WO2014074503A1 - Methods and compositions for wound healing - Google Patents

Methods and compositions for wound healing Download PDF

Info

Publication number
WO2014074503A1
WO2014074503A1 PCT/US2013/068463 US2013068463W WO2014074503A1 WO 2014074503 A1 WO2014074503 A1 WO 2014074503A1 US 2013068463 W US2013068463 W US 2013068463W WO 2014074503 A1 WO2014074503 A1 WO 2014074503A1
Authority
WO
WIPO (PCT)
Prior art keywords
wound
polymer layer
microsheet
agent
nanoscale
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/068463
Other languages
English (en)
French (fr)
Inventor
Ankit Agarwal
Nicholas L. Abbott
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
IMBED BIOSCIENCES Inc
Original Assignee
IMBED BIOSCIENCES Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by IMBED BIOSCIENCES Inc filed Critical IMBED BIOSCIENCES Inc
Priority to EP21203499.5A priority Critical patent/EP3995158A1/en
Priority to US14/440,997 priority patent/US20150283287A1/en
Priority to EP13853763.4A priority patent/EP2916876B1/en
Priority to ES13853763T priority patent/ES2904352T3/es
Priority to JP2015541849A priority patent/JP6334550B2/ja
Publication of WO2014074503A1 publication Critical patent/WO2014074503A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L15/00Chemical aspects of, or use of materials for, bandages, dressings or absorbent pads
    • A61L15/16Bandages, dressings or absorbent pads for physiological fluids such as urine or blood, e.g. sanitary towels, tampons
    • A61L15/42Use of materials characterised by their function or physical properties
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61FFILTERS IMPLANTABLE INTO BLOOD VESSELS; PROSTHESES; DEVICES PROVIDING PATENCY TO, OR PREVENTING COLLAPSING OF, TUBULAR STRUCTURES OF THE BODY, e.g. STENTS; ORTHOPAEDIC, NURSING OR CONTRACEPTIVE DEVICES; FOMENTATION; TREATMENT OR PROTECTION OF EYES OR EARS; BANDAGES, DRESSINGS OR ABSORBENT PADS; FIRST-AID KITS
    • A61F13/00Bandages or dressings; Absorbent pads
    • A61F13/02Adhesive bandages or dressings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L15/00Chemical aspects of, or use of materials for, bandages, dressings or absorbent pads
    • A61L15/16Bandages, dressings or absorbent pads for physiological fluids such as urine or blood, e.g. sanitary towels, tampons
    • A61L15/22Bandages, dressings or absorbent pads for physiological fluids such as urine or blood, e.g. sanitary towels, tampons containing macromolecular materials
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L15/00Chemical aspects of, or use of materials for, bandages, dressings or absorbent pads
    • A61L15/16Bandages, dressings or absorbent pads for physiological fluids such as urine or blood, e.g. sanitary towels, tampons
    • A61L15/22Bandages, dressings or absorbent pads for physiological fluids such as urine or blood, e.g. sanitary towels, tampons containing macromolecular materials
    • A61L15/24Macromolecular compounds obtained by reactions only involving carbon-to-carbon unsaturated bonds; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L15/00Chemical aspects of, or use of materials for, bandages, dressings or absorbent pads
    • A61L15/16Bandages, dressings or absorbent pads for physiological fluids such as urine or blood, e.g. sanitary towels, tampons
    • A61L15/22Bandages, dressings or absorbent pads for physiological fluids such as urine or blood, e.g. sanitary towels, tampons containing macromolecular materials
    • A61L15/26Macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L15/00Chemical aspects of, or use of materials for, bandages, dressings or absorbent pads
    • A61L15/16Bandages, dressings or absorbent pads for physiological fluids such as urine or blood, e.g. sanitary towels, tampons
    • A61L15/42Use of materials characterised by their function or physical properties
    • A61L15/44Medicaments
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L15/00Chemical aspects of, or use of materials for, bandages, dressings or absorbent pads
    • A61L15/16Bandages, dressings or absorbent pads for physiological fluids such as urine or blood, e.g. sanitary towels, tampons
    • A61L15/42Use of materials characterised by their function or physical properties
    • A61L15/46Deodorants or malodour counteractants, e.g. to inhibit the formation of ammonia or bacteria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2300/00Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices
    • A61L2300/10Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices containing or releasing inorganic materials
    • A61L2300/102Metals or metal compounds, e.g. salts such as bicarbonates, carbonates, oxides, zeolites, silicates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2300/00Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices
    • A61L2300/10Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices containing or releasing inorganic materials
    • A61L2300/102Metals or metal compounds, e.g. salts such as bicarbonates, carbonates, oxides, zeolites, silicates
    • A61L2300/104Silver, e.g. silver sulfadiazine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2300/00Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices
    • A61L2300/20Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices containing or releasing organic materials
    • A61L2300/204Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices containing or releasing organic materials with nitrogen-containing functional groups, e.g. aminoxides, nitriles, guanidines
    • A61L2300/206Biguanides, e.g. chlorohexidine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2300/00Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices
    • A61L2300/40Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices characterised by a specific therapeutic activity or mode of action
    • A61L2300/404Biocides, antimicrobial agents, antiseptic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2400/00Materials characterised by their function or physical properties
    • A61L2400/12Nanosized materials, e.g. nanofibres, nanoparticles, nanowires, nanotubes; Nanostructured surfaces

Definitions

  • the present invention relates to methods and compositions for the modulation of wound healing.
  • the present invention relates to nanoscale polymer layers comprising bioactive agents and microsheets comprising a nanoscale polymer layer supported on a sacrificial polymer layer.
  • Open cutaneous wounds represent one major category of wounds and include burn wounds, wounds resulting from chemical (especially alkali) burns, wounds from physical trauma, neuropathic ulcers, pressure sores, venous stasis ulcers, and diabetic ulcers.
  • Open cutaneous wounds routinely heal by a process which comprises six major components: i) inflammation, ii) fibroblast proliferation, iii) blood vessel proliferation, iv) connective tissue synthesis, v) epithelialization, and vi) wound contraction. Wound healing is impaired when these components, either individually or as a whole, do not function properly.
  • wound healing including but not limited to malnutrition, systemic debility due to a variety of causes, wound infection, local lack of progenitor cells, local and/or systemic pharmacological agents (e.g., numerous chemotherapeutic agents, actinomycin and steroids), repeated local trauma, diabetes and other endocrine/metabolic diseases (e.g., Cushing's disease), and advanced age (Hunt and Goodson, 1988, Current Surgical Diagnosis &
  • Diabetes mellitus is a chronic disorder of glucose metabolism and homeostasis that damages many organs. It is the eighth leading cause of death in the United States (Harris et al., 1987, Diabetes 36:523). In persons with diabetes, vascular disease, neuropathy, infections, and recurrent trauma predispose the extremities, especially the foot, to pathologic changes. These pathological changes can ultimately lead to chronic ulceration, which may necessitate amputation. Chronic wounds and wounds with pathological or dysregulated healing represent a major health burden and drain on health care resources. Chronic wounds have major impacts on the physical and mental health, productivity, morbidity, mortality and cost of care for affected individuals.
  • Normal wound healing is an enormously complex process involving the coordinated interplay between fibroblasts, vascular cells, extracellular matrix and epithelial cells to result in a seamless progression through an inflammatory reaction, wound repair, contracture and coverage by an epithelial barrier.
