毒性降低的抗体与sn-38的免疫缀合物的剂量 |
| MX2015007343A MX342894B (es) | 2012-12-13 | 2013-07-23 | Dosis de inmunoconjugados de anticuerpos y sn-38 para eficacia mejorada y toxicidad reducida. |
| CN202410017229.XA CN118001422A (zh) | 2012-12-13 | 2013-07-23 | 功效改进且毒性降低的抗体与sn-38的免疫缀合物的剂量 |
| CA2884313A CA2884313C (en) | 2012-12-13 | 2013-07-23 | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity |
| LTEPPCT/US2013/051667T LT2900277T (lt) | 2012-12-13 | 2013-07-23 | Antikūnų ir sn-38 imunokonjugatų dozės, skirtos pagerintam veiksmingumui ir sumažintam toksiškumui |
| HRP20220399TT HRP20220399T1 (hr) | 2012-12-13 | 2013-07-23 | Režim doziranja imunokonjugata protutijela i sn-38 za poboljšanu učinkovitost i smanjenu toksičnost |
| EP22156351.3A EP4035689A1 (en) | 2012-12-13 | 2013-07-23 | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity |
| KR1020227002409A KR102536723B1 (ko) | 2012-12-13 | 2013-07-23 | 개선된 효능 및 감소된 독성을 위한 항체 및 sn-38의 면역컨쥬게이트의 투약 |
| ES13861658T ES2909746T3 (es) | 2012-12-13 | 2013-07-23 | Dosificaciones de inmunoconjugados de anticuerpos y SN-38 para una eficacia mejorada y una toxicidad disminuida |
| BR112015013444-0A BR112015013444B1 (pt) | 2012-12-13 | 2013-07-23 | Uso de um imunoconjugado |
| MX2016013664A MX379460B (es) | 2012-12-13 | 2013-07-23 | Dosis de inmunoconjugados de anticuerpos y sn-38 para eficacia mejorada y toxicidad reducida. |
| EP13861658.6A EP2900277B1 (en) | 2012-12-13 | 2013-07-23 | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity |
| JP2015547923A JP6366111B2 (ja) | 2012-12-13 | 2013-07-23 | 有効性の改善および毒性の減少のための、抗体およびsn−38からなるイムノコンジュゲートの投薬 |
| KR1020257007068A KR20250034532A (ko) | 2012-12-13 | 2013-07-23 | 개선된 효능 및 감소된 독성을 위한 항체 및 sn-38의 면역컨쥬게이트의 투약 |
| SI201331977T SI2900277T1 (sl) | 2012-12-13 | 2013-07-23 | Odmerki imunokonjugatov protiteles in SN-38 za boljšo učinkovitost in zmanjšano toksičnost |
| KR1020157014368A KR102356017B1 (ko) | 2012-12-13 | 2013-07-23 | 개선된 효능 및 감소된 독성을 위한 항체 및 sn-38의 면역컨쥬게이트의 투약 |
| PL13861658T PL2900277T3 (pl) | 2012-12-13 | 2013-07-23 | Dawkowanie immunokoniugatów przeciwciał i sn-38 dla poprawy skuteczności i zmniejszenia toksyczności |
| DK13861658.6T DK2900277T3 (da) | 2012-12-13 | 2013-07-23 | Doser af immunokonjugater af antistoffer og sn-38 til forbedret effektivitet og reduceret toksicitet |
| AU2013360335A AU2013360335B2 (en) | 2012-12-13 | 2013-07-23 | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
| CN202511504573.2A CN121338027A (zh) | 2012-12-13 | 2013-07-23 | 功效改进且毒性降低的抗体与sn-38的免疫缀合物的剂量 |
| KR1020237017275A KR20230078823A (ko) | 2012-12-13 | 2013-07-23 | 개선된 효능 및 감소된 독성을 위한 항체 및 sn-38의 면역컨쥬게이트의 투약 |
| IL238018A IL238018A (en) | 2012-12-13 | 2015-03-30 | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity |
| IL253494A IL253494B (en) | 2012-12-13 | 2017-07-16 | Dosages of antibody and sn-38 immunoconjugates for improved efficacy and reduced toxicity |
| IL255521A IL255521A (en) | 2012-12-13 | 2017-11-08 | Doses of antibody and sn-38 immunoconjugates for increased efficacy and reduced toxicity |
| AU2018201403A AU2018201403B2 (en) | 2012-12-13 | 2018-02-27 | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
| IL257839A IL257839B (en) | 2012-12-13 | 2018-03-04 | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity |
| AU2019250192A AU2019250192B2 (en) | 2012-12-13 | 2019-10-17 | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
| AU2021204263A AU2021204263B2 (en) | 2012-12-13 | 2021-06-23 | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
| AU2025203246A AU2025203246A1 (en) | 2012-12-13 | 2025-05-06 | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261736684P | 2012-12-13 | 2012-12-13 | |
| US61/736,684 | 2012-12-13 | ||
| US201361749548P | 2013-01-07 | 2013-01-07 | |
| US61/749,548 | 2013-01-07 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014092804A1 true WO2014092804A1 (en) | 2014-06-19 |
Family
ID=50931133
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2013/051667 Ceased WO2014092804A1 (en) | 2012-12-13 | 2013-07-23 | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity |
Country Status (20)
| Country | Link |
|---|---|
| US (17) | US9028833B2 (https=) |
| EP (2) | EP2900277B1 (https=) |
| JP (5) | JP6366111B2 (https=) |
| KR (4) | KR102536723B1 (https=) |
| CN (4) | CN107753954A (https=) |
| AU (5) | AU2013360335B2 (https=) |
| BR (1) | BR112015013444B1 (https=) |
| CA (2) | CA2884313C (https=) |
| CY (1) | CY1125140T1 (https=) |
| DK (1) | DK2900277T3 (https=) |
| ES (1) | ES2909746T3 (https=) |
| HR (1) | HRP20220399T1 (https=) |
| HU (2) | HUE057977T2 (https=) |
| IL (4) | IL238018A (https=) |
| LT (1) | LT2900277T (https=) |
| MX (2) | MX342894B (https=) |
| PL (1) | PL2900277T3 (https=) |
| PT (1) | PT2900277T (https=) |
| SI (1) | SI2900277T1 (https=) |
| WO (1) | WO2014092804A1 (https=) |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016090050A1 (en) * | 2014-12-03 | 2016-06-09 | Genentech, Inc. | Quaternary amine compounds and antibody-drug conjugates thereof |
| US9382329B2 (en) | 2012-08-14 | 2016-07-05 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to Trop-2 expressing cells |
| US9770517B2 (en) | 2002-03-01 | 2017-09-26 | Immunomedics, Inc. | Anti-Trop-2 antibody-drug conjugates and uses thereof |
| US9797907B2 (en) | 2015-04-22 | 2017-10-24 | Immunomedics, Inc. | Isolation, detection, diagnosis and/or characterization of circulating Trop-2-positive cancer cells |
| CN108367995A (zh) * | 2015-10-06 | 2018-08-03 | 安大略省癌症研究所 | 靶向组蛋白途径以检测和克服蒽环类抗生素耐受性 |
| WO2019039483A1 (ja) | 2017-08-23 | 2019-02-28 | 第一三共株式会社 | 抗体-薬物コンジュゲートの製剤及びその凍結乾燥方法 |
| AU2014293670B2 (en) * | 2013-07-23 | 2019-08-01 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
| EP3448260A4 (en) * | 2016-04-27 | 2019-10-09 | Immunomedics, Inc. | EFFICACY OF ANTI-TROP-2 SN-38 ANTIBODY CONJUGATES FOR THE THERAPY OF REZIDIVATED / REFRACTORY TUMORS AGAINST CHECKPOINT INHIBITORS |
| WO2020063676A1 (zh) * | 2018-09-26 | 2020-04-02 | 江苏恒瑞医药股份有限公司 | 依喜替康类似物的配体-药物偶联物及其制备方法和应用 |
| CN111295389A (zh) * | 2017-12-15 | 2020-06-16 | 四川科伦博泰生物医药股份有限公司 | 生物活性物偶联物及其制备方法和用途 |
| RU2793316C2 (ru) * | 2018-09-26 | 2023-03-31 | Цзянсу Хэнжуй Медицин Ко., Лтд. | Конъюгат лиганд-лекарственное средство аналога экзатекана, способ его получения и его применение |
| WO2023201267A1 (en) | 2022-04-13 | 2023-10-19 | Gilead Sciences, Inc. | Combination therapy for treating trop-2 expressing cancers |
| US20230338565A1 (en) * | 2020-05-15 | 2023-10-26 | Sichuan Kelun-Biotech Biopharmaceutical Co., Ltd. | Antibody drug conjugate, preparation method therefor and use thereof |
| EP4257134A3 (en) * | 2015-06-25 | 2024-01-24 | Immunomedics, Inc. | Combining anti-hla-dr or anti-trop-2 antibodies with microtubule inhibitors, parp inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
| EP4265275A4 (en) * | 2020-12-18 | 2024-03-20 | Shanghai Fudan-Zhangjiang Bio-Pharmaceutical Co., Ltd. | ANTIBODY-DRUG CONJUGATE TARGETING TROP2, PREPARATION METHOD AND USE THEREOF |
| US12564642B2 (en) | 2020-11-10 | 2026-03-03 | Sanofi | CEACAM5 antibody-drug conjugate formulation |
| US12570761B2 (en) | 2012-11-20 | 2026-03-10 | Sanofi | Anti-CEACAM5 antibodies and uses thereof |
Families Citing this family (106)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9599619B2 (en) | 2002-06-14 | 2017-03-21 | Immunomedics, Inc. | Anti-pancreatic cancer antibodies |
| CA2508831C (en) * | 2002-12-13 | 2012-05-01 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
| US9707302B2 (en) * | 2013-07-23 | 2017-07-18 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
| US10058621B2 (en) | 2015-06-25 | 2018-08-28 | Immunomedics, Inc. | Combination therapy with anti-HLA-DR antibodies and kinase inhibitors in hematopoietic cancers |
| US20160355591A1 (en) * | 2011-05-02 | 2016-12-08 | Immunomedics, Inc. | Subcutaneous anti-hla-dr monoclonal antibody for treatment of hematologic malignancies |
| US9943614B2 (en) | 2008-06-17 | 2018-04-17 | Brigham Young University | Cationic steroid antimicrobial diagnostic, detection, screening and imaging methods |
| AU2011207189B2 (en) | 2008-08-08 | 2014-01-16 | Immunomedics, Inc. | Detection of early-stage pancreatic adenocarcinoma |
| US20160095939A1 (en) * | 2014-10-07 | 2016-04-07 | Immunomedics, Inc. | Neoadjuvant use of antibody-drug conjugates |
| ES3000111T3 (en) | 2009-02-13 | 2025-02-27 | Immunomedics Inc | Intermediates for preparing conjugates with an intracellularly-cleavable linkage |
| US8491927B2 (en) * | 2009-12-02 | 2013-07-23 | Nimble Epitech, Llc | Pharmaceutical composition containing a hypomethylating agent and a histone deacetylase inhibitor |
| SG10201501803YA (en) | 2010-03-12 | 2015-05-28 | Immunogen Inc | Cd37-binding molecules and immunoconjugates thereof |
| CN104053458B (zh) | 2011-07-20 | 2016-07-20 | 布莱阿姆青年大学 | 包含洗脱塞拉集宁化合物的水凝胶材料 |
| US10039285B2 (en) | 2012-05-02 | 2018-08-07 | Brigham Young University | Ceragenin particulate materials and methods for making same |
| US20130309223A1 (en) * | 2012-05-18 | 2013-11-21 | Seattle Genetics, Inc. | CD33 Antibodies And Use Of Same To Treat Cancer |
| WO2017004144A1 (en) | 2015-07-01 | 2017-01-05 | Immunomedics, Inc. | Antibody-sn-38 immunoconjugates with a cl2a linker |
| US9492566B2 (en) * | 2012-12-13 | 2016-11-15 | Immunomedics, Inc. | Antibody-drug conjugates and uses thereof |
| US10413539B2 (en) | 2012-12-13 | 2019-09-17 | Immunomedics, Inc. | Therapy for metastatic urothelial cancer with the antibody-drug conjugate, sacituzumab govitecan (IMMU-132) |
| US10744129B2 (en) | 2012-12-13 | 2020-08-18 | Immunomedics, Inc. | Therapy of small-cell lung cancer (SCLC) with a topoisomerase-I inhibiting antibody-drug conjugate (ADC) targeting Trop-2 |
| US12310958B2 (en) | 2012-12-13 | 2025-05-27 | Immunomedics, Inc. | Antibody-drug conjugates and uses thereof |
| US20210393617A1 (en) * | 2012-12-13 | 2021-12-23 | Immunomedics, Inc. | Therapy for metastatic urothelial cancer with the antibody-drug conjugate, sacituzumab govitecan (immu-132) |
| US10206918B2 (en) | 2012-12-13 | 2019-02-19 | Immunomedics, Inc. | Efficacy of anti-HLA-DR antiboddy drug conjugate IMMU-140 (hL243-CL2A-SN-38) in HLA-DR positive cancers |
| WO2015012904A2 (en) * | 2012-12-13 | 2015-01-29 | Immunomedics, Inc. | Antibody-sn-38 immunoconjugates with a cl2a linker |
| CN107753954A (zh) * | 2012-12-13 | 2018-03-06 | 免疫医疗公司 | 功效改进且毒性降低的抗体与sn‑38的免疫缀合物的剂量 |
| US20240139324A1 (en) | 2012-12-13 | 2024-05-02 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity |
| US10137196B2 (en) * | 2012-12-13 | 2018-11-27 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
| US9089614B2 (en) | 2012-12-21 | 2015-07-28 | Bioalliance C.V. | Hydrophilic self-immolative linkers and conjugates thereof |
| JP6294352B2 (ja) | 2013-01-07 | 2018-03-14 | ブリガム・ヤング・ユニバーシティBrigham Young University | 細胞増殖を減少させ、ある特定の疾患を治療する方法 |
| WO2014151411A1 (en) | 2013-03-15 | 2014-09-25 | Brigham Young University | Methods for treating inflammation, autoimmune disorders and pain |
| US10568893B2 (en) | 2013-03-15 | 2020-02-25 | Brigham Young University | Methods for treating inflammation, autoimmune disorders and pain |
| US11524015B2 (en) | 2013-03-15 | 2022-12-13 | Brigham Young University | Methods for treating inflammation, autoimmune disorders and pain |
| US9452228B2 (en) | 2013-04-01 | 2016-09-27 | Immunomedics, Inc. | Antibodies reactive with an epitope located in the N-terminal region of MUC5AC comprising cysteine-rich subdomain 2 (Cys2) |
| US11253606B2 (en) | 2013-07-23 | 2022-02-22 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, Bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
| US11690855B2 (en) | 2013-10-17 | 2023-07-04 | Brigham Young University | Methods for treating lung infections and inflammation |
| CA2924398A1 (en) * | 2013-11-05 | 2015-05-14 | Immunomedics, Inc. | Humanized anti-ceacam5 antibody and uses thereof |
| US20150203527A1 (en) | 2014-01-23 | 2015-07-23 | Brigham Young University | Cationic steroidal antimicrobials |
| CA2844321C (en) | 2014-02-27 | 2021-03-16 | Brigham Young University | Cationic steroidal antimicrobial compounds |
| US10220045B2 (en) | 2014-03-13 | 2019-03-05 | Brigham Young University | Compositions and methods for forming stabilized compositions with reduced CSA agglomeration |
| US9931350B2 (en) | 2014-03-14 | 2018-04-03 | Brigham Young University | Anti-infective and osteogenic compositions and methods of use |
| RU2708075C2 (ru) * | 2014-04-30 | 2019-12-04 | Пфайзер Инк. | Конъюгаты анти-ртк7 антитело-лекарственное средство |
| WO2015175533A2 (en) * | 2014-05-13 | 2015-11-19 | Immunogen, Inc. | Anti-cd37 immunoconjugate dosing regimens |
| US9950077B2 (en) | 2014-06-20 | 2018-04-24 | Bioalliance C.V. | Anti-folate receptor alpha (FRA) antibody-drug conjugates and methods of using thereof |
| SG11201610624WA (en) * | 2014-06-20 | 2017-01-27 | Bioalliance Cv | Anti-cd22 antibody-drug conjugates and methods of using thereof |
| US10238665B2 (en) | 2014-06-26 | 2019-03-26 | Brigham Young University | Methods for treating fungal infections |
| US10441595B2 (en) | 2014-06-26 | 2019-10-15 | Brigham Young University | Methods for treating fungal infections |
| CA2948013A1 (en) * | 2014-06-30 | 2016-01-07 | Immunomedics, Inc. | Antibodies reactive with an epitope located in the n-terminal region of muc5ac comprising cysteine-rich subdomain 2 (cys2) |
| US10227376B2 (en) * | 2014-08-22 | 2019-03-12 | Brigham Young University | Radiolabeled cationic steroid antimicrobials and diagnostic methods |
| US10155788B2 (en) | 2014-10-07 | 2018-12-18 | Brigham Young University | Cationic steroidal antimicrobial prodrug compositions and uses thereof |
| CN104829730A (zh) * | 2015-04-14 | 2015-08-12 | 苏静 | 一种能联合免疫细胞增强肿瘤杀伤能力的双特异性抗体及其制备方法和应用 |
| US10370403B2 (en) | 2015-04-22 | 2019-08-06 | Brigham Young University | Methods for the synthesis of ceragenins |
| US9527883B2 (en) | 2015-04-22 | 2016-12-27 | Brigham Young University | Methods for the synthesis of ceragenins |
| EP3302561A4 (en) | 2015-06-08 | 2019-02-06 | Debiopharm International SA | COMBINATIONS OF ANTI-CD37 IMMUNOCONJUGATE AND ANTI-CD20 ANTIBODIES |
| US10195175B2 (en) | 2015-06-25 | 2019-02-05 | Immunomedics, Inc. | Synergistic effect of anti-Trop-2 antibody-drug conjugate in combination therapy for triple-negative breast cancer when used with microtubule inhibitors or PARP inhibitors |
| KR102766022B1 (ko) | 2015-08-28 | 2025-02-10 | 데비오팜 인터네셔날 에스 에이 | Cd37 의 검출을 위한 항체 및 검정 |
| US10087194B2 (en) | 2015-10-27 | 2018-10-02 | California Pacific Medical Center | Podophyllotoxin derivatives and their use |
| CN106937529B (zh) * | 2015-10-27 | 2021-02-05 | 加州太平洋医疗中心 | 鬼臼毒素衍生物及其应用 |
| EP3373937B1 (en) | 2015-11-09 | 2021-12-22 | R.P. Scherer Technologies, LLC | Anti-cd22 antibody-maytansine conjugates and methods of use thereof |
| IL260289B (en) | 2016-01-08 | 2022-08-01 | Bioalliance Cv | Tetravalent anti-psgl-1 antibodies and uses thereof |
| CN108601841A (zh) * | 2016-02-10 | 2018-09-28 | 免疫医疗公司 | Abcg2抑制剂与sacituzumab govitecan(immu-132)的组合克服表达trop-2的癌中对sn-38的抗性 |
| US10226550B2 (en) | 2016-03-11 | 2019-03-12 | Brigham Young University | Cationic steroidal antimicrobial compositions for the treatment of dermal tissue |
| TWI794171B (zh) | 2016-05-11 | 2023-03-01 | 美商滬亞生物國際有限公司 | Hdac抑制劑與pd-l1抑制劑之組合治療 |
| TWI808055B (zh) | 2016-05-11 | 2023-07-11 | 美商滬亞生物國際有限公司 | Hdac 抑制劑與 pd-1 抑制劑之組合治療 |
| WO2018031408A1 (en) * | 2016-08-11 | 2018-02-15 | Immunomedics, Inc. | EFFICACY OF ANTI-HLA-DR ANTIBODY DRUG CONJUGATE IMMU-140 (hL243-CL2A-SN-38) IN HLA-DR POSITIVE CANCERS |
| WO2018036438A1 (zh) * | 2016-08-23 | 2018-03-01 | 四川科伦博泰生物医药股份有限公司 | 一种抗体-药物偶联物及其制备方法和应用 |
| TWI680122B (zh) * | 2016-09-07 | 2019-12-21 | 國立陽明大學 | 活化腺苷單磷酸活化蛋白激酶之化合物 |
| EP3535297B1 (en) | 2016-11-02 | 2022-08-10 | Debiopharm International, S.A. | Methods for improving anti-cd37 immunoconjugate therapy |