  • the wound healing processes can become asynchronous (i.e., loss of connectivity with triggering mechanisms associated with prior cellular events) and are unable to progress to closure, resulting in a chronic ulcer.
  • films e.g., polyurethane films
  • hydrocolloids hydrophilic colloidal particles bound to polyurethane foam
  • hydrogels cross-linked polymers containing about at least 60% water
  • foams hydrophilic or hydrophobic
  • calcium alginates nonwoven composites of fibers from calcium alginate
  • cellophane cellulose with a plasticizer
  • silver is considered particularly favorable because the likelihood of developing bacterial resistance to silver is believed to be very low; therefore, it can be employed as a bactericidal agent continuously.
  • currently available methods of applying silver as a bactericidal agent for wound treatment are inadequate.
  • 0.5% silver nitrate solution is a standard and popular agent for topical burn wound therapy, providing a beneficial effect in decreasing wound surface inflammation.
  • such formulations have a high concentration of silver, there is no residual activity, necessitating frequent applications (e.g., up to 12 times a day) which poses a severe logistical burden in clinical settings.
  • Silver ions released through use of 0.5% silver nitrate solution become rapidly inactive through formation of chemical complexes by chloride within 2 hours. Frequent dressings also result in large excesses of silver being delivered to the wound, causing wound-discoloration and toxic effects (Dunn et al, 2004, Burns 30(supplement 1):S1 ; herein incorporated by reference in its entirety). Additionally, nitrate is toxic to wounds and to mammalian cells. The reduction of nitrate to nitrite further causes oxidant-induced damage to cells, which is cited as the most likely reason for the impaired re-epithelialization with use of silver nitrate solution in partial thickness burns or donor sites.
  • Silver compounds such as silver sulfadiazine in cream formulations (e.g.,
  • Flammazine®, silvadene® have also been used for wound treatment. However, such formulations also have limited residual activity and have to be applied twice a day. Bacterial resistance does develop to these formulations, and, impaired re-epithelialization has also been observed. Bone marrow toxicity has been observed with silver sulfadiazine, primarily due to its propylene glycol component.
  • silver itself is incorporated into the dressing instead of being applied as a separate formulation. Controlled and prolonged release of silver to the wound allows dressings to be changed less frequently. However, dressings have to be impregnated with large amount of silver, which results in cytotoxicity to mammalian cells.
  • Silver released from a commercially available wound-dressing (ActicoatTM) containing nanocrystalline silver (Dunn et al, 2004, Burns 30(supplement 1):S1 ; herein incorporated by reference in its entirety) is toxic to in vitro monolayer cell cultures of keratinocytes and fibroblasts (Poon et al, 2004, Burns 30: 140; Trop et al, 2006, J. Trauma 60:648; each herein incorporated by reference in its entirety).
  • the present invention relates to methods and compositions for the modulation of wound healing, for modulation of the surface properties of biomedical devices, and for modulation of the surface properties of tissues including skin.
  • the present invention relates to promoting and enhancing wound healing by changing the intrinsic chemical composition and/or physical attributes of the wound bed.
  • the present invention provides formulations that alter the physical attributes (compliance, topography, charge), as well as cross-linker covalent modification molecules to attach and deliver antimicrobial compounds as well as extracellular matrices and other scaffolds and cytoactive agents to a wound.
  • the present invention provides methods and compositions utilizing oppositely charged polyelectrolytes to form a polyelectrolyte layer (e.g., a multilayer) on a wound surface.
  • the invention further relates to the incorporation of non-charged polymers into the wound bed via interactions such as but not limited to hydrogen bonding.
  • the scope of the invention includes incorporation of nanoparticles and microparticles into the wound bed to engineer the physical characteristics and chemical composition of the wound bed.
  • the invention further relates to incorporating wound active agents into a polyelectrolyte layer (e.g., a multilayer), nanoparticle or microparticle for delivery to a wound.
  • the present invention provides formulations that promote a favorable and stable pH, surface charge, surface energy, osmotic environment, surface functionalities that enhance galvano and magneto positive effects on wound healing, supply of nitric oxide, provide energy sources for cells and/or provide a balance of MMP/other peptidase/protease activity.
  • the present invention further relates to providing compositions, methods, and kits comprising selectively toxic wound active agents that are highly bactericidal but that support growth and viability of mammalian cells (e.g., keratinocytes, neurons, vascular endothelial cells and fibroblasts cells).
  • the wound active agent is silver, including but not limited to silver nanoparticles.
  • the silver loading of some embodiments of the present invention is between 0.35 and 0.4 ⁇ g/cm 2 .
  • Polyelectrolyte multilayer thin films of the present invention comprising silver (e.g., silver nanoparticles) find use in the treatment of wounds and the prevention of infection, including but not limited to as coatings on devices that come partially, directly, indirectly, or completely in contact with the body of a subject (e.g., a human patient).
  • a subject e.g., a human patient
  • compositions and methods of the present invention provide approaches to promote healing in pathologic wounds by altering the surface chemistry and structure of the pathologic wound bed itself so as to ultimately enable differential modulation of key cellular elements customizable to the specific patient's health wound type and anatomic location in a subject.
  • the present invention provides for the covalent immobilization of factors to the wound bed.
  • the present invention provides methods of treatment, comprising providing a subject having a wound, at least one covalent modification agent and at least one wound active agent, and contacting the wound with the at least one covalent modification agent and the at least one wound active agent under conditions such that the at least one wound active agent is covalently attached to the wound.
  • the subject is a human.
  • the subject is a non-human vertebrate.
  • the at least one covalent modification agent is a homobifunctional cross-linker.
  • the at least one covalent modification agent is a heterobifunctional cross-linker.
  • the homobifunctional cross-linker is an N-hydroxysuccinimidyl ester (e.g., including, but not limited to, disuccinimidyl ester, dithiobis(succinimidylpropionate), 3,3 '- dithiobis(sulfosuccinimidylpropionate), disuccinimidyl suberate,
  • N-hydroxysuccinimidyl ester e.g., including, but not limited to, disuccinimidyl ester, dithiobis(succinimidylpropionate), 3,3 '- dithiobis(sulfosuccinimidylpropionate), disuccinimidyl suberate,
  • the homobifunctional cross-linker is at a concentration between 1 nanomolar and 10 millimolar. In some preferred embodiments, the homobifunctional cross-linker is at a concentration between 10 micromolar and 1 millimolar.
  • the at least one covalent modification agent is a heterobifunctional cross-linker (e.g., including, but not limited to, N-succinimidyl 3-(2-pyridyldithio)propionate, succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate, sulfosuccinimidyl 6-(3'-[2- pyridyldithio]-propionamido)hexanoate, succinimidyloxycarbonyl-a-methyl-a-(2- pyridyldithio)toluene, sulfosuccinimidyl-6-[a-methyl-a-(2- pyridyldithio)toluamido]hexanoate, succinimidyl 4-(N-maleimidomethyl)cyclohexane- 1 - carboxylate, sulf
  • the heterobifunctional cross-linker is modified with functional groups, rendering it soluble in aqueous solvents for delivery as an aqueous solution.
  • the aqueous solution contains additives (e.g., including, but not limited to, surfactants and block copolymers).
  • additives e.g., including, but not limited to, surfactants and block copolymers.
  • a multiplicity of hetero-bifunctional cross-linkers can be attached to a molecule, polymer or particle to serve as the cross-linking agent.