| CN108066772B (zh) * | 2016-11-14 | 2021-07-13 | 中国科学院上海药物研究所 | 靶向tacstd2的抗体与药物偶联体(adc)分子 |
| WO2018102212A1 (en) * | 2016-12-01 | 2018-06-07 | Immunomedics, Inc. | Therapy for metastatic urothelial cancer with the antibody-drug conjugate, sacituzumab govitecan (immu-132) |
| US10959433B2 (en) | 2017-03-21 | 2021-03-30 | Brigham Young University | Use of cationic steroidal antimicrobials for sporicidal activity |
| EP3600283A4 (en) * | 2017-03-27 | 2020-12-16 | Immunomedics, Inc. | TREATMENT OF TROP-2 EXPRESSIVE TRIPLE NEGATIVE BREAST CANCER WITH SACITUZUMAB GOVITECAN AND A RAD51 INHIBITOR |
| US10799597B2 (en) | 2017-04-03 | 2020-10-13 | Immunomedics, Inc. | Subcutaneous administration of antibody-drug conjugates for cancer therapy |
| WO2018204422A1 (en) | 2017-05-01 | 2018-11-08 | Spg Therapeutics, Inc. | Tripartite androgen receptor eliminators, methods and uses thereof |
| EP3684820A4 (en) * | 2017-09-21 | 2021-05-26 | Wuxi Biologics (Cayman) Inc. | NEW ANTI-CD19 ANTIBODIES |
| US20230132400A9 (en) * | 2017-11-10 | 2023-04-27 | Actinium Pharmaceuticals, Inc. | Combination therapy for treatment of a hematological disease |
| KR20200117992A (ko) * | 2017-12-11 | 2020-10-14 | 트리페이스 리서치 앤드 디벨로프먼트 쓰리 코포레이션 | 항-cd22 항체-메이탄신 컨쥬게이트, 그것의 조합, 및 사용 방법 |
| CN107951888A (zh) * | 2017-12-19 | 2018-04-24 | 天津科技大学 | 阿法替尼与10-羟基喜树碱的药物组合及其应用 |
| WO2019154120A1 (zh) * | 2018-02-11 | 2019-08-15 | 四川科伦博泰生物医药股份有限公司 | 细胞毒性剂及其偶联物、其制备方法及用途 |
| CN110483639A (zh) | 2018-05-15 | 2019-11-22 | 复旦大学 | 靶向axl的抗体及抗体-药物偶联物及其制备方法和用途 |
| US12144818B2 (en) | 2018-05-30 | 2024-11-19 | Debiopharm International, S.A. | Method for treating cancer in a human patient by administering an anti-CD37 immunoconjugate using various dosing regimens |
| CN108743947B (zh) * | 2018-07-04 | 2020-12-15 | 复旦大学附属肿瘤医院 | 一种治疗b细胞淋巴瘤的药物组合物 |
| WO2020038278A1 (zh) * | 2018-08-21 | 2020-02-27 | 深圳市塔革特生物医药科技有限公司 | 新型喜树碱衍生物及其制备方法和应用 |
| MA54088A (fr) * | 2018-10-30 | 2022-03-16 | Immunogen Inc | Procédés de traitement faisant appel à des immunoconjugués anti-cd123 |
| WO2020180398A1 (en) * | 2019-01-14 | 2020-09-10 | The Regents Of The University Of California | Compositions and methods for modulating cellular internalization |
| AU2020216491A1 (en) * | 2019-02-01 | 2021-08-26 | VelosBio Inc. | Cancer treatment with ROR1 antibody immunoconjugates |
| US12186328B2 (en) | 2019-05-23 | 2025-01-07 | Brigham Young University | Use of CSA compounds to stimulate stem cells and hair growth |
| CN115379851A (zh) * | 2019-11-07 | 2022-11-22 | 因斯瑞拜奥有限公司 | 使用生长因子抗体与非酪氨酸靶向激酶抑制剂的组合的方法和组合物 |
| KR20220113747A (ko) * | 2019-12-16 | 2022-08-16 | 지앙수 헨그루이 파마슈티컬스 컴퍼니 리미티드 | 항 cea 항체-엑사테칸 유사체의 접합체 및 이의 약학적 용도 |
| WO2021143741A1 (zh) * | 2020-01-15 | 2021-07-22 | 北京海步医药科技有限公司 | 靶向多肽-药物缀合物及其用途 |
| JP2023512214A (ja) | 2020-01-28 | 2023-03-24 | リフレクション メディカル, インコーポレイテッド | 放射性核種および外部ビーム放射線療法の共同最適化 |
| AU2021240037A1 (en) | 2020-03-20 | 2022-09-22 | Immunomedics, Inc. | Biomarkers for sacituzumab govitecan therapy |
| CN111499685A (zh) * | 2020-03-30 | 2020-08-07 | 联宁(苏州)生物制药有限公司 | 具有马来酰亚胺连接头的抗体偶联药物中间体及其合成方法 |
| AU2021292488A1 (en) * | 2020-06-15 | 2023-02-02 | Monopar Therapeutics, Inc. | Precision radioimmunotherapeutic targeting of the urokinase plasminogen activator receptor (uPAR) for treatment of severe COVID-19 disease |
| KR102349925B1 (ko) * | 2020-07-16 | 2022-01-12 | 주식회사 피노바이오 | Fl118 약물을 포함하는 화합물 및 이를 이용한 면역접합체 |
| CN112168825A (zh) * | 2020-10-30 | 2021-01-05 | 江苏大学 | 含hsp90抑制剂和parp抑制剂的药物组合物 |
| CN112870194B (zh) * | 2021-01-06 | 2022-06-21 | 广州医科大学附属肿瘤医院 | 治疗肝癌的组合物及其应用 |
| EP4440603A1 (en) * | 2021-12-02 | 2024-10-09 | Sanofi | Cea assay for patient selection in cancer therapy |
| CA3241157A1 (en) | 2021-12-16 | 2023-06-22 | Wei Zhou | Camptothecin compound and conjugate thereof |
| CN116354976B (zh) * | 2021-12-27 | 2025-01-24 | 上海复旦张江生物医药股份有限公司 | 喜树碱衍生物的纯化方法 |
| CA3256048A1 (en) | 2022-04-13 | 2023-10-19 | Arcus Biosciences, Inc. | POLYTHERAPY FOR THE TREATMENT OF CANCERS EXPRESSING A TUMOR ANTIGEN |
| CN114778857B (zh) * | 2022-06-17 | 2022-08-23 | 信纳克(北京)生化标志物检测医学研究有限责任公司 | 检测非造血系统肿瘤的试剂组合物及其应用 |
| WO2024083162A1 (en) | 2022-10-19 | 2024-04-25 | Multitude Therapeutics Inc. | Antibodies, antibody-drug conjugates, preparations and uses thereof |
| CN116139267A (zh) * | 2023-01-28 | 2023-05-23 | 华中科技大学同济医学院附属同济医院 | 小鼠cd74单克隆抗体在制备治疗肿瘤药物中的应用 |
| KR20260012304A (ko) | 2023-04-17 | 2026-01-26 | 피크 바이오, 인크. | 항체 및 항체-약물 접합체 및 사용 방법 및 합성 공정 및 중간체 |
| AU2024326076A1 (en) | 2023-08-15 | 2026-02-12 | Gilead Sciences, Inc. | Treatment of non-small cell lung cancer using sacituzumab govitecan and an anti-pd-1 antibody or antigen binding fragment thereof |
| CN121969389A (zh) | 2023-10-13 | 2026-05-01 | 吉利德科学公司 | 用于治疗癌症的联合疗法 |
| CN119925630A (zh) * | 2023-11-03 | 2025-05-06 | 正大天晴药业集团南京顺欣制药有限公司 | 抗体药物偶联物的制备方法 |
| WO2025159982A1 (en) | 2024-01-22 | 2025-07-31 | Gilead Sciences, Inc. | Treatment of non-small cell lung cancer using sacituzumab govitecan |
Citations (228)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3927193A (en) | 1973-05-18 | 1975-12-16 | Hoffmann La Roche | Localization of tumors by radiolabelled antibodies |
| US4036945A (en) | 1976-05-03 | 1977-07-19 | The Massachusetts General Hospital | Composition and method for determining the size and location of myocardial infarcts |
| US4331647A (en) | 1980-03-03 | 1982-05-25 | Goldenberg Milton David | Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers |
| US4348376A (en) | 1980-03-03 | 1982-09-07 | Goldenberg Milton David | Tumor localization and therapy with labeled anti-CEA antibody |
| US4361544A (en) | 1980-03-03 | 1982-11-30 | Goldenberg Milton David | Tumor localization and therapy with labeled antibodies specific to intracellular tumor-associated markers |
| US4444744A (en) | 1980-03-03 | 1984-04-24 | Goldenberg Milton David | Tumor localization and therapy with labeled antibodies to cell surface antigens |
| US4468457A (en) | 1981-06-01 | 1984-08-28 | David M. Goldenberg | Method for producing a CSAp tryptic peptide and anti-CSAp antibodies |
| US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
| US4624846A (en) | 1983-07-29 | 1986-11-25 | Immunomedics, Inc. | Method for enhancing target specificity of antibody localization and clearance of non-target diagnostic and therapeutic principles |
| US4818709A (en) | 1983-01-21 | 1989-04-04 | Primus Frederick J | CEA-family antigens, Anti-CEA antibodies and CEA immunoassay |
| US4925648A (en) | 1988-07-29 | 1990-05-15 | Immunomedics, Inc. | Detection and treatment of infectious and inflammatory lesions |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| WO1991011465A1 (en) | 1990-01-26 | 1991-08-08 | Immunomedics, Inc. | Vaccines against cancer and infectious diseases |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| US5270163A (en) | 1990-06-11 | 1993-12-14 | University Research Corporation | Methods for identifying nucleic acid ligands |
| US5332567A (en) | 1989-08-24 | 1994-07-26 | Immunomedics | Detection and treatment of infections with immunoconjugates |
| US5439665A (en) | 1988-07-29 | 1995-08-08 | Immunomedics | Detection and treatment of infectious and inflammatory lesions |
| US5443953A (en) | 1993-12-08 | 1995-08-22 | Immunomedics, Inc. | Preparation and use of immunoconjugates |
| US5475096A (en) | 1990-06-11 | 1995-12-12 | University Research Corporation | Nucleic acid ligands |
| US5492807A (en) | 1993-11-19 | 1996-02-20 | Santi; Daniel V. | Method of obtaining diagnostic reagents, assays and therapeutics based on clinical manifestations of a disease |
| US5525338A (en) | 1992-08-21 | 1996-06-11 | Immunomedics, Inc. | Detection and therapy of lesions with biotin/avidin conjugates |
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| US5582981A (en) | 1991-08-14 | 1996-12-10 | Gilead Sciences, Inc. | Method for identifying an oligonucleotide aptamer specific for a target |
| US5587459A (en) | 1994-08-19 | 1996-12-24 | Regents Of The University Of Minnesota | Immunoconjugates comprising tyrosine kinase inhibitors |
| US5595877A (en) | 1990-06-11 | 1997-01-21 | Nexstar Pharmaceuticals, Inc. | Methods of producing nucleic acid ligands |
| US5601825A (en) | 1988-04-01 | 1997-02-11 | Immunomedics, Inc. | Therapeutic conjugates of toxins and drugs |
| US5609846A (en) | 1988-03-29 | 1997-03-11 | Immunomedics, Inc. | Radiolabelled antibody cytotoxic therapy of infectious or autoimmune disease |
| US5612016A (en) | 1988-04-01 | 1997-03-18 | Immunomedics, Inc. | Conjugates of antibodies and bifunctional ligands |
| US5622699A (en) | 1995-09-11 | 1997-04-22 | La Jolla Cancer Research Foundation | Method of identifying molecules that home to a selected organ in vivo |
| US5637459A (en) | 1990-06-11 | 1997-06-10 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: chimeric selex |
| US5677136A (en) | 1994-11-14 | 1997-10-14 | Systemix, Inc. | Methods of obtaining compositions enriched for hematopoietic stem cells, compositions derived therefrom and methods of use thereof |
| US5686072A (en) | 1992-06-17 | 1997-11-11 | Board Of Regents, The University Of Texas | Epitope-specific monoclonal antibodies and immunotoxins and uses thereof |
| US5705610A (en) | 1990-05-15 | 1998-01-06 | Chiron Corporation | Method and apparatus for biopolymer synthesis |
| US5716595A (en) | 1992-05-06 | 1998-02-10 | Immunomedics, Inc. | Intraperative, intravascular and endoscopic tumor and lesion detection and therapy with monovalent antibody fragments |
| US5736119A (en) | 1993-05-17 | 1998-04-07 | Immunomedics, Inc. | Detection and therapy of lesions with biotin/avidin-metal chelating protein conjugates |
| US5776456A (en) | 1992-11-13 | 1998-07-07 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
| US5789554A (en) | 1994-08-12 | 1998-08-04 | Immunomedics, Inc. | Immunoconjugates and humanized antibodies specific for B-cell lymphoma and leukemia cells |
| US5798229A (en) | 1993-08-02 | 1998-08-25 | Merck Patent Gesellschaft Mit Beschrankter Haftung | Bispecific molecules recognizing lymphocyte antigen CD2 and tumor antigens |
| US5814440A (en) | 1995-06-07 | 1998-09-29 | Systemix, Inc. | Methods of obtaining compositions enriched for hematopoietic stem cells, antibodies for use therein, compositions derived therefrom and methods of use thereof |
| US5831034A (en) | 1987-11-13 | 1998-11-03 | Hermann Katinger | Human monoclonal anti-HIV-I-antibodies |
| US5874540A (en) | 1994-10-05 | 1999-02-23 | Immunomedics, Inc. | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
| US5911989A (en) | 1995-04-19 | 1999-06-15 | Polynum Scientific Immunbiologische Forschung Gmbh | HIV-vaccines |
| US6068829A (en) | 1995-09-11 | 2000-05-30 | The Burnham Institute | Method of identifying molecules that home to a selected organ in vivo |
| US6077499A (en) | 1996-05-03 | 2000-06-20 | Immunomedics, Inc. | Targeted combination immunotherapy of cancer |
| US6083477A (en) | 1996-10-17 | 2000-07-04 | Immunomedics, Inc. | Non-antigenic toxin-conjugate and fusion protein of internalizing receptor system |
| US6096289A (en) | 1992-05-06 | 2000-08-01 | Immunomedics, Inc. | Intraoperative, intravascular, and endoscopic tumor and lesion detection, biopsy and therapy |
| US6107090A (en) | 1996-05-06 | 2000-08-22 | Cornell Research Foundation, Inc. | Treatment and diagnosis of prostate cancer with antibodies to extracellur PSMA domains |
| US6120768A (en) | 1993-05-17 | 2000-09-19 | Immunomedics, Inc. | Dota-biotin derivatives |
| US6120767A (en) | 1986-10-27 | 2000-09-19 | Pharmaceutical Royalties, L.L.C. | Chimeric antibody with specificity to human B cell surface antigen |
| US6129914A (en) | 1992-03-27 | 2000-10-10 | Protein Design Labs, Inc. | Bispecific antibody effective to treat B-cell lymphoma and cell line |
| US6183744B1 (en) | 1997-03-24 | 2001-02-06 | Immunomedics, Inc. | Immunotherapy of B-cell malignancies using anti-CD22 antibodies |
| US6254868B1 (en) | 1996-03-20 | 2001-07-03 | Immunomedics, Inc. | Glycosylated humanized B-cell specific antibodies |
| US6306393B1 (en) | 1997-03-24 | 2001-10-23 | Immunomedics, Inc. | Immunotherapy of B-cell malignancies using anti-CD22 antibodies |
| US6331175B1 (en) | 1985-07-05 | 2001-12-18 | Immunomedics, Inc. | Method and kit for imaging and treating organs and tissues |
| US6340571B1 (en) | 1996-03-21 | 2002-01-22 | Bio Merieux | Antibodies specific for Staphylococcus aureus, and use thereof |
| US6340459B1 (en) | 1995-12-01 | 2002-01-22 | The Trustees Of Columbia University In The City Of New York | Therapeutic applications for the anti-T-BAM (CD40-L) monoclonal antibody 5C8 in the treatment of reperfusion injury in non-transplant recipients |
| US6344198B1 (en) | 1995-01-20 | 2002-02-05 | Human Genome Sciences, Inc. | Human prostatic specific reductase |
| US6346246B1 (en) | 1994-01-25 | 2002-02-12 | Human Genome Sciences, Inc. | Antibodies that bind human haemopoietic maturation factor |
| US6355444B1 (en) | 1992-01-29 | 2002-03-12 | Viventia Biotech Inc. | Carcinoma associated antigen (SK1) monoclonal antibodies against SK1, methods of producing these antibodies and uses therefor |
| US6355244B1 (en) | 1997-11-17 | 2002-03-12 | University Of Kentucky Research Foundation | Methods and compositions for the treatment of psoriasis |
| US6355481B1 (en) | 1999-06-18 | 2002-03-12 | Emory University | Hybridoma cell line and monoclonal antibody for huntingtin protein |
| US6355245B1 (en) | 1994-05-02 | 2002-03-12 | Alexion Pharmaceuticals, Inc. | C5-specific antibodies for the treatment of inflammatory diseases |
| US6359126B1 (en) | 1992-04-03 | 2002-03-19 | Genentech, Inc. | Antibodies to αvβ3 integrin |
| US6372215B1 (en) | 1997-03-03 | 2002-04-16 | Bristol-Myers Squibb Company | Monoclonal antibodies to human CD6 |
| US6376654B1 (en) | 1999-08-13 | 2002-04-23 | Molecular Discoveries, Llc | Myeloma cell and ovarian cancer cell surface glycoproteins, antibodies thereto, and uses thereof |
| US6383484B1 (en) | 1998-12-21 | 2002-05-07 | Ludwig Institute For Cancer Research | Antibodies to truncated VEGF-D and thereof |
| US6383759B1 (en) | 1998-05-04 | 2002-05-07 | Gerald P. Murphy Cancer Foundation | Non-invasive method to detect prostate cancer |
| US6395276B1 (en) | 1997-05-02 | 2002-05-28 | Immunomedics, Inc. | Immunotoxins directed against malignant cells |
| US6395274B1 (en) | 1993-11-19 | 2002-05-28 | Baylor College Of Medicine | Monoclonal antibodies specific for human interleukin-5 |
| US6403770B1 (en) | 1996-10-25 | 2002-06-11 | Human Genome Sciences, Inc. | Antibodies to neutrokine-alpha |
| US6403091B1 (en) | 1991-11-15 | 2002-06-11 | The Trustees Of Columbia University In The City Of New York | Methods for inhibiting the rejection of a transplant organ in a subject with 5C8-specific antibodies |
| US6406694B1 (en) | 1998-07-23 | 2002-06-18 | Millennium Pharmaceuticals, Inc. | Anti-CCR2 antibodies |
| US6413726B1 (en) | 1996-03-19 | 2002-07-02 | Human Genome Sciences, Inc. | Antibodies that specifically bind Cytostatin III |
| US6419928B1 (en) | 1988-12-22 | 2002-07-16 | Genzyme Corporation | Monoclonal antibodies to transforming growth factor-beta and methods of use |
| US6432402B1 (en) | 1989-05-25 | 2002-08-13 | Sloan-Kettering Institute For Cancer Research | Anti-idiotypic antibody which induces an immune response against a glycosphingolipid and use thereof |
| US6432404B1 (en) | 1993-12-23 | 2002-08-13 | Icos Corporation | Methods of inhibiting locomotor damage following spinal cord injury with α D-specific antibodies |
| US6441143B1 (en) | 1995-04-13 | 2002-08-27 | Amgen Inc | Methods and compositions for determining HER-2/neu expression |
| US6444206B1 (en) | 1993-05-28 | 2002-09-03 | The Scripps Research Institute | Methods and compositions for inhibiting CD14 mediated cell activation |