  • the heterobifunctional cross-linker is dissolved in an organic solvent (e.g., including, but not limited to, dimethyl sulfoxide).
  • the at least one wound active agent includes, but is not limited to, trophic factors, extracellular matrices, enzymes, enzyme inhibitors, defensins, polypeptides, anti-infective agents, buffering agents, vitamins and minerals, analgesics, anticoagulants, coagulation factors, anti-inflammatory agents, vasoconstrictors, vasodilators, diuretics, and anti-cancer agents.
  • the at least one wound active agent contains one or more free -SH groups.
  • the present invention also provides a kit for treating a subject having a wound, comprising at least one covalent modification agent, at least one wound active agent, and instructions for using the kit to covalently link the at least one wound active agent to the wound.
  • the at least one covalent modification agent is a
  • the homobifunctional cross-linker is an N-hydroxysuccinimidyl ester (e.g., including, but not limited to, disuccinimidyl ester, dithiote(succinimidylpropionate), 3,3 '-dithio/? «(sulfosuccinimidylpropionate),
  • disuccinimidyl suberate Zra(sulfosuccinirnidyl)suberate, disuccinimidyl tartarate, disulfosuccinimidyl tartarate, te[2-(succinimidyloxycarbonyloxy)ethyl]sulfone, bis[2- (sulfosuccinimidooxycarbonyloxy) ethyl] sulfone, ethylene glycolfo ' s(succinimidylsuccinate), ethylene glycolte(sulfosuccinimidyl-succinate), disuccinimidyl glutarate, and N,N'- disuccinimidylcarbonate).
  • the at least one covalent modification agent is a heterobifunctional cross-linker (e.g., including, but not limited to, N-succinimidyl 3-(2- pyridyldithio)propionate, succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate, sulfosuccinimidyl 6-(3'-[2-pyridyldithio]-propionamido)hexanoate,
  • a heterobifunctional cross-linker e.g., including, but not limited to, N-succinimidyl 3-(2- pyridyldithio)propionate, succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate, sulfosuccinimidyl 6-(3'-[2-pyridyldithio]-propiona
  • the at least one wound active agent includes, but is not limited to, trophic factors (including polypetide growth factors, neuropeptides, neurotrophins, , extracellular matrices and their individual native constituents (exemplified by but not limited to laminin, fibronectin, vitronectin, collagens, also select amino acid sequences found in these proteins known to promote cell behaviors favorable to wound healing e.g., integrin binding sequences exemplified by but not limited to RGD, EILDVjVCAM- 1 and their recombined or synthetic analogs, enzymes, enzyme inhibitors, polypeptides, antimicrobial peptides ( exemplified by but not limited to defensins, magaignins, cathelocidins, bactenicin) anti-infective agents including silver containing compounds (e.g., ionic silver, elemental silver, silver nanoparticles, and formulations thereof), buffering agents, vitamins and minerals, compounds that promote
  • trophic factors including poly
  • kits include small interfering RNAs (siRNAs-also referred to as micro RNAs) that are capable of promoting cellular behaviors conducive to the wound healing process.
  • the kits include compounds that promote/stabilize a favorable pH, osmotic environment, surface energy, surface charge, surface functionalities that enhance galvano and magneto positive effects on wound healing, or balance of MMP/other peptidase/protease activity.
  • the present invention provides a method of treatment, comprising providing a subject having a wound, at least one cationic polyelectrolyte, at least one anionic polyelectrolyte, at least one covalent modification agent, and at least one wound active agent, and contacting the wound with the at least one cationic and the at least one anionic polyelectrolytes, the at least one covalent modification agent, and the at least one wound active agent so that the at least one wound active agent is covalently linked to the wound by incorporation into a polyelectrolyte layer formed by the at least one cationic and the at least one anionic polyelectrolytes.
  • the polyelectrolytes are sequentially and repeatedly layered on the wound, then the at least one covalent modification agent and the at least one wound active agent are added.
  • the at least one cationic polyelectrolyte e.g., including, but not limited to, poly(L-lysine), poly(ethylene imine), and poly(allylamine hydrochloride and dendrimers and multi-armed polymers that present multiple amine groups
  • the at least one cationic polyelectrolyte harbors a primary amine group which allows attachment of the at least one covalent modification agent to the at least one cationic polyelectrolyte.
  • the at least one cationic polyelectrolyte is polylysine and the at least one anionic polyelectrolyte is polyglutamic acid.
  • the at least one anionic polyelectrolyte e.g., including, but not limited to, poly(L-glutamic acid), poly(sodium 4-styrenesulfonate), poly(acrylic acid), poly(maleic acid-co-propylene), hyaluronic acid, chondroitin, and poly(vinyl sulfate)
  • the at least one anionic polyelectrolyte is polyglutamic acid.
  • the at least one covalent modification agent is a heterobifunctional cross-linker (e.g., including, but not limited to, N-succinimidyl 3-(2-pyridyldithio)propionate, succinimidyl 6-(3-[2- pyridyldithio]-propionamido)hexanoate, sulfosuccinimidyl 6-(3'-[2-pyridyldithio]- propionamido)hexanoate, succinimidyloxycarbonyl-a-methyl-a-(2-pyridyldithio)toluene, sulfosuccinimidyl-6-[a-methyl-a-(2-pyridyldithio)toluamido]hexanoate, succinimidyl 4-(N- maleimidomethyl)cyclohexane- 1 -carboxylate, sulfo
  • the at least one covalent modification agent is a homobifunctional cross-linker.
  • the homobifunctional cross-linker is an N-hydroxysuccinimidyl ester (e.g., including, but not limited to, disuccinimidyl ester, dithiofo ' s(succinimidylpropionate), 3,3 '- dithiote(sulfosuccinimidyl-propionate), disuccinimidyl suberate,
  • the at least one covalent modification agent can be at a concentration between 1 nanomolar and 10 millimolar. In some preferred embodiments, the at least one covalent modification agent is at a concentration between 10 micromolar to 1 millimolar.
  • the at least one covalent modification agent is te(sulfosuccinimidyl)suberate (for example, in aqueous solution at a concentration between 1 nM and 10 mM).
  • the at least one covalent modification agent comprises N-hydroxysuccinimidyl ester.
  • the at least one wound active agent contains the peptide sequence gly-arg-gly-asp-ser-pro-lys.
  • a first at least one anionic or cationic polyelectrolyte is contacted with the at least one covalent modification agent and the at least one wound active agent before contacting with the wound bed and oppositely charged at least one cationic or anionic polyelectrolyte.
  • the first at least one anionic polyelectrolyte is polyglutamic acid
  • the at least one covalent modification agent is N- hydroxysuccinimidyl ester
  • the at least one wound active agent contains a primary amine (e.g., including, but not limited to, the peptide sequence gly-arg-gly-asp-ser-pro-lys).
  • the first at least one cationic polyelectrolyte is polylysine
  • the at least one covalent modification agent is N-succinimidyl 3-(2-pyridyldithio)propionate
  • the at least one wound active agent contains the peptide sequence gly-arg-gly-asp-ser-pro-cys.
  • kits for treating a subject having a wound comprising at least one cationic polyelectrolyte, at least one anionic polyelectrolyte, at least one covalent modification agent, at least one wound active agent; and instructions for using the kit to covalently link the at least one wound active agent to the wound by incorporation into a polyelectrolyte layer that is formed by the at least one cationic and anionic
  • the incorporation of the at least one wound active agent is achieved by sequential and repeated layering of the polyelectrolytes, followed by addition of the at least one covalent modification agent and the at least one wound active agent.