| US6455040B1 (en) | 1997-01-14 | 2002-09-24 | Human Genome Sciences, Inc. | Tumor necrosis factor receptor 5 |
| US6458933B1 (en) | 1998-05-20 | 2002-10-01 | Immunomedics, Inc. | Therapeutic using a bispecific antibody |
| US6458356B1 (en) | 1995-12-05 | 2002-10-01 | Amgen Inc. | Antibody-induced apoptosis |
| US6461823B1 (en) | 1997-01-28 | 2002-10-08 | Human Genome Sciences, Inc. | Death domain containing receptor-4 antibodies |
| US6465173B2 (en) | 1992-03-09 | 2002-10-15 | Immune Research, Ltd. | Anti-idiotypic antibody and its use in diagnosis and therapy in HIV-related disease |
| US6468529B1 (en) | 1995-06-02 | 2002-10-22 | Genentech, Inc. | Hepatocyte growth factor receptor antagonists and uses thereof |
| US6468531B1 (en) | 1993-09-09 | 2002-10-22 | Duke University | Method of promoting cellular function |
| US6479247B1 (en) | 1996-10-09 | 2002-11-12 | The Corporation Of The Trustees Of The Order Of The Sisters Of Mercy In Queensland | Dendritic cell-specific antibodies |
| US6482598B2 (en) | 1996-11-13 | 2002-11-19 | Morphogenesis, Inc. | Antibody recognizing a small subset of human hematopoietic cells |
| US6482408B2 (en) | 1995-06-05 | 2002-11-19 | Human Genome Sciences, Inc. | Fibroblast growth factor 15 antibodies |
| US6488930B1 (en) | 1999-01-15 | 2002-12-03 | Millennium Pharmaceuticals, Inc. | Anti-CCR4 antibodies and methods of use therefor |
| US6511665B1 (en) | 1987-11-25 | 2003-01-28 | Immunex Corporation | Antibodies to interleukin-1 receptors |
| US6518404B1 (en) | 1994-10-17 | 2003-02-11 | Human Genome Sciences, Inc. | Human endothelin-bombesin receptor antibodies |
| US6521227B1 (en) | 1999-11-18 | 2003-02-18 | Peter L. Hudson | Polynucleotides encoding prostatic growth factor and process for producing prostatic growth factor polypeptides |
| US6528269B1 (en) | 1998-06-22 | 2003-03-04 | Case Western Reserve University | Immunological agents specific for prion protein (PRP) |
| US6528625B1 (en) | 1996-10-28 | 2003-03-04 | Millennium Pharmaceuticals, Inc. | Anti-CCR5 antibodies and kits comprising same |
| US6534058B2 (en) | 2000-10-10 | 2003-03-18 | Tanox, Inc. | Anti-C5 monoclonal antibodies |
| US6544749B1 (en) | 1992-05-08 | 2003-04-08 | Genentech, Inc. | Antibodies to leukemia inhibitory factor and their use in immunoassays |
| US6545130B2 (en) | 1997-06-04 | 2003-04-08 | Albert Einstein College Of Medicine Of Yeshiva University | Monoclonal antibodies to mycobacterium tuberculosis and a modified ELISA assay |
| US6562618B1 (en) | 1997-12-25 | 2003-05-13 | Japan Tobacco, Inc. | Monoclonal antibody against connective tissue growth factor and medicinal uses thereof |
| US6566076B1 (en) | 1998-04-23 | 2003-05-20 | The Regents Of The University Of California | Detection and diagnosis of conditions associated with lung injury |
| US6572856B1 (en) | 1998-09-10 | 2003-06-03 | The University Of Virginia Patent Foundation | Methods for the prevention and treatment of cancer using anti-C3b(i) antibodies |
| US6576745B1 (en) | 1996-04-03 | 2003-06-10 | Human Genome Sciences, Inc. | Human cystatin F antibodies |
| US6596852B2 (en) | 1994-07-08 | 2003-07-22 | Immunex Corporation | Antibodies that bind the cytokine designated LERK-5 |
| US6605441B1 (en) | 1995-06-05 | 2003-08-12 | Human Genome Sciences, Inc. | Antibodies against fibroblast growth factor 11 |
| US6605279B2 (en) | 1993-07-26 | 2003-08-12 | Genetics Institute, Inc. | Therapeutic compositions for inhibiting the interactions of B7-1 and B7-2 with their natural ligands |
| US6610833B1 (en) | 1997-11-24 | 2003-08-26 | The Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
| US6630144B1 (en) | 1999-08-30 | 2003-10-07 | The United States Of America As Represented By The Secretary Of The Army | Monoclonal antibodies to Ebola glycoprotein |
| US6653104B2 (en) | 1996-10-17 | 2003-11-25 | Immunomedics, Inc. | Immunotoxins, comprising an internalizing antibody, directed against malignant and normal cells |
| US6652852B1 (en) | 1986-10-27 | 2003-11-25 | Royalty Pharma Finance Trust | Chimeric antibody with specificity to human B cell surface antigen |
| US20030219433A1 (en) | 2002-02-14 | 2003-11-27 | Immunomedics, Inc. | Anti-CD20 antibodies and fusion proteins thereof and methods of use |
| US20040001825A1 (en) | 2002-03-01 | 2004-01-01 | Immunomedics, Inc. | RS7 antibodies |
| US6673344B1 (en) | 1994-08-23 | 2004-01-06 | Human Genome Sciences, Inc. | Antibodies to human CKβ-10/MCP-4 |
| US6682736B1 (en) | 1998-12-23 | 2004-01-27 | Abgenix, Inc. | Human monoclonal antibodies to CTLA-4 |
| US6682737B1 (en) | 1996-03-29 | 2004-01-27 | North Carolina State University | Anti-cryptosporidium parvum preparations |
| US6689355B2 (en) | 2000-05-11 | 2004-02-10 | Altarex Corp. | Therapeutic method and composition utilizing antigen-antibody complexation and presentation by dendritic cells |
| US6689607B2 (en) | 1997-10-21 | 2004-02-10 | Human Genome Sciences, Inc. | Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2 |
| US6689362B1 (en) | 1997-06-03 | 2004-02-10 | Regents Of The University Of Minnesota | Method for treating T-lineage leukemias and lymphomas using a CD7-specific monoclonal antibody (TXU-7) linked to the pokeweed antiviral protein (PAP) |
| US6693176B1 (en) | 1999-07-23 | 2004-02-17 | University Of Massachusetts | Antitumor antibodies, proteins, and uses thereof |
| US6692908B1 (en) | 1998-11-05 | 2004-02-17 | Stanford University | Prevention and treatment of HCV infection employing antibodies that inhibit the interaction of HCV virions with their receptor |
| US6709653B1 (en) | 1994-09-16 | 2004-03-23 | Human Genome Sciences, Inc. | Antibodies specific for human inositol monophosphatase H1 |
| US6716966B1 (en) | 1999-08-18 | 2004-04-06 | Altarex Corp. | Therapeutic binding agents against MUC-1 antigen and methods for their use |
| US6720155B1 (en) | 1998-08-13 | 2004-04-13 | Angel Lopez | Monoclonal antibody inhibitor of GM-CSF, IL-3, IL-5 and other cytokines, and uses thereof |
| US6730300B2 (en) | 1996-03-20 | 2004-05-04 | Immunomedics, Inc. | Humanization of an anti-carcinoembryonic antigen anti-idiotype antibody and use as a tumor vaccine and for targeting applications |
| US6733981B2 (en) | 1994-11-01 | 2004-05-11 | Human Genome Sciences, Inc. | Antibodies to interleukin-1 β converting enzyme like apoptosis protease-3 and 4 |
| US6743898B2 (en) | 2001-03-15 | 2004-06-01 | Ochsner Clinic Foundation | Monoclonal antibodies that suppress B cell growth and/or differentiation |
| US6764688B2 (en) | 1996-09-03 | 2004-07-20 | Kaneka Corporation | Method for inducing immunosuppressive cells and a culture device to be used therefor |
| US6764679B2 (en) | 1997-09-18 | 2004-07-20 | Genentech, Inc. | Antibodies to DcR3 Polypeptide, a TNFR Homolog |
| US6764681B2 (en) | 1991-10-07 | 2004-07-20 | Biogen, Inc. | Method of prophylaxis or treatment of antigen presenting cell driven skin conditions using inhibitors of the CD2/LFA-3 interaction |
| US6767711B2 (en) | 1995-06-05 | 2004-07-27 | Cornell Research Foundation, Inc. | Treatment and diagnosis of prostate cancer |
| US6770450B1 (en) | 1996-05-06 | 2004-08-03 | Cornell Research Foundation, Inc. | Treatment and diagnosis of cancer |
| US6783758B2 (en) | 1999-11-08 | 2004-08-31 | Rhode Island Hospital | Diagnosis and treatment of malignant neoplasms |
| US20040175756A1 (en) | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
| US20040202666A1 (en) | 2003-01-24 | 2004-10-14 | Immunomedics, Inc. | Anti-cancer anthracycline drug-antibody conjugates |
| US20040219156A1 (en) | 2002-12-31 | 2004-11-04 | Immunomedics, Inc. | Immunotherapy of B cell malignancies and autoimmune diseases using unconjugated antibodies and conjugated antibodies and antibody combinations and fusion proteins |
| US20040219203A1 (en) | 1999-05-10 | 2004-11-04 | Immunomedics, Inc. | Anti-CD74 immunoconjugates and methods |
| US20040235065A1 (en) | 2002-08-01 | 2004-11-25 | Immunomedics, Inc. | Alpha-fetoprotein Immu31 antibodies and fusion proteins and methods of use thereof |
| US6824778B2 (en) | 2001-04-23 | 2004-11-30 | The United States Of America As Represented By The Secretary Of The Army | Prophylactic and therapeutic monoclonal antibodies |
| US6824780B1 (en) | 1999-10-29 | 2004-11-30 | Genentech, Inc. | Anti-tumor antibody compositions and methods of use |
| US6835549B2 (en) | 2000-02-24 | 2004-12-28 | University Of Medicine & Dentistry Of New Jersey | Immunoassay method for the diagnosis of gastric intestinal metaplasia associated with gastric carcinoma |
| US6835370B2 (en) | 1999-11-08 | 2004-12-28 | Rhode Island Hospital | Diagnosis and treatment of malignant neoplasms |
| US20050002945A1 (en) | 1998-06-22 | 2005-01-06 | Immunomedics, Inc. | Therapeutic and diagnostic conjugates for use with multispecific antibodies |
| US20050014207A1 (en) | 2002-06-14 | 2005-01-20 | Immunomedics, Inc. | Monoclonal antibody hPAM4 |
| US20050025709A1 (en) | 2003-06-13 | 2005-02-03 | Immunomedics, Inc. | D-amino acid peptides |
| US6861511B1 (en) | 1986-06-04 | 2005-03-01 | Bayer Corporation | Detection and quantification of neu related proteins in the biological fluids of humans |
| US6861227B2 (en) | 1998-03-19 | 2005-03-01 | Human Genome Sciences, Inc. | Antibodies to cytokine receptor common gamma chain like |
| US6861226B2 (en) | 1996-03-21 | 2005-03-01 | Human Genome Sciences, Inc. | Human endometrial specific steroid-binding factor I, II and III |
| US20050048512A1 (en) | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US6864062B2 (en) | 1999-06-16 | 2005-03-08 | Molecular Geriatrics Corporation | Purified antigen for Alzheimer's disease and methods of obtaining and using same |
| US20050053973A1 (en) | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
| US6867006B2 (en) | 1994-05-16 | 2005-03-15 | Human Genome Sciences, Inc. | Antibodies to human chemotactic protein |
| US6872568B1 (en) | 1997-03-17 | 2005-03-29 | Human Genome Sciences, Inc. | Death domain containing receptor 5 antibodies |
| US6875580B2 (en) | 2003-01-28 | 2005-04-05 | Schering Corporation | Antibodies specific for plasmacytoid dendritic cells |
| US6878812B2 (en) | 1997-01-21 | 2005-04-12 | Human Genome Science, Inc. | Metalloproteinases |
| US20050079184A1 (en) | 2003-08-08 | 2005-04-14 | Immunomedics, Inc. | Bispecific antibodies for inducing apoptosis of tumor and diseased cells |
| US6881405B2 (en) | 1998-06-15 | 2005-04-19 | Altarex Medical Corp. | Reagents and methods for inducing an immune response to prostate specific antigen |
| US6884594B2 (en) | 1996-03-26 | 2005-04-26 | Human Genome Sciences, Inc. | Antibodies to growth factor HTTER36 |
| US20050089932A1 (en) | 2001-04-26 | 2005-04-28 | Avidia Research Institute | Novel proteins with targeted binding |
| US6887468B1 (en) | 1999-04-28 | 2005-05-03 | Board Of Regents, The University Of Texas System | Antibody kits for selectively inhibiting VEGF |
| US6887466B2 (en) | 1988-11-23 | 2005-05-03 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6899864B2 (en) | 2001-03-30 | 2005-05-31 | Immunomedics, Inc. | Morpholino imaging and therapy |
| US6899879B2 (en) | 1992-07-09 | 2005-05-31 | Chiron Corporation | Method for treating an IgE-mediated disease in a patient using anti-CD40 monoclonal antibodies |
| US6919433B2 (en) | 1997-03-14 | 2005-07-19 | Human Genome Sciences, Inc. | Antibodies to protein HPMBQ91 |
| US6919078B2 (en) | 1997-06-11 | 2005-07-19 | Human Genome Sciences, Inc. | Antibodies to human tumor necrosis factor receptor TR9 |
| US6921533B2 (en) | 1989-06-02 | 2005-07-26 | The Johns Hopkins University School Of Medicine | Method of using monoclonal antibodies against leukocyte adhesion receptor β-chain |
| US6921645B2 (en) | 1994-08-23 | 2005-07-26 | Human Genome Sciences, Inc. | Antibodies to chemokine β-4 |
| US20050169926A1 (en) | 1998-06-22 | 2005-08-04 | Immunomedics, Inc. | Chimeric, human and humanized anti-CSAP monoclonal antibodies |
| US6926893B1 (en) | 1994-07-06 | 2005-08-09 | Immunomedics, Inc. | Multi-stage cascade boosting vaccine |
| US6939547B2 (en) | 2000-07-31 | 2005-09-06 | The United States Of America As Represented By The Department Of Health And Human Services | Specific binding agents for KSHV vIL-6 that neutralize a biological activity |
| US6946129B1 (en) | 1999-06-08 | 2005-09-20 | Seattle Genetics, Inc. | Recombinant anti-CD40 antibody and uses thereof |
| US6949244B1 (en) | 1995-12-20 | 2005-09-27 | The Board Of Trustees Of The University Of Kentucky | Murine monoclonal anti-idiotype antibody 11D10 and methods of use thereof |
| US6951924B2 (en) | 1997-03-14 | 2005-10-04 | Human Genome Sciences, Inc. | Antibodies against secreted protein HTEBYII |
| US20050221384A1 (en) | 2001-04-26 | 2005-10-06 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US6956107B2 (en) | 1998-02-20 | 2005-10-18 | Tanox, Inc. | Inhibitors of complement activation |
| US6962981B1 (en) | 1996-03-25 | 2005-11-08 | Medarex, Inc. | Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen |
| US6962813B2 (en) | 2001-05-21 | 2005-11-08 | The Brigham And Women's Hospital, Inc. | P. aeruginosa mucoid exopolysaccharide specific binding peptides |
| US6962702B2 (en) | 1998-06-22 | 2005-11-08 | Immunomedics Inc. | Production and use of novel peptide-based agents for use with bi-specific antibodies |
| US6964854B1 (en) | 1999-07-13 | 2005-11-15 | Science & Technology Corporation | Compositions and methods useful for the diagnosis and treatment of heparin induced thrombocytopenia/thrombosis |
| US6965018B2 (en) | 2000-06-06 | 2005-11-15 | Bristol-Myers Squibb Company | Antibodies directed to B7-related polypeptide, BSL-2 |
| US6974863B2 (en) | 1988-11-07 | 2005-12-13 | Indiana University Research And Technology Corporation | Antibody for 4-1BB |
| US20060014245A1 (en) | 2004-02-13 | 2006-01-19 | Immunomedics, Inc. | Fusion proteins containing recombinant cytotoxic RNAses |
| US6989241B2 (en) | 2000-10-02 | 2006-01-24 | Oklahoma Medical Research Foundation | Assay for rapid detection of human activated protein C and highly specific monoclonal antibody therefor |
| US6994852B1 (en) | 1999-11-12 | 2006-02-07 | Temple University-Of The Commonwealth System Of Higher Education | Inhibition of angiogenesis by antibodies against high molecular weight kininogen domain 5 |
| US6994976B1 (en) | 1999-11-19 | 2006-02-07 | Tittle Thomas V | Tr3-specific binding agents and methods for their use |
| US6998468B2 (en) | 2000-03-23 | 2006-02-14 | Tanox, Inc. | Anti-C2/C2a inhibitors of complement activation |
| US20060034759A1 (en) | 1998-06-22 | 2006-02-16 | Immunomedics, Inc. | Production and use of novel peptide-based agents with bispecific antibodies |
| US7001598B2 (en) | 1995-01-26 | 2006-02-21 | Biogen Idec Ma Inc. | Anti-lymphotoxin-beta receptor antibodies as anti-tumor agents |
| US7012133B1 (en) | 1995-01-19 | 2006-03-14 | Children's Medical Center Corp. | Antibodies to C-C chemokine Receptor 3 Protein |
| US7037498B2 (en) | 2001-01-05 | 2006-05-02 | Abgenix, Inc. | Antibodies to insulin-like growth factor I receptor |
| US7038018B2 (en) | 1999-11-24 | 2006-05-02 | Millennium Pharmaceuticals, Inc. | Antibodies and ligands for “Bonzo” chemokine receptor |
| US7041293B1 (en) | 1990-04-03 | 2006-05-09 | Genentech, Inc. | HIV env antibodies |
| US7041802B2 (en) | 1998-12-23 | 2006-05-09 | Human Genome Sciences, Inc. | Peptidoglycan recognition proteins |
| US7041803B2 (en) | 1997-01-21 | 2006-05-09 | Human Genome Sciences, Inc. | Galectin 11 |
| US7045132B2 (en) | 1991-11-14 | 2006-05-16 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, C/O Centers For Disease Control And Prevention | Streptococcus pneumoniae 37-kDa surface adhesin a protein |
| US7049060B2 (en) | 2001-11-05 | 2006-05-23 | Ortho-Clinical Diagnostics, Inc. | HCV anti-core monoclonal antibodies |
| US7060802B1 (en) | 2000-09-18 | 2006-06-13 | The Trustees Of Columbia University In The City Of New York | Tumor-associated marker |
| US7074403B1 (en) | 1999-06-09 | 2006-07-11 | Immunomedics, Inc. | Immunotherapy of autoimmune disorders using antibodies which target B-cells |
| US20060193865A1 (en) | 2002-12-13 | 2006-08-31 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
| US7109304B2 (en) | 2003-07-31 | 2006-09-19 | Immunomedics, Inc. | Humanized anti-CD19 antibodies |
| US20060210475A1 (en) | 2005-03-03 | 2006-09-21 | Goldenberg David M | Humanized L243 antibodies |
| US7138496B2 (en) | 2002-02-08 | 2006-11-21 | Genetastix Corporation | Human monoclonal antibodies against human CXCR4 |
| US20070087001A1 (en) | 2005-10-19 | 2007-04-19 | Center For Molecular Medicine And Immunology | Inhibition of placenta growth factor (PLGF) mediated metastasis and/or angiogenesis |
| US7217797B2 (en) | 2002-10-15 | 2007-05-15 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| US7238786B2 (en) | 2002-06-14 | 2007-07-03 | Immunomedics, Inc. | Monoclonal antibody cPAM4 |
| US7251164B2 (en) | 2004-11-10 | 2007-07-31 | Innovative Silicon S.A. | Circuitry for and method of improving statistical distribution of integrated circuits |
| US7256004B2 (en) | 1998-10-31 | 2007-08-14 | United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Variants of humanized anti-carcinoma monoclonal antibody CC49 |
| WO2007123995A2 (en) * | 2006-04-19 | 2007-11-01 | Bionumerik Pharmaceuticals, Inc. | Camptothecin-analog with a novel, “flipped” lactone-stable, e-ring and methods for making and using same |
| US7312318B2 (en) | 2002-03-01 | 2007-12-25 | Immunomedics, Inc. | Internalizing anti-CD74 antibodies and methods of use |
| US7387773B2 (en) | 2001-08-07 | 2008-06-17 | Massey University | Vaccine |
| US7521056B2 (en) | 2005-04-06 | 2009-04-21 | Ibc Pharmaceuticals, Inc. | Stably tethered structures of defined compositions with multiple functions or binding specificities |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| US7527787B2 (en) | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
| US7534866B2 (en) | 2005-10-19 | 2009-05-19 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
| US7541440B2 (en) | 2002-09-30 | 2009-06-02 | Immunomedics, Inc. | Chimeric, human and humanized anti-granulocyte antibodies and methods of use |
| US7550143B2 (en) | 2005-04-06 | 2009-06-23 | Ibc Pharmaceuticals, Inc. | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
| US7585491B2 (en) | 2002-12-13 | 2009-09-08 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
| WO2009130575A2 (en) | 2008-04-22 | 2009-10-29 | Universita' Degli Studi Di Verona | Isolated monoclonal antibody or fragment thereof binding prostate specific membrane antigen, conjugates and uses thereof |
| US7666400B2 (en) | 2005-04-06 | 2010-02-23 | Ibc Pharmaceuticals, Inc. | PEGylation by the dock and lock (DNL) technique |
| US7901680B2 (en) | 2005-10-19 | 2011-03-08 | Ibc Pharmaceuticals, Inc. | Dock-and-lock (DNL) vaccines for cancer therapy |
| US7902338B2 (en) | 2003-07-31 | 2011-03-08 | Immunomedics, Inc. | Anti-CD19 antibodies |
| US7906118B2 (en) | 2005-04-06 | 2011-03-15 | Ibc Pharmaceuticals, Inc. | Modular method to prepare tetrameric cytokines with improved pharmacokinetics by the dock-and-lock (DNL) technology |
| US20110160159A1 (en) * | 2009-09-15 | 2011-06-30 | John Ryan | Treatment of cancer |
| US8003111B2 (en) | 2005-04-06 | 2011-08-23 | Ibc Pharmaceuticals, Inc. | Dimeric alpha interferon pegylated site-specifically shows enhanced and prolonged efficacy in vivo |
| US8034352B2 (en) | 2005-04-06 | 2011-10-11 | Ibc Pharmaceuticals, Inc. | Tetrameric cytokines with improved biological activity |
| US20110305631A1 (en) * | 2002-12-13 | 2011-12-15 | Immunomedics, Inc. | Camptothecin Conjugates of Anti-CD22 Antibodies for Treatment of B Cell Diseases |
| US20120082617A1 (en) * | 2002-12-13 | 2012-04-05 | Immunomedics, Inc. | Immunoconjugates with an Intracellularly-Cleavable Linkage |
| US8267865B2 (en) | 2007-02-16 | 2012-09-18 | University Of Rochester | Sonoelastographic shear velocity imaging using crawling wave excitation |
| US8287864B2 (en) | 2002-02-14 | 2012-10-16 | Immunomedics, Inc. | Structural variants of antibodies for improved therapeutic characteristics |
Family Cites Families (97)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB1541435A (en) | 1975-02-04 | 1979-02-28 | Searle & Co | Immunological materials |
| US4200690A (en) | 1976-12-16 | 1980-04-29 | Millipore Corporation | Immunoassay with membrane immobilized antibody |
| US5204095A (en) | 1980-04-09 | 1993-04-20 | National Research Development Corporation | Monoclonal antibodies against hepatitis B virus |
| US4359457A (en) | 1980-09-30 | 1982-11-16 | Neville Jr David M | Anti Thy 1.2 monoclonal antibody-ricin hybrid utilized as a tumor suppressant |
| US4916213A (en) | 1983-02-22 | 1990-04-10 | Xoma Corporation | Ribosomal inhibiting protein-immunoglobulin conjugates with specificity for tumor cell surface antigens, and mixtures thereof |
| US4925922A (en) | 1983-02-22 | 1990-05-15 | Xoma Corporation | Potentiation of cytotoxic conjugates |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5672347A (en) | 1984-07-05 | 1997-09-30 | Genentech, Inc. | Tumor necrosis factor antagonists and their use |
| US4824659A (en) | 1985-06-07 | 1989-04-25 | Immunomedics, Inc. | Antibody conjugates |
| US4918163A (en) | 1985-09-27 | 1990-04-17 | Pfizer Inc. | Monoclonal antibodies specific for lipid-A determinants of gram negative bacteria |
| US5618920A (en) | 1985-11-01 | 1997-04-08 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US5057313A (en) | 1986-02-25 | 1991-10-15 | The Center For Molecular Medicine And Immunology | Diagnostic and therapeutic antibody conjugates |
| US4699784A (en) | 1986-02-25 | 1987-10-13 | Center For Molecular Medicine & Immunology | Tumoricidal methotrexate-antibody conjugate |
| US4997913A (en) | 1986-06-30 | 1991-03-05 | Oncogen | pH-sensitive immunoconjugates and methods for their use in tumor therapy |
| US4704692A (en) | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| CA1320905C (en) | 1986-11-06 | 1993-08-03 | Joseph M. Cummins | Treatment of immuno-resistant disease |
| US4932412A (en) | 1986-12-18 | 1990-06-12 | Immunomedics, Inc. | Intraoperative and endoscopic tumor detection and therapy |
| WO1988007553A1 (fr) | 1987-03-26 | 1988-10-06 | Teijin Limited | Procede de preparation d'un complexe d'anticorps |
| US4981979A (en) | 1987-09-10 | 1991-01-01 | Neorx Corporation | Immunoconjugates joined by thioether bonds having reduced toxicity and improved selectivity |
| IL106992A (en) | 1988-02-11 | 1994-06-24 | Bristol Myers Squibb Co | Acylhydrazone derivatives of anthracycline and methods for their preparation |
| US5112954A (en) | 1988-02-26 | 1992-05-12 | Neorx Corporation | Method of enhancing the effect of cytotoxic agents |
| US4861579A (en) | 1988-03-17 | 1989-08-29 | American Cyanamid Company | Suppression of B-lymphocytes in mammals by administration of anti-B-lymphocyte antibodies |
| US5453359A (en) | 1988-06-13 | 1995-09-26 | American Biogenetic Sciences, Inc. | Immunoassay and kit for in vitro detection of soluble DesAABB fibrin polymers |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| GB8903021D0 (en) | 1989-02-10 | 1989-03-30 | Celltech Ltd | Chemical compounds |
| US5134075A (en) | 1989-02-17 | 1992-07-28 | Oncogen Limited Partnership | Monoclonal antibody to novel antigen associated with human tumors |
| US5171665A (en) | 1989-04-17 | 1992-12-15 | Oncogen | Monoclonal antibody to novel antigen associated with human tumors |
| JPH02283294A (ja) | 1989-04-24 | 1990-11-20 | Sumitomo Chem Co Ltd | ヒトモノクローナル抗体 |
| IL97459A0 (en) | 1990-03-09 | 1992-06-21 | Hybritech Inc | Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent |
| AU7566991A (en) | 1990-03-14 | 1991-10-10 | Biomembrane Institute, The | Monoclonal antibody and immunoconjugates for the treatment and detection of b cell disorders |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| GB9020075D0 (en) | 1990-09-14 | 1990-10-24 | Filler Aaron G | Contrast agents for magnetic resonance imaging of axonal transport |
| US5679640A (en) | 1991-02-12 | 1997-10-21 | Cytel Corporation | Immunosuppressant peptides |
| JP3105629B2 (ja) | 1991-04-23 | 2000-11-06 | サングスタット メディカル コーポレイション | 特異的結合ペアのメンバーの細胞活性調節接合体 |
| US5364612A (en) | 1991-05-06 | 1994-11-15 | Immunomedics, Inc. | Detection of cardiovascular lesions |
| MX9204374A (es) | 1991-07-25 | 1993-03-01 | Idec Pharma Corp | Anticuerpo recombinante y metodo para su produccion. |
| US7018809B1 (en) | 1991-09-19 | 2006-03-28 | Genentech, Inc. | Expression of functional antibody fragments |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| US5965132A (en) | 1992-03-05 | 1999-10-12 | Board Of Regents, The University Of Texas System | Methods and compositions for targeting the vasculature of solid tumors |
| MX9401351A (es) | 1993-02-22 | 1994-08-31 | Alza Corp | Composiciones para suministro oral para agentes activos. |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US5484892A (en) | 1993-05-21 | 1996-01-16 | Dana-Farber Cancer Institute, Inc. | Monoclonal antibodies that block ligand binding to the CD22 receptor in mature B cells |
| US5565215A (en) | 1993-07-23 | 1996-10-15 | Massachusettes Institute Of Technology | Biodegradable injectable particles for imaging |
| US5417972A (en) | 1993-08-02 | 1995-05-23 | The Board Of Trustees Of The Leland Stanford Junior University | Method of killing B-cells in a complement independent and an ADCC independent manner using antibodies which specifically bind CDIM |
| WO1995009917A1 (en) | 1993-10-07 | 1995-04-13 | The Regents Of The University Of California | Genetically engineered bispecific tetravalent antibodies |
| US5824701A (en) | 1993-10-20 | 1998-10-20 | Enzon, Inc. | Taxane-based prodrugs |
| US5487892A (en) | 1994-02-24 | 1996-01-30 | American Biogenetic Sciences, Inc. | Method for treating thrombotic disease using a fibrin specific monoclonal antibody |
| US5639725A (en) | 1994-04-26 | 1997-06-17 | Children's Hospital Medical Center Corp. | Angiostatin protein |
| US5686578A (en) | 1994-08-05 | 1997-11-11 | Immunomedics, Inc. | Polyspecific immunoconjugates and antibody composites for targeting the multidrug resistant phenotype |
| US8771694B2 (en) | 1994-08-12 | 2014-07-08 | Immunomedics, Inc. | Immunoconjugates and humanized antibodies specific for B-cell lymphoma and leukemia cells |
| US5798554A (en) | 1995-02-24 | 1998-08-25 | Consorzio Per La Ricerca Sulla Microelettronica Nel Mezzogiorno | MOS-technology power device integrated structure and manufacturing process thereof |
| AUPO591797A0 (en) | 1997-03-27 | 1997-04-24 | Commonwealth Scientific And Industrial Research Organisation | High avidity polyvalent and polyspecific reagents |
| US6441025B2 (en) | 1996-03-12 | 2002-08-27 | Pg-Txl Company, L.P. | Water soluble paclitaxel derivatives |
| JP2000516594A (ja) | 1996-07-26 | 2000-12-12 | スミスクライン・ビーチャム・コーポレイション | 免疫細胞介在全身性疾患の改良された治療法 |
| DE19640207A1 (de) | 1996-09-30 | 1998-04-02 | Bayer Ag | Glycokonjugate von modifizierten Camptothecin-Derivaten (A- oder B-Ring-Verknüpfung) |
| US6056973A (en) | 1996-10-11 | 2000-05-02 | Sequus Pharmaceuticals, Inc. | Therapeutic liposome composition and method of preparation |
| US7122636B1 (en) | 1997-02-21 | 2006-10-17 | Genentech, Inc. | Antibody fragment-polymer conjugates and uses of same |
| US6368596B1 (en) | 1997-07-08 | 2002-04-09 | Board Of Regents, The University Of Texas System | Compositions and methods for homoconjugates of antibodies which induce growth arrest or apoptosis of tumor cells |
| US6165440A (en) | 1997-07-09 | 2000-12-26 | Board Of Regents, The University Of Texas System | Radiation and nanoparticles for enhancement of drug delivery in solid tumors |
| US6051228A (en) | 1998-02-19 | 2000-04-18 | Bristol-Myers Squibb Co. | Antibodies against human CD40 |
| US7112324B1 (en) | 1998-04-21 | 2006-09-26 | Micromet Ag | CD 19×CD3 specific polypeptides and uses thereof |
| US7387779B2 (en) | 1998-06-17 | 2008-06-17 | Beth Israel Deaconess Medical Center | Anti-angiogenic proteins and fragments and methods of use thereof |
| AU1728800A (en) | 1998-11-18 | 2000-06-05 | Genentech Inc. | Antibody variants with higher binding affinity compared to parent antibodies |
| US6201104B1 (en) | 1998-12-04 | 2001-03-13 | Entremed, Inc. | Angiogenesis—inhibiting protein binding peptides and proteins and methods of use |
| US6379698B1 (en) | 1999-04-06 | 2002-04-30 | Isis Pharmaceuticals, Inc. | Fusogenic lipids and vesicles |
| WO2000067796A1 (en) | 1999-05-07 | 2000-11-16 | Genentech, Inc. | Treatment of autoimmune diseases with antagonists which bind to b cell surface markers |
| US8119101B2 (en) | 1999-05-10 | 2012-02-21 | The Ohio State University | Anti-CD74 immunoconjugates and methods of use |
| DE19926154A1 (de) | 1999-06-09 | 2000-12-14 | Ktb Tumorforschungs Gmbh | Verfahren zur Herstellung einer injizierbaren Arzneimittelzubereitung |
| AU775373B2 (en) | 1999-10-01 | 2004-07-29 | Immunogen, Inc. | Compositions and methods for treating cancer using immunoconjugates and chemotherapeutic agents |
| US6530944B2 (en) | 2000-02-08 | 2003-03-11 | Rice University | Optically-active nanoparticles for use in therapeutic and diagnostic methods |
| US20030133972A1 (en) | 2000-10-11 | 2003-07-17 | Targesome, Inc. | Targeted multivalent macromolecules |
| GB0028361D0 (en) | 2000-11-21 | 2001-01-03 | Glaxo Group Ltd | Method of separating extra chromosomal dna from other cellular components |
| US6716821B2 (en) | 2001-12-21 | 2004-04-06 | Immunogen Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
| SE0104462D0 (sv) | 2001-12-29 | 2001-12-29 | Carlbiotech Ltd As | Peptide purifcation (Peptidrening) |
| US8435529B2 (en) * | 2002-06-14 | 2013-05-07 | Immunomedics, Inc. | Combining radioimmunotherapy and antibody-drug conjugates for improved cancer therapy |
| US7591994B2 (en) | 2002-12-13 | 2009-09-22 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
| US8658773B2 (en) | 2011-05-02 | 2014-02-25 | Immunomedics, Inc. | Ultrafiltration concentration of allotype selected antibodies for small-volume administration |
| FR2840532B1 (fr) | 2002-06-11 | 2005-05-06 | Ethypharm Sa | Nanocapsules lipidiques furtives, procede de preparation et utilisation comme vecteur de principes(s) actif(s) |
| CN101972478B (zh) * | 2002-10-08 | 2012-10-31 | 免疫医疗公司 | 抗体治疗 |
| US8551480B2 (en) | 2004-02-13 | 2013-10-08 | Immunomedics, Inc. | Compositions and methods of use of immunotoxins comprising ranpirnase (Rap) show potent cytotoxic activity |
| US7612153B2 (en) | 2004-10-25 | 2009-11-03 | Intezyne Technologies, Inc. | Heterobifunctional poly(ethylene glycol) and uses thereof |
| US8349332B2 (en) | 2005-04-06 | 2013-01-08 | Ibc Pharmaceuticals, Inc. | Multiple signaling pathways induced by hexavalent, monospecific and bispecific antibodies for enhanced toxicity to B-cell lymphomas and other diseases |
| WO2007134037A2 (en) | 2006-05-15 | 2007-11-22 | Immunomedics, Inc. | Methods and compositions for treatment of human immunodeficiency virus infection with conjugated antibodies or antibody fragments |
| AU2009279503B2 (en) * | 2008-08-08 | 2014-05-29 | Immunomedics, Inc. | Anti-pancreatic cancer antibodies |
| CA2750038C (en) | 2009-02-05 | 2016-10-04 | Oncoxx S.R.L. | Anti-trop-2 monoclonal antibodies and uses thereof in the treatment and diagnosis of tumors |
| CA2794499A1 (en) * | 2010-04-01 | 2011-10-06 | Immumomedics, Inc. | Antibody-based depletion of antigen-presenting cells and dendritic cells |
| EA201500220A1 (ru) * | 2010-05-17 | 2015-10-30 | Ливтех, Инк. | Антитело против trop-2 человека, обладающее противоопухолевой активностью in vivo |
| WO2011155579A1 (ja) * | 2010-06-10 | 2011-12-15 | 北海道公立大学法人札幌医科大学 | 抗Trop-2抗体 |