  • a first at least one anionic or cationic polyelectrolyte is contacted with the at least one covalent modification agent and the at least one wound active agent before contacting with the wound bed and oppositely charged at least one cationic or anionic polyelectrolyte.
  • the at least one cationic polyelectrolyte includes, but is not limited to, poly(L-lysine), poly(ethylene imine), and poly(allylamine hydrochloride).
  • the at least one anionic polyelectrolyte includes, but is not limited to, poly(L-glutamic acid), poly(sodium 4-styrenesulfonate), poly(acrylic acid), poly(maleic acid-co-propylene), and poly(vinyl sulfate).
  • the at least one covalent modification agent is a homobifunctional cross-linker.
  • the homobifunctional cross-linker is an N-hydroxysuccinimidyl ester (e.g., including, but not limited to, disuccinimidyl ester, dithiobis(succinimidylpropionate), 3,3 '- dithiobis(sulfosuccinimidylpropionate), disuccinimidyl suberate,
  • N-hydroxysuccinimidyl ester e.g., including, but not limited to, disuccinimidyl ester, dithiobis(succinimidylpropionate), 3,3 '- dithiobis(sulfosuccinimidylpropionate), disuccinimidyl suberate,
  • the at least one covalent modification agent is a heterobifunctional cross-linker (e.g., including, but not limited to, N-succinimidyl 3-(2- pyridyldithio)propionate, succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate, sulfosuccinimidyl 6-(3'-[2-pyridyldithio]-propionamido)hexanoate,
  • the at least one wound active agent includes, but is not limited to, trophic factors, extracellular matrices, enzymes, enzyme inhibitors, defensins, polypeptides, anti-infective agents (including but not limited to silver (e.g., ionic silver, elemental silver, silver nanoparticles, and formulations thereof)), buffering agents, vitamins and minerals, analgesics, anticoagulants, coagulation factors, antiinflammatory agents, vasoconstrictors, vasodilators, diuretics, and anti-cancer agents.
  • the present invention also provides a method of treatment, comprising providing a subject having a wound, at least one cationic polyelectrolyte, at least one anionic
  • the method further comprises contacting the wound with an additional wound active agent (including but not limited to an anti-infective agent (e.g., ionic silver, elemental silver, silver nanoparticles, and formulations thereof.)
  • an additional wound active agent including but not limited to an anti-infective agent (e.g., ionic silver, elemental silver, silver nanoparticles, and formulations thereof.)
  • the present invention further provides a kit for treating a subject having a wound, comprising: at least one cationic polyelectrolyte, at least one anionic polyelectrolyte, at least one DNA delivery agent, at least one DNA species, and instructions for using the kit to deliver the at least one DNA species to the wound using the at least one DNA delivery agent and a polyelectrolyte layer formed by the at least one cationic and anionic polyelectrolytes.
  • the kit further comprises an additional wound active agent (including but not limited to an anti-infective agent (e.g., ionic silver, elemental silver, silver nanoparticles, and formulations thereof.)
  • the present invention also provides a method of treatment, comprising providing a subject having a wound, a cationic and anionic polyelectrolyte mixture, a deprotection agent, at least one covalent modification agent, and at least one wound active agent; contacting the wound with the polyelectrolyte mixture to form a polyelectrolyte layer on the wound;
  • the anionic and cationic polyelectrolyte mixture is made up of polylactic acid and poly(epsilon-CBZ-L-lysine), blended at an 80:20 ratio.
  • the deprotection occurs by acid hydrolysis.
  • the at least one covalent modification agent is SP3.
  • the present invention also provides a composition
  • a composition comprising a deprotected polyelectrolyte, functionalized with at least one covalent modification agent containing an active group that is exposable to at least one wound active agent.
  • the deprotected polyelectrolyte is comprised of polylactic acid and poly(epsilon-CBZ-L-lysine), blended at an 80:20 ratio.
  • the at least one covalent modification agent is SP3.
  • the present invention also provides a method of treatment, comprising providing a subject having a wound, a cationic and anionic polyelectrolyte mixture, a deprotection agent, at least one covalent modification agent, a first polypeptide, and at least one wound active agent linked to a second polypeptide; contacting the wound with the polyelectrolyte mixture to form a polyelectrolyte layer on the wound; applying the deprotection agent to the polyelectrolyte layer to form a deprotected polyelectrolyte layer; applying the at least one covalent modification agent to the deprotected polyelectrolyte layer to form a modified deprotected polyelectrolyte layer; applying the first polypeptide to the modified deprotected polyelectrolyte layer to covalently link the first polypeptide to the modified deprotected polyelectrolyte layer; and applying the at least one wound active agent linked to the second polypeptide to the modified deprotected poly
  • the specific protein binding occurs between biotin and a polypeptide (e.g., including, but not limited to, avidin, neutravidin, and streptavidin). In other preferred embodiments, the specific protein binding occurs between glutathione-S-transferase and glutathione. In yet other preferred embodiments, the specific protein binding occurs between nickel-nitrilotriacetic acid and polyhistidine. In some embodiments, the at least one covalent modification agent is SP3.
  • the present invention further provides a composition comprising a deprotected polyelectrolyte functionalized with at least one covalent modification agent linked to a first polypeptide that interacts by specific binding with a second polypeptide linked to at least one wound active agent.
  • the specific binding occurs between biotin and a polypeptide (e.g., including, but not limited to, avidin, neutravidin, and streptavidin).
  • the specific binding occurs between glutathione-S-transferase and glutathione.
  • the specific protein binding occurs between nickel-nitrilotriacetic acid and polyhistidine.
  • the present invention also provides a method of treatment, comprising providing a subject having a wound, a cationic and anionic polyelectrolyte mixture, a deprotection agent, at least one covalent modification agent, at least one molecule containing an azide group, and at least one wound active agent containing an alkyne group; contacting the wound with the polyelectrolyte mixture to form a polyelectrolyte layer on the wound; applying the deprotection agent to the polyelectrolyte layer to form a deprotected polyelectrolyte layer; applying the at least one covalent modification agent to the deprotected polyelectrolyte layer to form a modified deprotected polyelectrolyte layer; applying the at least one molecule containing an azide group to the modified deprotected polyelectrolyte layer to covalently link the at least one molecule containing an azide group to the modified deprotected
  • the polyelectrolyte layer ; and applying the at least one wound active agent containing an alkyne group to the modified deprotected polyelectrolyte layer covalently linked to the at least one molecule containing an azide group, so that the at least one wound active agent is attached to the wound by click chemistry.
  • the at least one molecule containing an azide group has the formula H 2 (CH 2 CH 2 0)2 3.
  • the at least one wound active agent is L-propargylglycine.
  • the reaction is carried out in the presence of Cu(I).
  • the present invention further provides a composition comprising a deprotected polyelectrolyte functionalized with at least one covalent modification agent linked to at least one molecule containing an azide group that is attached by click chemistry to at least one wound active agent containing an alkyne group.
  • the present invention further provides a kit for treating a subject having a wound, comprising a cationic and anionic polyelectrolyte mixture, a deprotection agent, at least one covalent modification agent, at least one wound active agent, and instructions for using the kit to covalently link the at least one wound active agent to the wound by deprotection of the polyelectrolyte mixture contacted to the wound, followed by addition of the at least one covalent modification agent and the at least one wound active agent.