| WO2012131527A1 (en) | 2011-04-01 | 2012-10-04 | Wyeth Llc | Antibody-drug conjugates |
| TWI495644B (zh) | 2011-11-11 | 2015-08-11 | Rinat Neuroscience Corp | 營養層細胞表面抗原(Trop-2)之專一性抗體類及彼等之用途 |
| US9382329B2 (en) | 2012-08-14 | 2016-07-05 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to Trop-2 expressing cells |
| US10413539B2 (en) * | 2012-12-13 | 2019-09-17 | Immunomedics, Inc. | Therapy for metastatic urothelial cancer with the antibody-drug conjugate, sacituzumab govitecan (IMMU-132) |
| US10137196B2 (en) * | 2012-12-13 | 2018-11-27 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
| CN107753954A (zh) * | 2012-12-13 | 2018-03-06 | 免疫医疗公司 | 功效改进且毒性降低的抗体与sn‑38的免疫缀合物的剂量 |
| US9492566B2 (en) * | 2012-12-13 | 2016-11-15 | Immunomedics, Inc. | Antibody-drug conjugates and uses thereof |
| US10195175B2 (en) * | 2015-06-25 | 2019-02-05 | Immunomedics, Inc. | Synergistic effect of anti-Trop-2 antibody-drug conjugate in combination therapy for triple-negative breast cancer when used with microtubule inhibitors or PARP inhibitors |
| US10669338B2 (en) * | 2016-06-17 | 2020-06-02 | Immunomedics, Inc. | Anti-PD-1 checkpoint inhibitor antibodies that block binding of PD-L1 to PD-1 |
-
2013
- 2013-07-23 CN CN201711044526.XA patent/CN107753954A/zh active Pending
- 2013-07-23 EP EP13861658.6A patent/EP2900277B1/en active Active
- 2013-07-23 DK DK13861658.6T patent/DK2900277T3/da active
- 2013-07-23 CA CA2884313A patent/CA2884313C/en active Active
- 2013-07-23 AU AU2013360335A patent/AU2013360335B2/en active Active
- 2013-07-23 KR KR1020227002409A patent/KR102536723B1/ko active Active
- 2013-07-23 BR BR112015013444-0A patent/BR112015013444B1/pt active IP Right Grant
- 2013-07-23 PT PT138616586T patent/PT2900277T/pt unknown
- 2013-07-23 MX MX2015007343A patent/MX342894B/es active IP Right Grant
- 2013-07-23 CN CN202410017229.XA patent/CN118001422A/zh active Pending
- 2013-07-23 HR HRP20220399TT patent/HRP20220399T1/hr unknown
- 2013-07-23 PL PL13861658T patent/PL2900277T3/pl unknown
- 2013-07-23 KR KR1020237017275A patent/KR20230078823A/ko not_active Ceased
- 2013-07-23 KR KR1020157014368A patent/KR102356017B1/ko active Active
- 2013-07-23 CA CA3177936A patent/CA3177936A1/en active Pending
- 2013-07-23 JP JP2015547923A patent/JP6366111B2/ja active Active
- 2013-07-23 US US13/948,732 patent/US9028833B2/en active Active
- 2013-07-23 EP EP22156351.3A patent/EP4035689A1/en active Pending
- 2013-07-23 SI SI201331977T patent/SI2900277T1/sl unknown
- 2013-07-23 ES ES13861658T patent/ES2909746T3/es active Active
- 2013-07-23 WO PCT/US2013/051667 patent/WO2014092804A1/en not_active Ceased
- 2013-07-23 CN CN201380065210.2A patent/CN104837508A/zh active Pending
- 2013-07-23 LT LTEPPCT/US2013/051667T patent/LT2900277T/lt unknown
- 2013-07-23 HU HUE13861658A patent/HUE057977T2/hu unknown
- 2013-07-23 MX MX2016013664A patent/MX379460B/es unknown
- 2013-07-23 CN CN202511504573.2A patent/CN121338027A/zh active Pending
- 2013-07-23 KR KR1020257007068A patent/KR20250034532A/ko active Pending
-
2014
- 2014-03-11 US US14/204,698 patent/US9226973B2/en active Active
- 2014-04-17 HU HUE14828674A patent/HUE053008T2/hu unknown
-
2015
- 2015-03-12 US US14/656,200 patent/US9458242B2/en active Active
- 2015-03-25 US US14/667,982 patent/US9493573B2/en active Active
- 2015-03-26 US US14/669,611 patent/US9475884B2/en active Active
- 2015-03-27 US US14/670,755 patent/US20150196665A1/en not_active Abandoned
- 2015-03-30 US US14/672,495 patent/US20150196653A1/en not_active Abandoned
- 2015-03-30 IL IL238018A patent/IL238018A/en active IP Right Grant
- 2015-03-30 US US14/672,399 patent/US20150196666A1/en not_active Abandoned
- 2015-03-31 US US14/674,682 patent/US20150196654A1/en not_active Abandoned
- 2015-03-31 US US14/674,117 patent/US9522959B2/en active Active
- 2015-04-01 US US14/675,826 patent/US9493574B2/en active Active
- 2015-04-01 US US14/675,805 patent/US20150202319A1/en not_active Abandoned
- 2015-10-16 US US14/885,174 patent/US9499631B2/en active Active
- 2015-12-01 US US14/955,469 patent/US9481732B2/en active Active
-
2016
- 2016-09-30 US US15/281,453 patent/US10130626B2/en active Active
-
2017
- 2017-07-16 IL IL253494A patent/IL253494B/en active IP Right Grant
- 2017-11-08 IL IL255521A patent/IL255521A/en unknown
-
2018
- 2018-02-27 AU AU2018201403A patent/AU2018201403B2/en active Active
- 2018-03-04 IL IL257839A patent/IL257839B/en active IP Right Grant
- 2018-06-28 JP JP2018123539A patent/JP6741349B2/ja active Active
- 2018-09-28 US US16/145,755 patent/US10682347B2/en active Active
-
2019
- 2019-10-17 AU AU2019250192A patent/AU2019250192B2/en active Active
-
2020
- 2020-05-01 US US16/864,245 patent/US11541047B2/en active Active
- 2020-07-21 JP JP2020124453A patent/JP2020183429A/ja active Pending
-
2021
- 2021-06-23 AU AU2021204263A patent/AU2021204263B2/en active Active
-
2022
- 2022-04-28 CY CY20221100308T patent/CY1125140T1/el unknown
- 2022-08-17 JP JP2022130018A patent/JP7472210B2/ja active Active
-
2024
- 2024-04-10 JP JP2024063461A patent/JP2024095784A/ja active Pending
-
2025
- 2025-05-06 AU AU2025203246A patent/AU2025203246A1/en active Pending
Patent Citations (288)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3927193A (en) | 1973-05-18 | 1975-12-16 | Hoffmann La Roche | Localization of tumors by radiolabelled antibodies |
| US4036945A (en) | 1976-05-03 | 1977-07-19 | The Massachusetts General Hospital | Composition and method for determining the size and location of myocardial infarcts |
| US4331647A (en) | 1980-03-03 | 1982-05-25 | Goldenberg Milton David | Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers |
| US4348376A (en) | 1980-03-03 | 1982-09-07 | Goldenberg Milton David | Tumor localization and therapy with labeled anti-CEA antibody |
| US4361544A (en) | 1980-03-03 | 1982-11-30 | Goldenberg Milton David | Tumor localization and therapy with labeled antibodies specific to intracellular tumor-associated markers |
| US4444744A (en) | 1980-03-03 | 1984-04-24 | Goldenberg Milton David | Tumor localization and therapy with labeled antibodies to cell surface antigens |
| US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
| US4468457A (en) | 1981-06-01 | 1984-08-28 | David M. Goldenberg | Method for producing a CSAp tryptic peptide and anti-CSAp antibodies |
| US4818709A (en) | 1983-01-21 | 1989-04-04 | Primus Frederick J | CEA-family antigens, Anti-CEA antibodies and CEA immunoassay |
| US4624846A (en) | 1983-07-29 | 1986-11-25 | Immunomedics, Inc. | Method for enhancing target specificity of antibody localization and clearance of non-target diagnostic and therapeutic principles |
| US6331175B1 (en) | 1985-07-05 | 2001-12-18 | Immunomedics, Inc. | Method and kit for imaging and treating organs and tissues |
| US6861511B1 (en) | 1986-06-04 | 2005-03-01 | Bayer Corporation | Detection and quantification of neu related proteins in the biological fluids of humans |
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| US6120767A (en) | 1986-10-27 | 2000-09-19 | Pharmaceutical Royalties, L.L.C. | Chimeric antibody with specificity to human B cell surface antigen |
| US6893625B1 (en) | 1986-10-27 | 2005-05-17 | Royalty Pharma Finance Trust | Chimeric antibody with specificity to human B cell surface antigen |
| US6652852B1 (en) | 1986-10-27 | 2003-11-25 | Royalty Pharma Finance Trust | Chimeric antibody with specificity to human B cell surface antigen |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5831034A (en) | 1987-11-13 | 1998-11-03 | Hermann Katinger | Human monoclonal anti-HIV-I-antibodies |
| US6511665B1 (en) | 1987-11-25 | 2003-01-28 | Immunex Corporation | Antibodies to interleukin-1 receptors |
| US5609846A (en) | 1988-03-29 | 1997-03-11 | Immunomedics, Inc. | Radiolabelled antibody cytotoxic therapy of infectious or autoimmune disease |
| US5601825A (en) | 1988-04-01 | 1997-02-11 | Immunomedics, Inc. | Therapeutic conjugates of toxins and drugs |
| US5612016A (en) | 1988-04-01 | 1997-03-18 | Immunomedics, Inc. | Conjugates of antibodies and bifunctional ligands |
| US5439665A (en) | 1988-07-29 | 1995-08-08 | Immunomedics | Detection and treatment of infectious and inflammatory lesions |
| US4925648A (en) | 1988-07-29 | 1990-05-15 | Immunomedics, Inc. | Detection and treatment of infectious and inflammatory lesions |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US6974863B2 (en) | 1988-11-07 | 2005-12-13 | Indiana University Research And Technology Corporation | Antibody for 4-1BB |
| US6887466B2 (en) | 1988-11-23 | 2005-05-03 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6419928B1 (en) | 1988-12-22 | 2002-07-16 | Genzyme Corporation | Monoclonal antibodies to transforming growth factor-beta and methods of use |
| US6432402B1 (en) | 1989-05-25 | 2002-08-13 | Sloan-Kettering Institute For Cancer Research | Anti-idiotypic antibody which induces an immune response against a glycosphingolipid and use thereof |
| US6921533B2 (en) | 1989-06-02 | 2005-07-26 | The Johns Hopkins University School Of Medicine | Method of using monoclonal antibodies against leukocyte adhesion receptor β-chain |
| US5332567A (en) | 1989-08-24 | 1994-07-26 | Immunomedics | Detection and treatment of infections with immunoconjugates |
| US20020136690A1 (en) | 1989-08-24 | 2002-09-26 | Immunomedics, Inc. | Detection and treatment of infections with immunoconjugates |
| US6319500B1 (en) | 1989-08-24 | 2001-11-20 | Immunomedics, Inc. | Detection and treatment of infections with immunoconjugates |
| US6548275B2 (en) | 1989-08-24 | 2003-04-15 | Immunomedics, Inc. | Detection and treatment of infections with immunoconjugates |
| WO1991011465A1 (en) | 1990-01-26 | 1991-08-08 | Immunomedics, Inc. | Vaccines against cancer and infectious diseases |
| US6440416B1 (en) | 1990-01-26 | 2002-08-27 | Immunomedics, Inc. | Vaccines against cancer and infectious diseases |
| US7041293B1 (en) | 1990-04-03 | 2006-05-09 | Genentech, Inc. | HIV env antibodies |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| US5705610A (en) | 1990-05-15 | 1998-01-06 | Chiron Corporation | Method and apparatus for biopolymer synthesis |
| US5840841A (en) | 1990-05-15 | 1998-11-24 | Chiron Corporation | Method and apparatus for biopolymer synthesis |
| US5475096A (en) | 1990-06-11 | 1995-12-12 | University Research Corporation | Nucleic acid ligands |
| US5595877A (en) | 1990-06-11 | 1997-01-21 | Nexstar Pharmaceuticals, Inc. | Methods of producing nucleic acid ligands |
| US5637459A (en) | 1990-06-11 | 1997-06-10 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: chimeric selex |
| US5270163A (en) | 1990-06-11 | 1993-12-14 | University Research Corporation | Methods for identifying nucleic acid ligands |
| US5582981A (en) | 1991-08-14 | 1996-12-10 | Gilead Sciences, Inc. | Method for identifying an oligonucleotide aptamer specific for a target |
| US6764681B2 (en) | 1991-10-07 | 2004-07-20 | Biogen, Inc. | Method of prophylaxis or treatment of antigen presenting cell driven skin conditions using inhibitors of the CD2/LFA-3 interaction |
| US7045132B2 (en) | 1991-11-14 | 2006-05-16 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, C/O Centers For Disease Control And Prevention | Streptococcus pneumoniae 37-kDa surface adhesin a protein |
| US6451310B1 (en) | 1991-11-15 | 2002-09-17 | The Trustees Of Columbia University In The City Of New York | Method for inhibiting an allergic response with a 5c8-specific antibody |
| US6793924B2 (en) | 1991-11-15 | 2004-09-21 | The Trustees Of Columbia University In The City Of New York | Protein recognized by an antibody that specifically binds an epitope that is specifically bound by monoclonal antibody 5c8. |
| US6455044B1 (en) | 1991-11-15 | 2002-09-24 | The Trustees Of Columbia University In The City Of New York | 5c8 antigen |
| US6403091B1 (en) | 1991-11-15 | 2002-06-11 | The Trustees Of Columbia University In The City Of New York | Methods for inhibiting the rejection of a transplant organ in a subject with 5C8-specific antibodies |
| US6592868B1 (en) | 1991-11-15 | 2003-07-15 | The Trustees Of Columbia University In The City Of New York | Methods for treating autoimmune diseases with 5C8-specific antibodies |
| US6610294B1 (en) | 1991-11-15 | 2003-08-26 | The Trustees Of Columbia University In The City Of New York | Methods of inhibiting an autoimmune response in a human suffering from an autoimmune disease by administering an antibody that binds to a protein to which monoclonal antibody 5C8 binds |
| US6355444B1 (en) | 1992-01-29 | 2002-03-12 | Viventia Biotech Inc. | Carcinoma associated antigen (SK1) monoclonal antibodies against SK1, methods of producing these antibodies and uses therefor |
| US6465173B2 (en) | 1992-03-09 | 2002-10-15 | Immune Research, Ltd. | Anti-idiotypic antibody and its use in diagnosis and therapy in HIV-related disease |
| US6916475B2 (en) | 1992-03-09 | 2005-07-12 | Hema Diagnostic Systems L.L.C. | Anti-idiotypic antibody and its use in regulating the composition of T cell lymphocytes |
| US6129914A (en) | 1992-03-27 | 2000-10-10 | Protein Design Labs, Inc. | Bispecific antibody effective to treat B-cell lymphoma and cell line |
| US6359126B1 (en) | 1992-04-03 | 2002-03-19 | Genentech, Inc. | Antibodies to αvβ3 integrin |
| US5716595A (en) | 1992-05-06 | 1998-02-10 | Immunomedics, Inc. | Intraperative, intravascular and endoscopic tumor and lesion detection and therapy with monovalent antibody fragments |
| US6387350B2 (en) | 1992-05-06 | 2002-05-14 | Immunomedics, Inc. | Intraoperative, intravascular and endoscopic tumor and lesion detection, biopsy and therapy |
| US6096289A (en) | 1992-05-06 | 2000-08-01 | Immunomedics, Inc. | Intraoperative, intravascular, and endoscopic tumor and lesion detection, biopsy and therapy |
| US6544749B1 (en) | 1992-05-08 | 2003-04-08 | Genentech, Inc. | Antibodies to leukemia inhibitory factor and their use in immunoassays |
| US5686072A (en) | 1992-06-17 | 1997-11-11 | Board Of Regents, The University Of Texas | Epitope-specific monoclonal antibodies and immunotoxins and uses thereof |
| US6899879B2 (en) | 1992-07-09 | 2005-05-31 | Chiron Corporation | Method for treating an IgE-mediated disease in a patient using anti-CD40 monoclonal antibodies |
| US5525338A (en) | 1992-08-21 | 1996-06-11 | Immunomedics, Inc. | Detection and therapy of lesions with biotin/avidin conjugates |
| US6682734B1 (en) | 1992-11-13 | 2004-01-27 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
| US5776456A (en) | 1992-11-13 | 1998-07-07 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
| US5922302A (en) | 1993-05-17 | 1999-07-13 | Immunomedics, Inc. | Detection and therapy of lesions with biotin/avidin-metal chelating protein conjugates |
| US5736119A (en) | 1993-05-17 | 1998-04-07 | Immunomedics, Inc. | Detection and therapy of lesions with biotin/avidin-metal chelating protein conjugates |
| US6120768A (en) | 1993-05-17 | 2000-09-19 | Immunomedics, Inc. | Dota-biotin derivatives |
| US6444206B1 (en) | 1993-05-28 | 2002-09-03 | The Scripps Research Institute | Methods and compositions for inhibiting CD14 mediated cell activation |
| US6605279B2 (en) | 1993-07-26 | 2003-08-12 | Genetics Institute, Inc. | Therapeutic compositions for inhibiting the interactions of B7-1 and B7-2 with their natural ligands |
| US5798229A (en) | 1993-08-02 | 1998-08-25 | Merck Patent Gesellschaft Mit Beschrankter Haftung | Bispecific molecules recognizing lymphocyte antigen CD2 and tumor antigens |
| US6468531B1 (en) | 1993-09-09 | 2002-10-22 | Duke University | Method of promoting cellular function |
| US5492807A (en) | 1993-11-19 | 1996-02-20 | Santi; Daniel V. | Method of obtaining diagnostic reagents, assays and therapeutics based on clinical manifestations of a disease |
| US6395274B1 (en) | 1993-11-19 | 2002-05-28 | Baylor College Of Medicine | Monoclonal antibodies specific for human interleukin-5 |