  • the polyelectrolyte mixture comprises polylactic acid and poly(epsilon-CBZ- L-lysine).
  • the deprotection agent causes deprotection by acid hydrolysis of the polyelectrolyte mixture.
  • the at least one covalent modification agent is SP3.
  • the kit also contains a first and a second polypeptide that interact with each other by specific protein binding.
  • the first polypeptide is linked to either the at least one covalent modification agent or the at least one wound active agent and the second polypeptide is linked to the other at least one covalent modification agent or the at least one wound active agent.
  • the first polypeptide is biotin and the second polypeptide is avidin, neutravidin, or streptavidin.
  • the first polypeptide is glutathione-S-transferase and the second polypeptide is glutathione.
  • the first polypeptide is nickel-nitrilotriacetic acid and the second polypeptide is polyhistidine.
  • the kit contains at least one molecule containing an azide group that is attached to the polyelectrolyte mixture after deprotection so that at least one wound active agent containing an alkyne group can be attached to the wound by click chemistry.
  • the present invention further provides a method of treatment, comprising providing a subject having a wound, at least one cationic polyelectrolyte, at least one anionic
  • the polyelectrolytes are sequentially and repeatedly layered on the wound.
  • the at least one anionic polyelectrolyte e.g., including, but not limited to, polyglutamic acid
  • the at least one modifying agents are ethylene dichloride and HSCH 2 PI1.
  • the present invention also provides a composition
  • a composition comprising a polyelectrolyte layer that is functionalized with at least one modifying agent that is exposable to native chemical ligation with at least one wound active agent containing an amino terminal cysteine residue.
  • the present invention also provides a kit for treating a subject having a wound, comprising at least one cationic polyelectrolyte, at least one anionic polyelectrolyte, at least one modifying agent, at least one wound active agent containing an amino terminal cysteine residue, and instructions for using the kit to form a polyelectrolyte layer on the wound, followed by treatment with the at least one modifying agent and attachment of the at least one wound active agent by native chemical ligation.
  • the at least one anionic polyelectrolyte is polyglutamic acid.
  • the at least one modifying agents are ethylene dichloride and HSCH 2 PI1.
  • the present invention provides methods of treatment comprising: a) providing a subject having a wound, at least one wound modifying agent, and at least one wound active agent; b) contacting the wound with the at least one wound modification agent to provide a modified wound bed, and c) contacting the modified wound bed with the at least one wound active agent under conditions such that the at least one wound active agent is incorporated into the modified wound bed and healing of the wound is enhanced.
  • the modified wound bed is modified to present a functionalized surface reactive with the at least one wound active agent.
  • the wound active agent is applied to the modified wound bed to form a gradient.
  • the wound modifying agent alters a property of the wound bed selected from the group consisting of compliance, pH, alkalinity, and oxidative or reductive strength, net charge, hydrophilicity, osmotic strength, nanoscale or submicron topographic features, electroconductivity, MMP production, phagocytosis, and
  • the wound modifying agent is applied to the wound bed by a method selected from the group consisting of coating, sprinkling, seeding, electrospinning, spattering, stamping, spraying, pumping, painting, smearing and printing.
  • the at least one wound modification agent is at least one crosslinker.
  • the at least one crosslinker is selected from the group consisting of a homobifunctional crosslinker, a heterobifunctional cross linker, a hetero- and homo- multifunctional crosslinker, and a photoactivatable crosslinker and combinations thereof.
  • the heterobifunctional crosslinker comprises an alkyne group.
  • the wound modifying agent comprises at least one polymer.
  • the at least one polymer is applied to the wound bed to form a polymer multilayer.
  • the at least one polymer is selected from the group consisting of a cationic polymer, an anionic polymer, a nonionic polymer an amphoteric polymer and combinations thereof.
  • the methods further comprise contacting the polymer multilayer with a crosslinker to form a functionalized surface reactive with the at least one wound active agent.
  • the at least one polymer is a polyelectrolyte multilayer preformed on a support so that the polyelectrolyte multilayer can be transferred from the support to the wound bed to form a modified wound bed.
  • the support is an elastomeric support.
  • the polymer multilayer is from 1 nm to 250 nm thick. In some embodiments, the polymer multilayer has a compliance of from 3 to 500 kPa. In some embodiments, the wound modifying agent is selected from the group consisting of nanoparticles and microparticles. In some
  • the nano- and microparticles are functionalized.
  • the functionalized bead is a mesoscopic cross-linker.
  • the at least one wound active agent is selected from the group consisting of trophic factors, extracellular matrices, enzymes, enzyme inhibitors, defensins, polypeptides, anti-infective agents, buffering agents, vitamins and minerals, analgesics, anticoagulants, coagulation factors, antiinflammatory agents, vasoconstrictors, vasodilators, diuretics, and anti-cancer agents.
  • kits for treating a subject having a wound comprising: a) at least one wound modification agent, b) at least one wound active agent; and c) instructions for using the kit to treat a wound bed with the at least one wound modification agent to provide a modified wound bed and for incorporating the wound active agent into the modified wound bed.
  • the at least one wound modification agent is selected from the group consisting of a covalent modifying agent, at least one polyelectrolyte, microparticle, nanoparticle, and combinations thereof.
  • the present invention provides methods of treatment comprising: a) providing a subject having a wound, i) a cationic and anionic polyelectrolyte mixture, ii)a deprotection agent, iii) at least one covalent modification agent, iv) at least one molecule containing an azide group or alkyne group, and v) at least one wound active agent containing the other of an azide group or an alkyne group; b) contacting the wound with the polyelectrolyte mixture to form a polyelectrolyte layer on the wound; c) applying the deprotection agent to the polyelectrolyte layer to form a deprotected polyelectrolyte layer; d) applying the at least one covalent modification agent to the deprotected polyelectrolyte layer to form a modified deprotected polyelectrolyte layer; e) applying the at least one molecule containing an azide group or an alkyn
  • the present invention provides a composition comprising a deprotected polyelectrolyte functionalized with at least one covalent modification agent linked to at least one molecule containing an azide group that is attached by click chemistry to at least one wound active agent containing an alkyne group.
  • the present invention provides methods comprising a) providing a subject having a wound, a plurality of functionalized beads and at least one cytoactive factor, b) contacting the at least one cytoactive factor with the at least one functionalized biocompatible bead such that the at least one cytoactive factor is linked to the at least one functionalized biocompatible bead and c) applying the at least one functionalized biocompatible bead linked to the at least one cytoactive factor to a wound bed of the subject.
  • the present invention provides methods of treatment comprising: a) providing a subject having a wound, at least one polymer, and at least one wound active agent b) applying the at least one polymer to the wound so that a polymer multilayer is formed on the wound; and c) incorporating the at least one wound active agent into the polymer multilayer during application of the at least one polymer, wherein the at least one wound active agent forms a gradient in the polymer multilayer.
  • the present invention provides an article comprising a matrix formed from a biocompatible material, the matrix comprising at least one wound active agent, wherein the matrix is from 1 to 500 nm in thickness and has a compliance of from 3 to 500 kPa.
  • the matrix is functionalized.
  • the biocompatible material is selected from the group consisting of proteins and polymers.
  • the polymers are selected from the group consisting of polyanionic polymers, polycationic polymers, uncharged polymers, and amphoteric polymers and combinations thereof, and wherein the polymers from a multilayer.
  • the proteins are extracellular matrix proteins selected from the group consisting of laminin, vitronectin, fibronection, keratin, collagen, and combinations thereof.
  • the matrix is supported by a solid support selected from the group consisting of silicone, siloxane elastomers, latex, nylon, nylon mesh, biological tissue, silk, polyurethane, Teflon, polyvinyl alcohol membranes, and polyethylene oxide membranes.
  • the at least one wound active agent is distributed on the matrix so that a gradient is formed.
  • the matrix is at least partially PEGylated.
  • the present invention provides methods comprising, applying the articles described above to a wound on a subject, wherein the article enhances healing of the wound.
  • kits comprising the articles described above in a sterile package.
  • the compositions and methods described above enhance wound healing.
  • wound healing may be enhanced in a variety of ways.
  • the compositions and methods minimize contracture of the wound as to best favor function and cosmesis.
  • compositions and methods promote wound contracture to best favor function and cosmesis.
  • the compositions and methods promote vascularization.
  • the compositions and methods inhibit vascularization.
  • the compositions and methods promote fibrosis.
  • the compositions and methods inhibit fibrosis.
  • the compositions and methods promote epithelial coverage.
  • the compositions and methods inhibit epithelial coverage.
  • compositions and methods of the present invention modulates one or properties of cells in the wound environment or in the immediate vicinity of the wound.
  • the properties that are modulated, e.g., are increased or decreased include, but are not limited to adhesion, migration, proliferation, differentiation, extracellular matrix secretion, phagocytosis, MMP activity, contraction, and combinations thereof.
  • the present invention provides for the use of any of the compositions described above or elsewhere herein to enhance healing of a wound or modulate one or more properties of cells in the wound environment or in the immediate vicinity of the wound.
  • the present invention provides for the use of a combination of a wound modifying agent and wound active agent to enhance healing of a wound to enhance healing of a wound or modulate one or more properties of cells in the wound environment or in the immediate vicinity of the wound.
  • the present invention provides for the use of the articles described above to enhance healing of a wound or modulate one or more properties of cells in the wound environment or in the immediate vicinity of the wound.
  • the present invention provides an article or composition comprising a polymer multilayer comprising at least one polymer, the polymer multilayer having associated therewith particles selected from the group consisting of nanoscale and microscale particles.
  • the at least one polymer is selected from the group consisting of a cationic polymer, an anionic polymer, a nonionic polymer an amphoteric polymer and combinations thereof.
  • the polymer multilayer is from 1 nm to 500 nm thick, preferably from 1 nm to 250 nm thick.
  • the polymer multilayer has a compliance of from 3 kPa to 500 kPa, 3 kPa to 10 MPa, or 3 kPa to 5 GPa.
  • the particles are polymeric particles. In some embodiments, the particles are selected from the group consisting of spherical, ovoid, and cylindrical shaped particles. In some embodiments, the diameter of the particles is greater than the thickness of the polymer multilayer.
  • the articles or compositions comprise at least one wound active agent in association with the composition.
  • the wound active agent is selected from the group consisting of antimicrobials, trophic factors, extracellular matrices, enzymes, enzyme inhibitors, defensins, polypeptides, anti-infective agents, buffering agents, vitamins and minerals, analgesics, anticoagulants, coagulation factors, antiinflammatory agents, vasoconstrictors, vasodilators, diuretics, and anti-cancer agents.
  • the wound active agent is dispersed in the polymer multilayer.
  • the wound active agent is covalently associated with the polymer multilayer.
  • the particles are functionalized.
  • the wound active agent is attached to the particles. In some embodiments, the wound active agent is contained within the particle.
  • the polymer layer is disposed on a support.
  • the support is a polymeric support.
  • the polymeric support is a polymer composition that is distinct from the polymer multilayer.
  • the polymeric support is an elastomeric polymer.
  • the polymeric support and the polymer multilayer are separated by a water soluble material.
  • the polymeric support is water soluble.
  • the water soluble support comprises polyvinyl alcohol.
  • the support is a wound dressing.
  • the support is a biologic wound dressing.
  • the polymer multilayer is deposited onto the support by a method selected from the group consisting of adsorption from solution, spin coating, and spray coating.
  • the particles have an elastic modulus of from about 0.5 to about 10 GPa.
  • the particles are interspersed or dispersed in the polymer multilayer.
  • the particles are displayed on a surface of the polymer multilayer.
  • the particles are underneath the polymer multilayer.
  • the particles are between the polymer multilayer and the support.
  • the particles are on the surface of the polymer multilayer and have a diameter that is greater than the thickness of the polymer multilayer, and wherein the article further comprises an antimicrobial silver composition.
  • the present invention provides methods of modifying a surface comprising contacting a surface with a polymer multilayer comprising at least one polymer, the polymer multilayer having associated therewith particles selected from the group consisting of nanoscale and microscale particles under conditions such that the polymer multilayer is transferred to the surface.
  • pressure is applied to the polymer multilayer to effect transfer to the surface.
  • the pressure is from about 10 to about 500 kPa.
  • the polymer multilayer is disposed on a support.
  • the support is from about 1 micrometer to about 10mm in thickness.
  • the surface is a wound dressing.
  • the wound dressing is a biologic wound dressing.
  • the polymer multilayer is deposited on the support by a process selected from the group consisting of adsorption from solution, spraying, and spin coating.
  • the support is an elastomeric support.
  • the surface is a soft or compliant surface.
  • the soft surface has an elastic modulus of from about 10 to about 100 kPa.
  • the soft surface is a biological surface.
  • the biological surface is selected from the group consisting of skin, a wound bed, hair, a tissue surface, and an organ surface.
  • the biological surface comprises molecules selected from the group consisting of a proteins, a lipids, a carbohydrates, and combinations thereof.
  • the surface comprises (e.g., is coated with or displays) with glycosaminoglycans, collagen and/or hyaluronic acid.
  • the surface is a surface on a biomedical device.
  • the surface is a silicone surface.
  • the at least one polymer is selected from the group consisting of a cationic polymer, an anionic polymer, a nonionic polymer an amphoteric polymer and combinations thereof.
  • the polymer multilayer is from 1 nm to 500nm thick.
  • the polymer multilayer has a compliance of from 3 kPa to 500 kPa, 3 kPa to 10 MPa, or 3 kPa to 5 GPa.
  • the particles are polymeric particles.
  • the diameter of the particles is greater than the thickness of the polymer multilayer.
  • the particles are selected from the group consisting of spherical, ovoid, and cylindrical shaped particles.
  • the polymer multilayer comprises at least one wound active agent.
  • the wound active agent is selected from the group consisting of trophic factors, extracellular matrices, enzymes, enzyme inhibitors, defensins, polypeptides, anti-infective agents, buffering agents, vitamins and minerals, analgesics, anticoagulants, coagulation factors, antiinflammatory agents, vasoconstrictors, vasodilators, diuretics, antimicrobial agents, growth factors, oligopeptides, saccharides, polysaccharides, synthetic molecules comprising a biological moiety, metal particles, electrodes, magnetic particles, honey, and anti-cancer agents.
  • the wound active agent is dispersed in the polymer multilayer.
  • the wound active agent is covalently associated with the polymer multilayer.
  • the particles are functionalized.
  • the wound active agent is attached to the particles.
  • the particles have an elastic modulus of from about 0.5 to about 10 GPa.
  • the particles are dispersed in the polymer multilayer.
  • the particles are displayed on a surface of the polymer multilayer.