| US5670312A (en) | 1993-11-19 | 1997-09-23 | Santi; Daniel V. | Method of obtaining diagnostic reagents, assays and therapeutics based on clinical manifestations of a disease |
| US5443953A (en) | 1993-12-08 | 1995-08-22 | Immunomedics, Inc. | Preparation and use of immunoconjugates |
| US6432404B1 (en) | 1993-12-23 | 2002-08-13 | Icos Corporation | Methods of inhibiting locomotor damage following spinal cord injury with α D-specific antibodies |
| US6346246B1 (en) | 1994-01-25 | 2002-02-12 | Human Genome Sciences, Inc. | Antibodies that bind human haemopoietic maturation factor |
| US6355245B1 (en) | 1994-05-02 | 2002-03-12 | Alexion Pharmaceuticals, Inc. | C5-specific antibodies for the treatment of inflammatory diseases |
| US6867006B2 (en) | 1994-05-16 | 2005-03-15 | Human Genome Sciences, Inc. | Antibodies to human chemotactic protein |
| US6905681B1 (en) | 1994-06-03 | 2005-06-14 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6926893B1 (en) | 1994-07-06 | 2005-08-09 | Immunomedics, Inc. | Multi-stage cascade boosting vaccine |
| US6596852B2 (en) | 1994-07-08 | 2003-07-22 | Immunex Corporation | Antibodies that bind the cytokine designated LERK-5 |
| US6187287B1 (en) | 1994-08-12 | 2001-02-13 | Immunomedics, Inc. | Immunoconjugates and humanized antibodies specific for B-cell lymphoma and leukemia cells |
| US5789554A (en) | 1994-08-12 | 1998-08-04 | Immunomedics, Inc. | Immunoconjugates and humanized antibodies specific for B-cell lymphoma and leukemia cells |
| US5587459A (en) | 1994-08-19 | 1996-12-24 | Regents Of The University Of Minnesota | Immunoconjugates comprising tyrosine kinase inhibitors |
| US6921645B2 (en) | 1994-08-23 | 2005-07-26 | Human Genome Sciences, Inc. | Antibodies to chemokine β-4 |
| US6673344B1 (en) | 1994-08-23 | 2004-01-06 | Human Genome Sciences, Inc. | Antibodies to human CKβ-10/MCP-4 |
| US6709653B1 (en) | 1994-09-16 | 2004-03-23 | Human Genome Sciences, Inc. | Antibodies specific for human inositol monophosphatase H1 |
| US6676924B2 (en) | 1994-10-05 | 2004-01-13 | Immunomedics, Inc. | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
| US5874540A (en) | 1994-10-05 | 1999-02-23 | Immunomedics, Inc. | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
| US6518404B1 (en) | 1994-10-17 | 2003-02-11 | Human Genome Sciences, Inc. | Human endothelin-bombesin receptor antibodies |
| US6733981B2 (en) | 1994-11-01 | 2004-05-11 | Human Genome Sciences, Inc. | Antibodies to interleukin-1 β converting enzyme like apoptosis protease-3 and 4 |
| US5677136A (en) | 1994-11-14 | 1997-10-14 | Systemix, Inc. | Methods of obtaining compositions enriched for hematopoietic stem cells, compositions derived therefrom and methods of use thereof |
| US7012133B1 (en) | 1995-01-19 | 2006-03-14 | Children's Medical Center Corp. | Antibodies to C-C chemokine Receptor 3 Protein |
| US6344198B1 (en) | 1995-01-20 | 2002-02-05 | Human Genome Sciences, Inc. | Human prostatic specific reductase |
| US7001598B2 (en) | 1995-01-26 | 2006-02-21 | Biogen Idec Ma Inc. | Anti-lymphotoxin-beta receptor antibodies as anti-tumor agents |
| US6441143B1 (en) | 1995-04-13 | 2002-08-27 | Amgen Inc | Methods and compositions for determining HER-2/neu expression |
| US5911989A (en) | 1995-04-19 | 1999-06-15 | Polynum Scientific Immunbiologische Forschung Gmbh | HIV-vaccines |
| US6468529B1 (en) | 1995-06-02 | 2002-10-22 | Genentech, Inc. | Hepatocyte growth factor receptor antagonists and uses thereof |
| US6482408B2 (en) | 1995-06-05 | 2002-11-19 | Human Genome Sciences, Inc. | Fibroblast growth factor 15 antibodies |
| US6767711B2 (en) | 1995-06-05 | 2004-07-27 | Cornell Research Foundation, Inc. | Treatment and diagnosis of prostate cancer |
| US6605441B1 (en) | 1995-06-05 | 2003-08-12 | Human Genome Sciences, Inc. | Antibodies against fibroblast growth factor 11 |
| US5814440A (en) | 1995-06-07 | 1998-09-29 | Systemix, Inc. | Methods of obtaining compositions enriched for hematopoietic stem cells, antibodies for use therein, compositions derived therefrom and methods of use thereof |
| US6068829A (en) | 1995-09-11 | 2000-05-30 | The Burnham Institute | Method of identifying molecules that home to a selected organ in vivo |
| US5622699A (en) | 1995-09-11 | 1997-04-22 | La Jolla Cancer Research Foundation | Method of identifying molecules that home to a selected organ in vivo |
| US6340459B1 (en) | 1995-12-01 | 2002-01-22 | The Trustees Of Columbia University In The City Of New York | Therapeutic applications for the anti-T-BAM (CD40-L) monoclonal antibody 5C8 in the treatment of reperfusion injury in non-transplant recipients |
| US6458356B1 (en) | 1995-12-05 | 2002-10-01 | Amgen Inc. | Antibody-induced apoptosis |
| US6949244B1 (en) | 1995-12-20 | 2005-09-27 | The Board Of Trustees Of The University Of Kentucky | Murine monoclonal anti-idiotype antibody 11D10 and methods of use thereof |
| US6413726B1 (en) | 1996-03-19 | 2002-07-02 | Human Genome Sciences, Inc. | Antibodies that specifically bind Cytostatin III |
| US6730300B2 (en) | 1996-03-20 | 2004-05-04 | Immunomedics, Inc. | Humanization of an anti-carcinoembryonic antigen anti-idiotype antibody and use as a tumor vaccine and for targeting applications |
| US6254868B1 (en) | 1996-03-20 | 2001-07-03 | Immunomedics, Inc. | Glycosylated humanized B-cell specific antibodies |
| US6861226B2 (en) | 1996-03-21 | 2005-03-01 | Human Genome Sciences, Inc. | Human endometrial specific steroid-binding factor I, II and III |
| US6340571B1 (en) | 1996-03-21 | 2002-01-22 | Bio Merieux | Antibodies specific for Staphylococcus aureus, and use thereof |
| US6962981B1 (en) | 1996-03-25 | 2005-11-08 | Medarex, Inc. | Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen |
| US6884594B2 (en) | 1996-03-26 | 2005-04-26 | Human Genome Sciences, Inc. | Antibodies to growth factor HTTER36 |
| US6730307B2 (en) | 1996-03-29 | 2004-05-04 | The Arizona Board Of Regents Acting On Behalf Of The University Of Arizona | Anti-cryptosporidium parvum preparations |
| US6682737B1 (en) | 1996-03-29 | 2004-01-27 | North Carolina State University | Anti-cryptosporidium parvum preparations |
| US6576745B1 (en) | 1996-04-03 | 2003-06-10 | Human Genome Sciences, Inc. | Human cystatin F antibodies |
| US6077499A (en) | 1996-05-03 | 2000-06-20 | Immunomedics, Inc. | Targeted combination immunotherapy of cancer |
| US6770450B1 (en) | 1996-05-06 | 2004-08-03 | Cornell Research Foundation, Inc. | Treatment and diagnosis of cancer |
| US6107090A (en) | 1996-05-06 | 2000-08-22 | Cornell Research Foundation, Inc. | Treatment and diagnosis of prostate cancer with antibodies to extracellur PSMA domains |
| US6764688B2 (en) | 1996-09-03 | 2004-07-20 | Kaneka Corporation | Method for inducing immunosuppressive cells and a culture device to be used therefor |
| US6479247B1 (en) | 1996-10-09 | 2002-11-12 | The Corporation Of The Trustees Of The Order Of The Sisters Of Mercy In Queensland | Dendritic cell-specific antibodies |
| US6083477A (en) | 1996-10-17 | 2000-07-04 | Immunomedics, Inc. | Non-antigenic toxin-conjugate and fusion protein of internalizing receptor system |
| US6653104B2 (en) | 1996-10-17 | 2003-11-25 | Immunomedics, Inc. | Immunotoxins, comprising an internalizing antibody, directed against malignant and normal cells |
| US20050175582A1 (en) | 1996-10-17 | 2005-08-11 | Immunomedics, Inc. | Non-antigenic toxin-conjugate and fusion protein of internalizing receptor system |
| US6635482B1 (en) | 1996-10-25 | 2003-10-21 | Human Genome Sciences, Inc. | Monoclonal antibodies to membrane neutrokine-α |
| US6403770B1 (en) | 1996-10-25 | 2002-06-11 | Human Genome Sciences, Inc. | Antibodies to neutrokine-alpha |
| US6528625B1 (en) | 1996-10-28 | 2003-03-04 | Millennium Pharmaceuticals, Inc. | Anti-CCR5 antibodies and kits comprising same |
| US6482598B2 (en) | 1996-11-13 | 2002-11-19 | Morphogenesis, Inc. | Antibody recognizing a small subset of human hematopoietic cells |
| US6838282B2 (en) | 1996-11-13 | 2005-01-04 | Morphogenesis, Inc. | Antibody recognizing a small subset of human hematopoietic cells |
| US6455040B1 (en) | 1997-01-14 | 2002-09-24 | Human Genome Sciences, Inc. | Tumor necrosis factor receptor 5 |
| US6878812B2 (en) | 1997-01-21 | 2005-04-12 | Human Genome Science, Inc. | Metalloproteinases |
| US7041803B2 (en) | 1997-01-21 | 2006-05-09 | Human Genome Sciences, Inc. | Galectin 11 |
| US6461823B1 (en) | 1997-01-28 | 2002-10-08 | Human Genome Sciences, Inc. | Death domain containing receptor-4 antibodies |
| US6943020B2 (en) | 1997-01-28 | 2005-09-13 | Human Genome Sciences, Inc. | Death domain containing receptor-4 antibodies |
| US6372215B1 (en) | 1997-03-03 | 2002-04-16 | Bristol-Myers Squibb Company | Monoclonal antibodies to human CD6 |
| US6951924B2 (en) | 1997-03-14 | 2005-10-04 | Human Genome Sciences, Inc. | Antibodies against secreted protein HTEBYII |
| US6919433B2 (en) | 1997-03-14 | 2005-07-19 | Human Genome Sciences, Inc. | Antibodies to protein HPMBQ91 |
| US6872568B1 (en) | 1997-03-17 | 2005-03-29 | Human Genome Sciences, Inc. | Death domain containing receptor 5 antibodies |
| US6183744B1 (en) | 1997-03-24 | 2001-02-06 | Immunomedics, Inc. | Immunotherapy of B-cell malignancies using anti-CD22 antibodies |
| US6306393B1 (en) | 1997-03-24 | 2001-10-23 | Immunomedics, Inc. | Immunotherapy of B-cell malignancies using anti-CD22 antibodies |
| US20030124058A1 (en) | 1997-03-24 | 2003-07-03 | Immunomedics, Inc. | Immunotherapy of B-cell malignancies using anti-CD22 antibodies |
| US6395276B1 (en) | 1997-05-02 | 2002-05-28 | Immunomedics, Inc. | Immunotoxins directed against malignant cells |
| US20050249738A1 (en) | 1997-05-02 | 2005-11-10 | The Govt. of the U.S.A as represented by the Sect. of the Dept. of Health & Human Services, Inc | Immunotoxins directed against malignant cells |
| US6689362B1 (en) | 1997-06-03 | 2004-02-10 | Regents Of The University Of Minnesota | Method for treating T-lineage leukemias and lymphomas using a CD7-specific monoclonal antibody (TXU-7) linked to the pokeweed antiviral protein (PAP) |
| US6545130B2 (en) | 1997-06-04 | 2003-04-08 | Albert Einstein College Of Medicine Of Yeshiva University | Monoclonal antibodies to mycobacterium tuberculosis and a modified ELISA assay |
| US6919078B2 (en) | 1997-06-11 | 2005-07-19 | Human Genome Sciences, Inc. | Antibodies to human tumor necrosis factor receptor TR9 |
| US6764679B2 (en) | 1997-09-18 | 2004-07-20 | Genentech, Inc. | Antibodies to DcR3 Polypeptide, a TNFR Homolog |
| US6689607B2 (en) | 1997-10-21 | 2004-02-10 | Human Genome Sciences, Inc. | Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2 |
| US6355244B1 (en) | 1997-11-17 | 2002-03-12 | University Of Kentucky Research Foundation | Methods and compositions for the treatment of psoriasis |
| US6610833B1 (en) | 1997-11-24 | 2003-08-26 | The Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
| US6562618B1 (en) | 1997-12-25 | 2003-05-13 | Japan Tobacco, Inc. | Monoclonal antibody against connective tissue growth factor and medicinal uses thereof |
| US6956107B2 (en) | 1998-02-20 | 2005-10-18 | Tanox, Inc. | Inhibitors of complement activation |
| US6861227B2 (en) | 1998-03-19 | 2005-03-01 | Human Genome Sciences, Inc. | Antibodies to cytokine receptor common gamma chain like |
| US6566076B1 (en) | 1998-04-23 | 2003-05-20 | The Regents Of The University Of California | Detection and diagnosis of conditions associated with lung injury |
| US6383759B1 (en) | 1998-05-04 | 2002-05-07 | Gerald P. Murphy Cancer Foundation | Non-invasive method to detect prostate cancer |
| US7230084B2 (en) | 1998-05-20 | 2007-06-12 | Immunomedics, Inc. | Therapeutic using a bispecific antibody |
| US20030103982A1 (en) | 1998-05-20 | 2003-06-05 | Immunomedics, Inc. | Therapeutic using a bispecific antibody |
| US6458933B1 (en) | 1998-05-20 | 2002-10-01 | Immunomedics, Inc. | Therapeutic using a bispecific antibody |
| US6881405B2 (en) | 1998-06-15 | 2005-04-19 | Altarex Medical Corp. | Reagents and methods for inducing an immune response to prostate specific antigen |
| US7553953B2 (en) | 1998-06-22 | 2009-06-30 | Immunomedics, Inc. | Chimeric, human and humanized anti-CSAp monoclonal antibodies |
| US6962702B2 (en) | 1998-06-22 | 2005-11-08 | Immunomedics Inc. | Production and use of novel peptide-based agents for use with bi-specific antibodies |
| US7641891B2 (en) | 1998-06-22 | 2010-01-05 | Immunomedics, Inc. | Chimeric, human and humanized anti-CSAp monoclonal antibodies |
| US7670804B2 (en) | 1998-06-22 | 2010-03-02 | Immunomedics, Inc. | Chimeric, human and humanized anti-CSAP monoclonal antibodies |
| US7405320B2 (en) | 1998-06-22 | 2008-07-29 | Immunomedics, Inc. | Therapeutic and diagnostic conjugates for use with multispecific antibodies |
| US6528269B1 (en) | 1998-06-22 | 2003-03-04 | Case Western Reserve University | Immunological agents specific for prion protein (PRP) |
| US20050002945A1 (en) | 1998-06-22 | 2005-01-06 | Immunomedics, Inc. | Therapeutic and diagnostic conjugates for use with multispecific antibodies |
| US20050169926A1 (en) | 1998-06-22 | 2005-08-04 | Immunomedics, Inc. | Chimeric, human and humanized anti-CSAP monoclonal antibodies |
| US20060034759A1 (en) | 1998-06-22 | 2006-02-16 | Immunomedics, Inc. | Production and use of novel peptide-based agents with bispecific antibodies |
| US7414121B2 (en) | 1998-06-22 | 2008-08-19 | Immunomedics, Inc. | Chimeric, human and humanized anti-CSAp monoclonal antibodies |
| US6406694B1 (en) | 1998-07-23 | 2002-06-18 | Millennium Pharmaceuticals, Inc. | Anti-CCR2 antibodies |
| US6491915B2 (en) | 1998-07-23 | 2002-12-10 | Millennium Pharmaceuticals, Inc. | Anti-CCR2 antibodies and methods of use therefor |
| US6720155B1 (en) | 1998-08-13 | 2004-04-13 | Angel Lopez | Monoclonal antibody inhibitor of GM-CSF, IL-3, IL-5 and other cytokines, and uses thereof |
| US6572856B1 (en) | 1998-09-10 | 2003-06-03 | The University Of Virginia Patent Foundation | Methods for the prevention and treatment of cancer using anti-C3b(i) antibodies |
| US7256004B2 (en) | 1998-10-31 | 2007-08-14 | United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Variants of humanized anti-carcinoma monoclonal antibody CC49 |
| US6692908B1 (en) | 1998-11-05 | 2004-02-17 | Stanford University | Prevention and treatment of HCV infection employing antibodies that inhibit the interaction of HCV virions with their receptor |
| US6383484B1 (en) | 1998-12-21 | 2002-05-07 | Ludwig Institute For Cancer Research | Antibodies to truncated VEGF-D and thereof |
| US6682736B1 (en) | 1998-12-23 | 2004-01-27 | Abgenix, Inc. | Human monoclonal antibodies to CTLA-4 |
| US7041802B2 (en) | 1998-12-23 | 2006-05-09 | Human Genome Sciences, Inc. | Peptidoglycan recognition proteins |
| US6488930B1 (en) | 1999-01-15 | 2002-12-03 | Millennium Pharmaceuticals, Inc. | Anti-CCR4 antibodies and methods of use therefor |
| US7056509B2 (en) | 1999-04-28 | 2006-06-06 | Board Of Regents The University Of Texas System | Antibody methods for selectively inhibiting VEGF |
| US6887468B1 (en) | 1999-04-28 | 2005-05-03 | Board Of Regents, The University Of Texas System | Antibody kits for selectively inhibiting VEGF |
| US20040219203A1 (en) | 1999-05-10 | 2004-11-04 | Immunomedics, Inc. | Anti-CD74 immunoconjugates and methods |
| US6946129B1 (en) | 1999-06-08 | 2005-09-20 | Seattle Genetics, Inc. | Recombinant anti-CD40 antibody and uses thereof |
| US7641901B2 (en) | 1999-06-09 | 2010-01-05 | Immunomedics, Inc. | Immunotherapy of autoimmune disorders using antibodies which target B-cells |
| US7074403B1 (en) | 1999-06-09 | 2006-07-11 | Immunomedics, Inc. | Immunotherapy of autoimmune disorders using antibodies which target B-cells |
| US7919087B2 (en) | 1999-06-09 | 2011-04-05 | Immunomedics, Inc. | Internalizing anti-CD74 antibodies and methods of use |