  • the transfer is done in the substantial absence of a solution or a liquid solvent. In some embodiments, the transfer is a substantially or completely dry transfer. In some embodiments, the transfer is performed through a gas phase. In some embodiments, the transfer is performed in an environment where the humidity is less than 100% of saturation. In some embodiments, the transfer is performed in the absence of liquid water.
  • the present invention provides an article or composition comprising a polymer multilayer loaded with an antimicrobial silver composition in the amount of about 100 to about 500 ⁇ g/cm 2 of the polymer multilayer and/or having a releasable antimicrobial silver composition incorporated therein, wherein the releasable antimicrobial silver composition is releasable in an amount of about 0.01 and 100 ⁇ g/cm 2 of the polymer multilayer per day. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 100 ⁇ g/cm 2 of the polymer multilayer per day.
  • the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 20 ⁇ g/cm 2 of the polymer multilayer per day. In some embodiments, the antimicrobial silver composition is releasable in an amount of about 0.05 and 5 ⁇ g/cm 2 of the polymer multilayer per day. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 2 ⁇ g/cm 2 of the polymer multilayer per day. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 1 ⁇ g/cm 2 of the polymer multilayer per day.
  • the releasable antimicrobial silver composition is releasable in an amount of about 0.1 to 0.5 ⁇ g/cm 2 of the polymer multilayer per day.
  • the antimicrobial silver composition comprises silver nanoparticles.
  • the silver nanoparticles are zerovalent silver nanoparticles.
  • the composition provides at least 99.99% killing of Staphylococcus epidermis.
  • the article does not substantially impair the healing of wounds.
  • the antimicrobial silver composition permits at least 90% viability of NIH-3T3 cells.
  • the viability is assessed after 24 h of incubation of the NIH-3T3 cells on the composition in the presence of growth media.
  • the article is a film.
  • the article is a three-dimensional object, at least a portion of which is coated with the polymer multilayer.
  • the three- dimensional object is a medical device.
  • the article is selected from the group consisting of a polymeric support, an elastomeric support, a wound care device, a wound dressing and a biologic wound dressing.
  • the medical device partially contacts a subject.
  • the medical device is completely implanted in a subject.
  • the at least one of the polymers comprises poly(allylamine hydrochloride).
  • at least one of the polymers comprises poly(acrylic acid).
  • the articles or compositions further comprise at least one additional antimicrobial agent.
  • the present invention provides a method for treating a wound comprising providing a subject with a wound and contacting the wound with an article or composition as described above.
  • kits for the treatment of a wound in a subject comprising an article or composition as described above and instructions for applying the article to the wound.
  • the kits further comprise additional wound dressing material.
  • the wound dressing material is a biologic wound dressing.
  • the present invention provides an article or composition comprising a solid support comprising a releasable antimicrobial silver composition, wherein the releasable antimicrobial silver composition is loaded at an amount of from 1 to about 500 ⁇ g/cm 2 of the solid support and/or releasable in an amount of about 0.01 and 100 ⁇ g/cm 2 of the solid support per day.
  • the solid support is selected from the group consisting of a polymeric support, an elastomeric support, nanoparticles, microparticles, a wound dressing and a biologic wound dressing.
  • the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 100 ⁇ g/cm 2 of the solid support per day. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 20 ⁇ g/cm 2 of the solid support per day. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 5 ⁇ g/cm 2 of the solid support per day. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 2 ⁇ g/cm 2 of the solid support per day.
  • the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 1 ⁇ g/cm 2 of the solid support per day. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.1 to 0.5 ⁇ g/cm 2 of the solid support per day. In some embodiments, the antimicrobial silver composition comprises silver nanoparticles. In some embodiments, the silver nanoparticles are zerovalent silver nanoparticles. In some embodiments, the article does not substantially impair the healing of wounds. In some embodiments, the articles or compositions further comprise at least one additional antimicrobial agent. In some embodiments, the present invention provides methods for treating a wound comprising providing a subject with a wound and contacting the wound with the article or composition as described above.
  • the present invention provides methods for synthesizing a composition for treatment of a wound, comprising: a) assembling alternating layers of polymers to form a film or coating and b) during the assembling, incorporating an
  • antimicrobial silver composition into the alternating layers of polymers.
  • the present invention provides methods for synthesizing a composition for treatment of a wound, comprising: a) assembling alternating layers of polymers to form a film or coating; b) incubating the film or coating in bulk solution of a silver salt; c) exposing the film or coating to a reducing agent; and d) selecting films or coatings for use having a silver loading level between 0.01 and 100 ⁇ g/cm 2 .
  • at least one of the polymers comprises a solution containing poly(allylamine hydrochloride).
  • at least one of the polymers comprises a solution containing poly(acrylic acid).
  • the bulk solution of a silver salt comprises silver nitrate.
  • the concentration of Ag + in the silver nitrate solution is from 0.005 mM to 5 mM.
  • the pH of the poly(acrylic acid) solution is from 2.5 to 7.5.
  • the present invention provides a solid support; and a polymer multilayer supported by the solid support, the polymer multilayer comprising at least one wound active agent.
  • the article further comprises a water soluble material between the solid support and the polymer multilayer.
  • the solid support comprises a polymer.
  • the polymer is an elastomeric polymer.
  • the elastomeric polymer is a silicon polymer.
  • the silicon polymer is selected from the group consisting of
  • the polymer multilayer has a thickness of from about 1 nm to 500 nm. In some embodiments, the polymer multilayer has a compliance of from about 3 kPa to 5 GPa, preferably about 3 kPa to 500 kPa. In some embodiments, the polymer multilayer comprises nanoscale to microscale particles incorporated therein. In some embodiments, the particles have a diameter that is greater than thickness of the polymer multilayer. In some embodiments, the at least one wound active agent is an antimicrobial silver composition. In some embodiments, the silver loading of the polyelectrolyte multilayer is between about 0.01 and 500 ⁇ g/cm 2 of the antimicrobial silver composition.
  • the antimicrobial silver composition comprises silver nanoparticles. In some embodiments, the silver nanoparticles are zerovalent silver nanoparticles. In some embodiments, the antimicrobial silver composition comprises multivalent silver ions carried by zirconium phosphate.
  • the solid support comprises a material selected from the group consisting of a foam, a transparent thin film, a hydrogel, hydrofibers, hydrocolloids, alginate fibers, and combinations thereof. In some embodiments, the solid support comprises a material selected from the group consisting of super absorbent polymers (SAP), silica gel, sodium polyacrylate, potassium
  • the solid support comprises an absorbent material.
  • the polymer multilayer is transferred to the support in the substantial absence of a solvent.
  • the absorbent material is selected from the group consisting of a fabric, e.g., cotton or nylon gauze, and polymer foam.
  • the absorbent material comprises a first surface comprising an anti-adherent material.
  • the polymer multilayer is deposited on the first surface comprising an anti-adherent material.
  • the absorbent material comprises a second surface fixed to an adhesive material.
  • the adhesive material is sized to extend from one or more edges of the absorbent material so that the absorbent material can be exposed to the skin of a subject.
  • the article further comprises a removable sheet, wherein the article is removably affixed to the removable sheet.
  • the article is packaged in a sterile package.
  • the polymer multilayer has a thickness of from about 1 nm to 500 nm. In some embodiments, the polymer multilayer has a compliance of from about 3 to 500 kPa. In some embodiments, the polymer multilayer comprises nanoscale to microscale particles incorporated therein.