| US6864062B2 (en) | 1999-06-16 | 2005-03-08 | Molecular Geriatrics Corporation | Purified antigen for Alzheimer's disease and methods of obtaining and using same |
| US6355481B1 (en) | 1999-06-18 | 2002-03-12 | Emory University | Hybridoma cell line and monoclonal antibody for huntingtin protein |
| US7387772B1 (en) | 1999-06-22 | 2008-06-17 | Immunimedics, Inc. | Chimeric, human and humanized anti-CSAP monoclonal antibodies |
| US6964854B1 (en) | 1999-07-13 | 2005-11-15 | Science & Technology Corporation | Compositions and methods useful for the diagnosis and treatment of heparin induced thrombocytopenia/thrombosis |
| US6693176B1 (en) | 1999-07-23 | 2004-02-17 | University Of Massachusetts | Antitumor antibodies, proteins, and uses thereof |
| US6376654B1 (en) | 1999-08-13 | 2002-04-23 | Molecular Discoveries, Llc | Myeloma cell and ovarian cancer cell surface glycoproteins, antibodies thereto, and uses thereof |
| US6716966B1 (en) | 1999-08-18 | 2004-04-06 | Altarex Corp. | Therapeutic binding agents against MUC-1 antigen and methods for their use |
| US6630144B1 (en) | 1999-08-30 | 2003-10-07 | The United States Of America As Represented By The Secretary Of The Army | Monoclonal antibodies to Ebola glycoprotein |
| US6824780B1 (en) | 1999-10-29 | 2004-11-30 | Genentech, Inc. | Anti-tumor antibody compositions and methods of use |
| US6783758B2 (en) | 1999-11-08 | 2004-08-31 | Rhode Island Hospital | Diagnosis and treatment of malignant neoplasms |
| US6812206B2 (en) | 1999-11-08 | 2004-11-02 | Rhode Island Hospital | Diagnosis and treatment of malignant neoplasms |
| US6835370B2 (en) | 1999-11-08 | 2004-12-28 | Rhode Island Hospital | Diagnosis and treatment of malignant neoplasms |
| US6994852B1 (en) | 1999-11-12 | 2006-02-07 | Temple University-Of The Commonwealth System Of Higher Education | Inhibition of angiogenesis by antibodies against high molecular weight kininogen domain 5 |
| US6521227B1 (en) | 1999-11-18 | 2003-02-18 | Peter L. Hudson | Polynucleotides encoding prostatic growth factor and process for producing prostatic growth factor polypeptides |
| US6994976B1 (en) | 1999-11-19 | 2006-02-07 | Tittle Thomas V | Tr3-specific binding agents and methods for their use |
| US7038018B2 (en) | 1999-11-24 | 2006-05-02 | Millennium Pharmaceuticals, Inc. | Antibodies and ligands for “Bonzo” chemokine receptor |
| US6835549B2 (en) | 2000-02-24 | 2004-12-28 | University Of Medicine & Dentistry Of New Jersey | Immunoassay method for the diagnosis of gastric intestinal metaplasia associated with gastric carcinoma |
| US6998468B2 (en) | 2000-03-23 | 2006-02-14 | Tanox, Inc. | Anti-C2/C2a inhibitors of complement activation |
| US6689355B2 (en) | 2000-05-11 | 2004-02-10 | Altarex Corp. | Therapeutic method and composition utilizing antigen-antibody complexation and presentation by dendritic cells |
| US6965018B2 (en) | 2000-06-06 | 2005-11-15 | Bristol-Myers Squibb Company | Antibodies directed to B7-related polypeptide, BSL-2 |
| US6939547B2 (en) | 2000-07-31 | 2005-09-06 | The United States Of America As Represented By The Department Of Health And Human Services | Specific binding agents for KSHV vIL-6 that neutralize a biological activity |
| US7060802B1 (en) | 2000-09-18 | 2006-06-13 | The Trustees Of Columbia University In The City Of New York | Tumor-associated marker |
| US6989241B2 (en) | 2000-10-02 | 2006-01-24 | Oklahoma Medical Research Foundation | Assay for rapid detection of human activated protein C and highly specific monoclonal antibody therefor |
| US6534058B2 (en) | 2000-10-10 | 2003-03-18 | Tanox, Inc. | Anti-C5 monoclonal antibodies |
| US7037498B2 (en) | 2001-01-05 | 2006-05-02 | Abgenix, Inc. | Antibodies to insulin-like growth factor I receptor |
| US6743898B2 (en) | 2001-03-15 | 2004-06-01 | Ochsner Clinic Foundation | Monoclonal antibodies that suppress B cell growth and/or differentiation |
| US6899864B2 (en) | 2001-03-30 | 2005-05-31 | Immunomedics, Inc. | Morpholino imaging and therapy |
| US6824778B2 (en) | 2001-04-23 | 2004-11-30 | The United States Of America As Represented By The Secretary Of The Army | Prophylactic and therapeutic monoclonal antibodies |
| US20050048512A1 (en) | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US20050089932A1 (en) | 2001-04-26 | 2005-04-28 | Avidia Research Institute | Novel proteins with targeted binding |
| US20040175756A1 (en) | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
| US20050221384A1 (en) | 2001-04-26 | 2005-10-06 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US20050053973A1 (en) | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
| US6962813B2 (en) | 2001-05-21 | 2005-11-08 | The Brigham And Women's Hospital, Inc. | P. aeruginosa mucoid exopolysaccharide specific binding peptides |
| US7387773B2 (en) | 2001-08-07 | 2008-06-17 | Massey University | Vaccine |
| US7049060B2 (en) | 2001-11-05 | 2006-05-23 | Ortho-Clinical Diagnostics, Inc. | HCV anti-core monoclonal antibodies |
| US7138496B2 (en) | 2002-02-08 | 2006-11-21 | Genetastix Corporation | Human monoclonal antibodies against human CXCR4 |
| US7435803B2 (en) | 2002-02-14 | 2008-10-14 | Immunomedics, Inc. | Anti-CD20 antibodies and fusion proteins thereof and methods of use |
| US8287864B2 (en) | 2002-02-14 | 2012-10-16 | Immunomedics, Inc. | Structural variants of antibodies for improved therapeutic characteristics |
| US20030219433A1 (en) | 2002-02-14 | 2003-11-27 | Immunomedics, Inc. | Anti-CD20 antibodies and fusion proteins thereof and methods of use |
| US7151164B2 (en) | 2002-02-14 | 2006-12-19 | Immunomedics, Inc. | Anti-CD20 antibodies and fusion proteins thereof and methods of use |
| US7312318B2 (en) | 2002-03-01 | 2007-12-25 | Immunomedics, Inc. | Internalizing anti-CD74 antibodies and methods of use |
| US7772373B2 (en) | 2002-03-01 | 2010-08-10 | Immunomedics, Inc. | Internalizing anti-CD74 antibodies and methods of use |
| US20040001825A1 (en) | 2002-03-01 | 2004-01-01 | Immunomedics, Inc. | RS7 antibodies |
| US7238785B2 (en) | 2002-03-01 | 2007-07-03 | Immunomedics, Inc. | RS7 antibodies |
| US7517964B2 (en) | 2002-03-01 | 2009-04-14 | Immunomedics, Inc. | RS7 antibodies |
| US7931903B2 (en) | 2002-03-01 | 2011-04-26 | Immunomedics, Inc. | Internalizing anti-CD74 antibodies and methods of use |
| US8084583B2 (en) | 2002-03-01 | 2011-12-27 | Immunomedics, Inc. | RS7 antibodies |
| US7282567B2 (en) | 2002-06-14 | 2007-10-16 | Immunomedics, Inc. | Monoclonal antibody hPAM4 |
| US20050014207A1 (en) | 2002-06-14 | 2005-01-20 | Immunomedics, Inc. | Monoclonal antibody hPAM4 |
| US7238786B2 (en) | 2002-06-14 | 2007-07-03 | Immunomedics, Inc. | Monoclonal antibody cPAM4 |
| US7300655B2 (en) | 2002-08-01 | 2007-11-27 | Immunomedics, Inc. | Alpha-fetoprotein Immu31 antibodies and fusion proteins and methods of use thereof |
| US20040235065A1 (en) | 2002-08-01 | 2004-11-25 | Immunomedics, Inc. | Alpha-fetoprotein Immu31 antibodies and fusion proteins and methods of use thereof |
| US7541440B2 (en) | 2002-09-30 | 2009-06-02 | Immunomedics, Inc. | Chimeric, human and humanized anti-granulocyte antibodies and methods of use |
| US7951369B2 (en) | 2002-09-30 | 2011-05-31 | Immunomedics, Inc. | Chimeric, human and humanized anti-granulocyte antibodies and methods of use |
| US7217797B2 (en) | 2002-10-15 | 2007-05-15 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20120082617A1 (en) * | 2002-12-13 | 2012-04-05 | Immunomedics, Inc. | Immunoconjugates with an Intracellularly-Cleavable Linkage |
| US20060193865A1 (en) | 2002-12-13 | 2006-08-31 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
| US20110305631A1 (en) * | 2002-12-13 | 2011-12-15 | Immunomedics, Inc. | Camptothecin Conjugates of Anti-CD22 Antibodies for Treatment of B Cell Diseases |
| US7585491B2 (en) | 2002-12-13 | 2009-09-08 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
| US20040219156A1 (en) | 2002-12-31 | 2004-11-04 | Immunomedics, Inc. | Immunotherapy of B cell malignancies and autoimmune diseases using unconjugated antibodies and conjugated antibodies and antibody combinations and fusion proteins |
| US20050271671A1 (en) | 2003-01-24 | 2005-12-08 | Immunomedics, Inc. | Anthracycline-antibody conjugates |
| US20040202666A1 (en) | 2003-01-24 | 2004-10-14 | Immunomedics, Inc. | Anti-cancer anthracycline drug-antibody conjugates |
| US6875580B2 (en) | 2003-01-28 | 2005-04-05 | Schering Corporation | Antibodies specific for plasmacytoid dendritic cells |
| US20050025709A1 (en) | 2003-06-13 | 2005-02-03 | Immunomedics, Inc. | D-amino acid peptides |
| US7902338B2 (en) | 2003-07-31 | 2011-03-08 | Immunomedics, Inc. | Anti-CD19 antibodies |
| US8337840B2 (en) | 2003-07-31 | 2012-12-25 | Immunomedics, Inc. | Anti-CD19 antibodies |
| US8147831B2 (en) | 2003-07-31 | 2012-04-03 | Immunomedics, Inc. | Anti-CD19 antibodies |
| US7109304B2 (en) | 2003-07-31 | 2006-09-19 | Immunomedics, Inc. | Humanized anti-CD19 antibodies |
| US7462352B2 (en) | 2003-07-31 | 2008-12-09 | Immunomedics, Inc. | Methods of treatng B-cell diseases using humanized anti-CD19 antibodies |
| US20050079184A1 (en) | 2003-08-08 | 2005-04-14 | Immunomedics, Inc. | Bispecific antibodies for inducing apoptosis of tumor and diseased cells |
| US20060014245A1 (en) | 2004-02-13 | 2006-01-19 | Immunomedics, Inc. | Fusion proteins containing recombinant cytotoxic RNAses |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| US7251164B2 (en) | 2004-11-10 | 2007-07-31 | Innovative Silicon S.A. | Circuitry for and method of improving statistical distribution of integrated circuits |
| US7612180B2 (en) | 2005-03-03 | 2009-11-03 | Immunomedics, Inc. | Humanized L243 antibodies |
| US20060210475A1 (en) | 2005-03-03 | 2006-09-21 | Goldenberg David M | Humanized L243 antibodies |
| US7906118B2 (en) | 2005-04-06 | 2011-03-15 | Ibc Pharmaceuticals, Inc. | Modular method to prepare tetrameric cytokines with improved pharmacokinetics by the dock-and-lock (DNL) technology |
| US7981398B2 (en) | 2005-04-06 | 2011-07-19 | Ibc Pharmaceuticals, Inc. | PEGylation by the dock and lock (DNL) technique |
| US7871622B2 (en) | 2005-04-06 | 2011-01-18 | Ibc Pharmaceuticals, Inc. | Stably tethered structures of defined compositions with multiple functions or binding specificities |
| US8163291B2 (en) | 2005-04-06 | 2012-04-24 | Ibc Pharmaceuticals, Inc. | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
| US7550143B2 (en) | 2005-04-06 | 2009-06-23 | Ibc Pharmaceuticals, Inc. | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
| US8034352B2 (en) | 2005-04-06 | 2011-10-11 | Ibc Pharmaceuticals, Inc. | Tetrameric cytokines with improved biological activity |
| US7521056B2 (en) | 2005-04-06 | 2009-04-21 | Ibc Pharmaceuticals, Inc. | Stably tethered structures of defined compositions with multiple functions or binding specificities |
| US7666400B2 (en) | 2005-04-06 | 2010-02-23 | Ibc Pharmaceuticals, Inc. | PEGylation by the dock and lock (DNL) technique |
| US8003111B2 (en) | 2005-04-06 | 2011-08-23 | Ibc Pharmaceuticals, Inc. | Dimeric alpha interferon pegylated site-specifically shows enhanced and prolonged efficacy in vivo |
| US7858070B2 (en) | 2005-10-19 | 2010-12-28 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
| US7901680B2 (en) | 2005-10-19 | 2011-03-08 | Ibc Pharmaceuticals, Inc. | Dock-and-lock (DNL) vaccines for cancer therapy |
| US7642239B2 (en) | 2005-10-19 | 2010-01-05 | Center For Molecular Medicine And Immunology | Inhibition of placenta growth factor (PLGF) mediated metastasis and/or angiogenesis |
| US7527787B2 (en) | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
| US7906121B2 (en) | 2005-10-19 | 2011-03-15 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
| US20070087001A1 (en) | 2005-10-19 | 2007-04-19 | Center For Molecular Medicine And Immunology | Inhibition of placenta growth factor (PLGF) mediated metastasis and/or angiogenesis |
| US7534866B2 (en) | 2005-10-19 | 2009-05-19 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
| WO2007123995A2 (en) * | 2006-04-19 | 2007-11-01 | Bionumerik Pharmaceuticals, Inc. | Camptothecin-analog with a novel, “flipped” lactone-stable, e-ring and methods for making and using same |
| US8267865B2 (en) | 2007-02-16 | 2012-09-18 | University Of Rochester | Sonoelastographic shear velocity imaging using crawling wave excitation |
| WO2009130575A2 (en) | 2008-04-22 | 2009-10-29 | Universita' Degli Studi Di Verona | Isolated monoclonal antibody or fragment thereof binding prostate specific membrane antigen, conjugates and uses thereof |
| US20110160159A1 (en) * | 2009-09-15 | 2011-06-30 | John Ryan | Treatment of cancer |
Non-Patent Citations (183)
| Title |
|---|
| "in GOODMAN AND GILMAN'S THE PHARMACOLOGICAL BASIS OF THERAPEUTICS", 1985, MACMILLAN PUBLISHING CO. |
| "MONOCLONAL ANTIBODIES: PRODUCTION, ENGINEERING AND CLINICAL APPLICATION", vol. 574, 1995, CAMBRIDGE UNIVERSITY PRESS, article "Antibody Variations", pages: 137 - 185 |
| ALBERTI ET AL., HYBRIDOMA, vol. 11, 1992, pages 539 - 45 |
| ALTO ET AL., PROC NATL ACAD SCI USA, vol. 100, 2003, pages 4445 - 50 |
| ALTO ET AL., PROC. NATL. ACAD. SCI. USA., vol. 100, 2003, pages 4445 |
| ANN. REV. BIOCHEM., vol. 47, 1978, pages 251 - 276 |
| ANSEL ET AL.: "PHARMACEUTICAL DOSAGE FORMS AND DRUG DELIVERY SYSTEMS", 1990, MACK PUBLISHING COMPANY |
| ANSELLEAFEBIGER ET AL.: "PHARMACEUTICAL DOSAGE FORMS AND DRUG DELIVERY SYSTEMS", 1990 |
| ARAP ET AL., SCIENCE, vol. 279, 1998, pages 377 - 380 |
| BAERT ET AL., N ENGL J MED, vol. 348, 2003, pages 602 - 08 |
| BAILLIE ET AL., FEBS LETTERS, vol. 579, 2005, pages 3264 |
| BAINES ET AL.: "METHODS IN MOLECULAR BIOLOGY", vol. 10, 1992, THE HUMANA PRESS, INC., article "Purification of Immunoglobulin G (IgG", pages: 79 - 104 |
| BEIER ET AL., CANCER RES., vol. 67, no. 3, 2007, pages 1030 - 7 |
| BIOPHYS. J., vol. 26, 1979, pages 367 - 384 |
| BLUMENTHAL ET AL., BMC CANCER, vol. 7, 2007, pages 2 |
| BREKKELOSET, CURR. OPIN. PHAMACOL., vol. 3, 2003, pages 544 - 50 |
| BURKE ET AL.: "Design, Synthesis, and Biological Evaluation of Antibody-Drug Conjugates Comprised of Potent Camptothecin Analogues", BIOCONJUGATE CHEM., vol. 20, 2009, pages 1242 - 1250, XP055079987 * |
| BURNS-HAMURO ET AL., PROTEIN SCI, vol. 14, 2005, pages 2982 - 92 |
| BURTON ET AL., CLIN CANCER RES, vol. 10, 2004, pages 6606 - 11 |
| CARDILLO ET AL., CLIN CANCER RES, vol. 17, 2011, pages 3157 - 47 |
| CARDILLO ET AL., CLIN CANCER RES, vol. 17, no. 10, 3 March 2011 (2011-03-03), pages 3157 - 3169 |
| CARDILLO ET AL.: "Humanized Anti-Trop-2 IgG-SN-38 Conjugate for Effective Treatment of Diverse Epithelial Cancers: Preclinical Studies in Human Cancer Xenograft Models and Monkeys", CLIN CANCER RES, vol. 17, no. 10, 3 March 2011 (2011-03-03), pages 3157 - 69, XP055044596 * |
| CARR ET AL., J BIOL CHEM, vol. 276, 2001, pages 17332 - 38 |
| CARR ET AL., J. BIOL. CHEM., vol. 266, 1991, pages 14188 |
| CARTER ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 89, 1992, pages 4285 |
| CASADEVALL, CLIN IMMUNOL, vol. 93, no. 1, 1999, pages 5 - 15 |
| CERNEA ET AL., DIABETES METAB REV, vol. 26, 2010, pages 602 - 05 |
| CHMURA ET AL., PROC. NATL. ACAD. SCI. USA., vol. 98, 2001, pages 8480 |
| CHOUFASMAN, BIOCHEMISTRY, vol. 13, 1974, pages 222 - 245 |
| COLLEDGESCOTT, TRENDS CELL BIOL., vol. 6, 1999, pages 216 |
| CONRADSCHELLER, COMB. CHEM. HIGH THROUGHPUT SCREEN., vol. 8, 2005, pages 117 - 26 |
| COSSINS ET AL., PROTEIN EXPRESSION AND PURIFICATION, vol. 51, 2007, pages 253 - 59 |
| CRAIGFOON, BLOOD, 15 January 2008 (2008-01-15) |
| CUBAS ET AL., MOL CANCER, vol. 9, 2010, pages 253 |
| DADACHOVACASADEVALL, Q J NUCL MED MOL IMAGING, vol. 50, no. 3, 2006, pages 193 - 204 |
| DANTAS-BARBOSA ET AL., GENET. MOL. RES., vol. 4, 2005, pages 126 - 40 |
| DEBOER ET AL., JOURNAL OF ANTIBIOTICS, vol. 23, 1970, pages 442 - 447 |
| DEMONTE ET AL., PROC NATL ACAD SCI USA., vol. 87, 1990, pages 2941 - 2945 |
| DONNENBERG ET AL., J. CONTROL RELEASE, vol. 122, no. 3, 2007, pages 385 - 91 |
| EDELMAN ET AL.: "METHODS IN ENZYMOLOGY", 1967, ACADEMIC PRESS, pages: 422 |
| FROLICH ET AL., ARTHRITIS RES THER, vol. 14, 2012, pages R54 |
| GINSBERG, JAM COLL CARDIOL, vol. 52, 2007, pages 2319 - 21 |
| GM ALLOTYPES, J IMMUNOL, vol. 117, 1976, pages 1056 - 59 |
| GOLD ET AL., INT J CLIN EXP PATHOL, vol. 4, 2010, pages 1 - 12 |
| GOLDENBERG ET AL., BLOOD, vol. 113, 2009, pages 1062 - 70 |
| GOVINDAN ET AL., BREAST CANCER RES TREAT, vol. 84, 2004, pages 173 - 82 |
| GOVINDAN ET AL., CLIN CANCER RES, vol. 15, 2009, pages 6052 - 62 |
| GOVINDAN ET AL., EXPERT OPIN BIOL THER, vol. 12, 2012, pages 1415 - 21 |
| GREEN ET AL., J. IMMUNOL. METHODS, vol. 231, 1999, pages 11 - 23 |
| GREEN ET AL., NATURE GENET., vol. 7, 1994, pages 13 |
| GRIFFITHS ET AL., CLIN CANCER RES, vol. 9, 2003, pages 6567 - 71 |
| HAMAGUCHI ET AL., CLIN CANCER RES, vol. 16, 2010, pages 5058 - 66 |
| HANSEN ET AL., BIOCHEM J, vol. 320, 1996, pages 293 - 300 |
| HANSEN ET AL., BIOCHEM J., vol. 320, 1996, pages 293 - 300 |
| HE ET AL., BIOORGANIC & MEDICINAL CHEMISTRY, vol. 12, 2004, pages 4003 - 4008 |
| HILLPERRIS, J. NATL. CANCER INST., vol. 99, 2007, pages 1435 - 40 |
| HINTON ET AL., J IMMUNOL, vol. 176, 2006, pages 346 - 56 |
| HORNICK ET AL., J NUCL MED, vol. 41, 2000, pages 355 - 9.22 |
| HUNDSRUCKER ET AL., BIOCHEM J, vol. 400, 2006, pages 493 - 306 |
| INBAR ET AL., PROC. NAT'L. ACAD. SCI. USA, vol. 69, 1972, pages 2659 |
| IYERRATAIN, CANCER CHEMOTHER PHARMACOL., vol. 42, 1998, pages 31 - 43 |
| IYERRATAIN, CANCER CHEMOTHER. PHAMACOL., vol. 42, 1998, pages S31 - S43 |
| JEFFERISLEFRANC, MABS, vol. 1, 2009, pages 1 - 7 |
| JOHANSSON ET AL., AIDS, vol. 20, no. 15, 3 October 2006 (2006-10-03), pages 1911 - 5 |
| JOHNSONCHISWELL, CURRENT OPINION IN STRUCTURAL BIOLOGY, vol. 3, 1993, pages 5564 - 571 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 |
| JOOS ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 50, no. 5, 2006, pages 1773 - 9 |
| KAUFMAN ET AL., ASH ANNUAL MEETING ABSTRACTS, vol. 112, 2008, pages 3697 |
| KINDERMAN ET AL., MOL CELL, vol. 24, 2006, pages 397 - 408 |
| KNIGHT, SEMIN. NUCL. MED., vol. 20, 1990, pages 52 - 67 |
| KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KOIZUMI ET AL., CANCER RES, vol. 66, 2006, pages 10048 - 56 |
| KOLB HCSHARPLESS KB, DRUG DISCOV TODAY, vol. 8, 2003, pages 1128 - 37 |
| KOZLOV ET AL., CANCER GENET. CYTOGENET., vol. 163, no. 1, 2005, pages 62 - 7 |
| KSIEZAK-REDING ET AL., J BIOL CHEM, vol. 263, 1987, pages 7943 - 47 |
| KYTEDOOLITTLE, J. MOL. BIOL., vol. 157, 1982, pages 105 - 132 |
| LAN, NEPHRON EXP NEPHROL., vol. 109, 2008, pages e79 - 83 |
| LARRICK ET AL., METHODS: A COMPANION TO METHODS IN ENZYMOLOGY, vol. 2, 1991, pages 106 |
| LENG ET AL., J EXP MED, vol. 197, 2003, pages 1467 - 76 |
| LEUNG ET AL., HYBRIDOMA, vol. 13, 1994, pages 469 |
| LIU ET AL.: "NY Acad Sci.", vol. 922, 2000, article "The Camptothecins: Unfolding Their Anticancer Potential", pages: 1 - 10 |
| LOHMANN ET AL., PROC. NATL. ACAD. SCI USA., vol. 81, 1984, pages 6723 |
| LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 |
| LOSMAN ET AL., INT. J. CANCER, vol. 46, 1990, pages 310 |
| MAHATO ET AL.: "Prodrugs for Improving Tumor Targetability and Efficiency", ADV DRUG DELIV REV., vol. 63, no. 8, 18 July 2011 (2011-07-18), pages 659 - 670, XP028098219 * |
| MAITLAND ET AL., ERNST SCHERING FOUND. SYMPOS. PROC., vol. 5, 2006, pages 155 - 79 |
| MANCINI ET AL., NEW MICROBIOL., vol. 27, 2004, pages 315 - 28 |
| MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 97 |
| MATHIJSSEN ET AL., CLIN CANCER RES., vol. 7, 2002, pages 2182 - 2194 |
| MATTES ET AL., CLIN CANCER RES, vol. 14, 2008, pages 6154 - 60 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 553 |
| MEYER-SIEGLER ET AL., BMC CANCER, vol. 12, 2004, pages 34 |
| MEYER-SIEGLER ET AL., MEDIATORS INFLAMM EPUB, 22 March 2009 (2009-03-22) |
| MILSTEINCUELLO, NATURE, vol. 305, 1983, pages 537 - 540 |
| MOON ET AL., J MED CHEM, vol. 51, 2008, pages 6916 - 26 |
| MOON ET AL., J. MEDICINAL CHEM., vol. 51, 2008, pages 6916 - 6926 |
| MORANDLEECH, FRONT BIOSCI, vol. 10, 2005, pages 12 - 22 |
| MORCHHAUSER ET AL., J CLIN ONCOL, vol. 27, 2009, pages 3346 - 53 |
| NAGY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 2464 - 2469 |
| NAUJOKAS ET AL., CELL, vol. 74, 1993, pages 257 - 68 |
| NECKERS ET AL., INVEST. NEW DRUGS, vol. 17, 1999, pages 361 - 373 |
| NEWLON ET AL., EMBO J., vol. 20, 2001, pages 1651 |
| NEWLON ET AL., NAT. STRUCT. BIOL., vol. 6, 1999, pages 222 |
| NISONOFF ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 89, 1960, pages 230 |
| NITTA ET AL., LANCET, vol. 355, 1990, pages 368 - 371 |
| NORD ET AL., NAT BIOTECHNOL, vol. 15, 1997, pages 772 - 77 |
| NORD ET AL., PROTEIN ENG, vol. 8, 1995, pages 601 - 8 |
| NOVELLINO ET AL., CANCER IMMUNOL IMMUNOTHER, vol. 54, 2005, pages 187 - 207 |
| OFEI ET AL., DIABETES, vol. 45, 2011, pages 881 - 85 |
| ONG ET AL., IMMUNOLOGY, vol. 98, 1999, pages 296 - 302 |
| PACK ET AL., BIOLTECHNOLOGY, vol. 11, 1993, pages 1271 |
| PARMIANI ET AL., J IMMUNOL, vol. 178, 2007, pages 1975 - 79 |
| PASQUALINI, QUART. J. NUCL. MED., vol. 43, 1999, pages 159 - 162 |
| PASQUALINI, THE QUART. J. NUCL. MED., vol. 43, 1999, pages 159 - 162 |
| PASQUALINIRUOSLAHTI, NATURE, vol. 380, 1996, pages 364 - 366 |
| PASTAN. ET AL., CELL, vol. 47, 1986, pages 641 |
| PETKOVA ET AL., INT IMMUNOL, vol. 18, 2006, pages 1759 - 69 |
| PORTER, BIOCHEM. J., vol. 73, 1959, pages 119 |
| PRINCE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 104, no. 24, 2007, pages 10158 - 63 |
| QU ET AL., PROC AM ASSOC CANCER RES, vol. 43, 2002, pages 255 |
| RAVANDI, J CLIN ONCOL, vol. 29, 2011, pages 349 - 51 |
| REICHERTDEWITZ, NAT REV DRUG DISCOVERY, vol. 5, 2006, pages 191 - 195 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 |
| RIVORY, ANN NY ACAD SCI., vol. 922, 2000, pages 205 - 215 |
| ROBAKROBAK, BIODRUGS, vol. 25, 2011, pages 13 - 25 |
| ROBBINSANGELL: "Basic Pathology", 1976, W. B. SAUNDERS CO., pages: 68 - 79 |
| ROCHE ET AL., PNAS USA, vol. 90, 1993, pages 8581 - 85 |
| SALTZMAN ET AL., BIOPHYS. J., vol. 55, 1989 |
| SANDHU, CRIT. REV. BIOTECH., vol. 12, 1992, pages 437 |
| SAPRA ET AL., CLIN CANCER RES, vol. 11, 2005, pages 5257 - 64 |
| SAPRA ET AL., EXPERT OPIN BIOL THER, vol. 20, 2011, pages 1131 - 49 |
| SAPRA ET AL., HAEMATOLOGICA, vol. 94, 2009, pages 1456 - 9 |
| SCOTT ET AL., J. BIOL. CHEM., vol. 265, 1990, pages 21561 |
| SCOTT, PHARMACOL. THER., vol. 50, 1991, pages 123 |
| SENSI ET AL., CLIN CANCER RES, vol. 12, 2006, pages 5023 - 32 |
| SHACHARHARAN, LEUK LYMPHOMA, vol. 52, 2011, pages 1446 - 54 |
| SHARKEY ET AL., JNUCL MED, vol. 50, 2009, pages 444 - 53 |
| SHARKEY ET AL., MOL CANCER THER, vol. 10, 2011, pages 1072 - 81 |
| SHARKEY ET AL.: "Epratuzumab-SN-38: A New Antibody-Drug Conjugate for the Therapy of Hematologic Malignancies", MOI CANCER THER, vol. 11, no. 1, 2011, pages 224 - 34, XP055125141 * |
| SHARKEYGOLDENBERG, CA CANCER J CLIN., vol. 56, no. 4, July 2006 (2006-07-01), pages 226 - 243 |
| SHARKEYGOLDENBERG, CA CANCER J CLIN., vol. 56, no. 4, pages 226 - 43 |
| SHERWOOD ET AL., BIOLTECHNOLOGY, vol. 10, 1992, pages 1446 |
| SHIH ET AL., CANCER RES, vol. 55, 1995, pages 5857s - 63s |
| SHIH ET AL., INT J CANCER, vol. 56, 1994, pages 538 - 45 |
| SHUNTAO ET AL., MOLEC IMMUNOL, vol. 43, 2006, pages 1912 - 19 |
| SILVERMAN ET AL., NAT. BIOTECHNOL., vol. 23, 2005, pages 1493 - 94 |
| SILVERMAN ET AL., NAT. BIOTECHNOL., vol. 24, 2006, pages 220 |
| SINGER ET AL., J. IMMUN., vol. 150, 1993, pages 2844 |
| SKOLNIK ET AL., THER DRUG MONIT, vol. 32, 2010, pages 741 - 48 |
| SMITHSCOTT, METH. ENZYMOL., vol. 21, 1993, pages 228 - 257 |
| SMITHSCOTT, SCIENCE, vol. 228, 1985, pages 1315 - 1317 |
| STAERZ ET AL., NATURE, vol. 316, 1985, pages 354 - 356 |
| STAERZBEVAN, PROC NATL ACAD SCI USA., vol. 83, 1986, pages 1453 - 1457 |
| STEFFENS ET AL., CIRCULATION, vol. 114, 2006, pages 1977 - 84 |
| STEIN ET AL., CANCER, vol. 80, 1997, pages 2636 - 41 |
| STEIN ET AL., CLIN CANCER RES., vol. 13, 15 September 2007 (2007-09-15), pages 5556s - 5563s |
| STEIN ET AL., INT J CANCER SUPPL., vol. 8, 1994, pages 98 - 102 |
| STEINCOLLEAGUES, INT J CANCER, vol. 55, 1993, pages 938 - 46 |
| STEVENSON, MOL MED, vol. 12, no. 11-12, 2006, pages 345 - 346 |
| STICKLER ET AL., GENES AND IMMUNITY, vol. 12, 2011, pages 213 - 21 |
| TAI ET AL., BLOOD, vol. 112, no. 4, 2008, pages 1329 - 37 |
| TAI ET AL., CANCER RES., vol. 65, no. 13, 2005, pages 5898 - 5906 |
| TAKAHASHI ET AL., RESPIR RES, vol. 10, 2009, pages 33 |
| TANHA ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 24774 - 780 |
| TASSONE ET AL., BLOOD, vol. 104, no. 12, 2004, pages 3705 - 623 |
| TAYLOR ET AL., INT. IMMUN., vol. 6, 1994, pages 579 |
| TAYLOR, J. BIOL. CHEM., vol. 264, 1989, pages 8443 |
| TEMPEST ET AL., BIOTECHNOLOGY, vol. 9, 1991, pages 266 - 22 |
| THEURILLAT ET AL., INT. J. CANCER, vol. 120, no. 11, 2007, pages 2411 - 7 |
| THURBER ET AL., ADV DRUG DEL REV, vol. 60, 2008, pages 1421 - 34 |
| TOLMACHEV ET AL., BIOCONJUGATE CHEM, vol. 22, 2011, pages 894 - 902 |
| TOLMACHEV ET AL., CANCER RES, vol. 67, 2007, pages 2773 - 82 |
| VAN DER NEUT KOLFSCHOTEN ET AL., SCIENCE, vol. 317, 14 September 2007 (2007-09-14), pages 1554 - 1557 |
| VAN OIGEN ET AL., J DRUG TARGET, vol. 5, 1998, pages 75 - 91 |
| VCELAR ET AL., AIDS, vol. 21, no. 16, 2007, pages 2161 - 2170 |
| VERHOEYEN ET AL., SCIENCE, vol. 242, 1988, pages 1534 |
| WALDMANN ET AL., HEMATOL, vol. 1, 2000, pages 394 - 408 |
| WALSH ET AL., J. BIOL. CHEM., vol. 243, 1968, pages 3763 |
| WILLNER ET AL., BIOCONJUGATE CHEM., vol. 4, 1993, pages 521 - 527 |
| WINER ET AL., NATURE MED, vol. 17, 2011, pages 610 - 18 |
| WONGSCOTT, NAT. REV. MOL. CELL BIOL., vol. 5, 2004, pages 959 |
| ZHANG ET AL., NEUROLOGY, vol. 44, 1994, pages 1747 - 51 |
| ZHAO ET AL., BIOCONJUG CHEM, vol. 19, 2008, pages 849 - 59 |
Cited By (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9770517B2 (en) | 2002-03-01 | 2017-09-26 | Immunomedics, Inc. | Anti-Trop-2 antibody-drug conjugates and uses thereof |
| US9879088B2 (en) | 2012-08-14 | 2018-01-30 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to Trop-2 expressing cells |
| US9670286B2 (en) | 2012-08-14 | 2017-06-06 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to Trop-2 expressing cells |
| US9382329B2 (en) | 2012-08-14 | 2016-07-05 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to Trop-2 expressing cells |
| US10662252B2 (en) | 2012-08-14 | 2020-05-26 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to Trop-2 expressing cells |
| US12570761B2 (en) | 2012-11-20 | 2026-03-10 | Sanofi | Anti-CEACAM5 antibodies and uses thereof |
| AU2014293670B2 (en) * | 2013-07-23 | 2019-08-01 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
| CN107206101A (zh) * | 2014-12-03 | 2017-09-26 | 基因泰克公司 | 季铵化合物及其抗体‑药物缀合物 |
| CN107206101B (zh) * | 2014-12-03 | 2021-06-25 | 基因泰克公司 | 季铵化合物及其抗体-药物缀合物 |
| US20200087297A1 (en) * | 2014-12-03 | 2020-03-19 | Genentech, Inc. | Quaternary amine compounds and antibody-drug conjugates thereof |
| WO2016090050A1 (en) * | 2014-12-03 | 2016-06-09 | Genentech, Inc. | Quaternary amine compounds and antibody-drug conjugates thereof |
| US11104673B2 (en) | 2014-12-03 | 2021-08-31 | Genentech, Inc. | Quaternary amine compounds and antibody-drug conjugates thereof |
| US10556895B2 (en) | 2014-12-03 | 2020-02-11 | Genentech, Inc. | Quaternary amine compounds and antibody-drug conjugates thereof |
| US10436788B2 (en) | 2015-04-22 | 2019-10-08 | Immunomedics, Inc. | Isolation, detection, diagnosis and/or characterization of circulating Trop-2-positive cancer cells |
| US9797907B2 (en) | 2015-04-22 | 2017-10-24 | Immunomedics, Inc. | Isolation, detection, diagnosis and/or characterization of circulating Trop-2-positive cancer cells |
| EP4257134A3 (en) * | 2015-06-25 | 2024-01-24 | Immunomedics, Inc. | Combining anti-hla-dr or anti-trop-2 antibodies with microtubule inhibitors, parp inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
| CN108367995A (zh) * | 2015-10-06 | 2018-08-03 | 安大略省癌症研究所 | 靶向组蛋白途径以检测和克服蒽环类抗生素耐受性 |
| CN108367995B (zh) * | 2015-10-06 | 2021-08-27 | 安大略省癌症研究所 | 靶向组蛋白途径以检测和克服蒽环类抗生素耐受性 |
| EP3448260A4 (en) * | 2016-04-27 | 2019-10-09 | Immunomedics, Inc. | EFFICACY OF ANTI-TROP-2 SN-38 ANTIBODY CONJUGATES FOR THE THERAPY OF REZIDIVATED / REFRACTORY TUMORS AGAINST CHECKPOINT INHIBITORS |
| US11192955B2 (en) | 2016-04-27 | 2021-12-07 | Immunomedics, Inc. | Efficacy of anti-Trop-2-SN-38 antibody drug conjugates for therapy of tumors relapsed/refractory to checkpoint inhibitors |
| WO2019039483A1 (ja) | 2017-08-23 | 2019-02-28 | 第一三共株式会社 | 抗体-薬物コンジュゲートの製剤及びその凍結乾燥方法 |
| KR20200044044A (ko) | 2017-08-23 | 2020-04-28 | 다이이찌 산쿄 가부시키가이샤 | 항체-약물 콘주게이트의 제제 및 그 동결 건조 방법 |
| KR20250004902A (ko) | 2017-08-23 | 2025-01-08 | 다이이찌 산쿄 가부시키가이샤 | 항체-약물 콘주게이트의 제제 및 그 동결 건조 방법 |
| CN111295389A (zh) * | 2017-12-15 | 2020-06-16 | 四川科伦博泰生物医药股份有限公司 | 生物活性物偶联物及其制备方法和用途 |
| US11970506B2 (en) | 2017-12-15 | 2024-04-30 | Sichuan Kelun-Biotech Biopharmaceutical Co., Ltd. | Bioactive molecule conjugate, preparation method and use thereof |
| RU2793316C2 (ru) * | 2018-09-26 | 2023-03-31 | Цзянсу Хэнжуй Медицин Ко., Лтд. | Конъюгат лиганд-лекарственное средство аналога экзатекана, способ его получения и его применение |
| WO2020063676A1 (zh) * | 2018-09-26 | 2020-04-02 | 江苏恒瑞医药股份有限公司 | 依喜替康类似物的配体-药物偶联物及其制备方法和应用 |
| US12617867B2 (en) | 2018-09-26 | 2026-05-05 | Jiangsu Hengrui Medicine Co., Ltd. | Ligand-drug conjugate of exatecan analogue, preparation method therefor and application thereof |
| US20230338565A1 (en) * | 2020-05-15 | 2023-10-26 | Sichuan Kelun-Biotech Biopharmaceutical Co., Ltd. | Antibody drug conjugate, preparation method therefor and use thereof |
| US12564642B2 (en) | 2020-11-10 | 2026-03-03 | Sanofi | CEACAM5 antibody-drug conjugate formulation |
| EP4265275A4 (en) * | 2020-12-18 | 2024-03-20 | Shanghai Fudan-Zhangjiang Bio-Pharmaceutical Co., Ltd. | ANTIBODY-DRUG CONJUGATE TARGETING TROP2, PREPARATION METHOD AND USE THEREOF |
| WO2023201267A1 (en) | 2022-04-13 | 2023-10-19 | Gilead Sciences, Inc. | Combination therapy for treating trop-2 expressing cancers |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2021204263B2 (en) | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity | |
| US20160256562A1 (en) | Antibody-sn-38 immunoconjugates with a cl2a linker | |
| EP3024460A2 (en) | Antibody-sn-38 immunoconjugates with a cl2a linker | |
| US20260014140A1 (en) | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity | |
| HK40075632A (en) | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13861658 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2884313 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2013360335 Country of ref document: AU Date of ref document: 20130723 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 238018 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013861658 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2015547923 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20157014368 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 122022013706 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2015/007343 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015013444 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112015013444 Country of ref document: BR Kind code of ref document: A2 Effective date: 20150609 |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 1020257007068 Country of ref document: KR |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020257007068 Country of ref document: KR |