  • the at least one wound active agent is an antimicrobial silver composition.
  • the silver loading of the polyelectrolyte multilayer is between about 0.01 and 500 ⁇ g/cm 2 of the antimicrobial silver composition.
  • the antimicrobial silver composition comprises silver nanoparticles.
  • the silver nanoparticles are selected from the group consisting of zerovalent silver nanoparticles and multivalent silver ions (carried by zirconium phosphate).
  • the solid support comprises a biologic wound dressing.
  • the biologic wound dressing comprises (e.g., is coated with or displays) a biological molecule selected from the group consisting of collagen, hyaluronic acid, glycosaminoglycans, keratin, fibronectin, vitronectin, laminin, and combinations or fragments thereof.
  • the biopolymer is supported on a silicone film.
  • the silicone film comprises a fabric support.
  • the fabric support is a nylon fabric support.
  • the polymer multilayer is deposited on the silicone film. In some embodiments, the polymer multilayer has a thickness of from about 1 nm to 500 nm.
  • the polymer multilayer has a compliance of from about 3 to 500 kPa. In some embodiments, the polymer multilayer comprises nanoscale to microscale particles incorporated therein. In some embodiments, the particles have a diameter that is greater than the thickness of the polymer multilayer. In some embodiments, the at least one wound active agent is an antimicrobial silver composition. In some embodiments, the silver loading of the polyelectrolyte multilayer is between about 0.01 and 500 ⁇ g/cm 2 of the antimicrobial silver composition. In some embodiments, the antimicrobial silver composition comprises silver nanoparticles. In some embodiments, the silver nanoparticles are selected from the group consisting of zerovalent and multivalent silver nanoparticles.
  • the present invention provides processes for manufacture of a nanoscale polymer matrix microsheet comprising: a) forming a nanoscale polymer layer about 0.5 nm to 1000 nm thick on a substrate; b) introducing a bioactive agent into the nanoscale polymer layer to provide a bioactive nanoscale polymer layer; c) forming a sacrificial polymer layer on the bioactive nanoscale polymer layer, wherein the sacrificial polymer layer is dissolvable.
  • the present invention provides a process for manufacture of a nanoscale polymer matrix microsheet comprising: a) forming a nanoscale polymer layer about 0.5 nm to 1000 nm thick on a substrate; b) introducing a bioactive agent into the nanoscale polymer layer to provide a bioactive nanoscale polymer layer; and c) forming a second polymer layer on the bioactive nanoscale polymer layer, wherein the second polymer layer is formed from a polymer different from the nanoscale polymer layer.
  • the present invention provides a process for manufacture of a nanoscale polymer matrix microsheet comprising: a) forming a nanoscale polymer layer about 0.5 nm to 1000 nm thick on a substrate; b) forming a second polymer layer on the nanoscale polymer layer by spin coating, wherein the second polymer layer is formed from a different polymer than the nanoscale polymer layer.
  • the bioactive agent is a wound active agent.
  • the nanoscale polymer matrix is a polymer multilayer. In some embodiments, the nanoscale polymer matrix is formed by alternating layers of at least one positively charged electrolyte and at least one negatively charged polyelectrolyte. In some
  • the at least one positively charged polyelectrolyte is selected form the group consisting of poly(allylamine hydrochloride) (PAH), polyl- lysine (PLL), poly(ethylene imine) (PEI), poly(histidine), poly( ,N-dimethyl aminoacrylate), poly(N,N,N- trimethylaminoacrylate chloride), poly(methyacrylamidopropyltrimethyl ammonium chloride), and natural or synthetic polysaccharides such as chitosan.
  • PAH poly(allylamine hydrochloride)
  • PLL polyl- lysine
  • PEI poly(ethylene imine)
  • PHI poly(histidine)
  • poly(N,N,N- trimethylaminoacrylate chloride) poly(methyacrylamidopropyltrimethyl ammonium chloride)
  • natural or synthetic polysaccharides such as chitosan.
  • the at least one negatively charged polyelectrolyte is selected from the group consisting of poly(acrylic acid) (PAA), poly(styrenesulfonate) (PSS), alginate, hyaluronic acid, heparin, heparan sulfate, chondroitin sulfate, dextran sulfate, poly(methacrylic acid), oxidized cellulose, carboxymethyl cellulose, polyaspartic acid, and polyglutamic acid.
  • PAA poly(acrylic acid)
  • PSS poly(styrenesulfonate)
  • alginate hyaluronic acid
  • heparin heparan sulfate
  • chondroitin sulfate chondroitin sulfate
  • dextran sulfate poly(methacrylic acid)
  • oxidized cellulose carboxymethyl cellulose
  • polyaspartic acid polyglutamic acid
  • the polymer multilayer is formed by applying the at least one positively charged electrolyte and at least one negatively charged polyelectrolyte by a method selected from the group consisting of spraying polymer solutions on the substrate, dip coating the substrate in polymer solutions, or spin coating polymer solutions on the substrate.
  • the at least one positively charged electrolyte and the at least one negatively charged polyelectrolyte are synthetic polyelectrolytes.
  • the bioactive agent is incorporated into the nanoscale polymer layer so that the bioactive agent is interspersed within the three dimensional structure of the nanoscale polymer layer. In some embodiments, the bioactive agent is incorporated into the nanoscale polymer multilayer so that the bioactive agent is interspersed within the layers the polymer multilayer. In some embodiments, the bioactive agent is selected from the group consisting of an antimicrobial agent, an antibiofilm agent, a growth factor, a hemostatic agent, a bioactive peptide, a bioactive polypeptide, an analgesic, an anticoagulant, antiinflammatory agent, and a drug molecule or a drug compound.
  • the antimicrobial agent is selected from the groups consisting of charged small molecule antimicrobial agents, antimicrobial polypeptides, metallic particles, and metal ion antimicrobial agents.
  • the metal ion antimicrobial agent is a metal ion, metal ion salt, or metal ion nanoparticle.
  • the metal ion nanoparticle is a silver nanoparticle.
  • the charged small molecule antimicrobial agent is selected from the group consisting of chlorhexidine, antibiotics, polyhexamethylene biguanide (PHMB), iodine, cadexomer iodine, povidone iodine (PVI), hydrogen peroxide, and vinegar (acetic acid).
  • the metal ion antibiofilm agent is a metal ion, a metal ion salt, or a metal ion nanoparticle. In some embodiments, the metal ion antibiofilm agent is a gallium salt, gallium nanoparticle, gallium alloy, or an alloy of gallium and silver.
  • the bioactive agent is introduced into the nanoscale polymer layer during the formation of the nanoscale polymer layer. In some embodiments, the bioactive agent is introduced into the nanoscale polymer layer after formation of the nanoscale polymer layer.
  • introducing a bioactive agent into the nanoscale polymer layer to provide a bioactive nanoscale polymer multilayer comprises introducing silver ions into the nanoscale polymer multilayer and reducing the silver ions in situ to provide silver nanoparticles.
  • introducing a bioactive agent into the nanoscale polymer layer to provide a bioactive nanoscale polymer multilayer comprises introducing a charged small molecule antimicrobial agent in between polyelectrolyte layers having a different charge.
  • the process comprises 1 to 20 repititions of the introducing step, e.g., to control and/or increase the amound of bioactive agent introduced into the nanoscale polymer layer.
  • the process comprises controlling the amount of the bioactive agent in the nanoscale polymer matrix microsheet by controlling the number of nanoscale polymer layers, by controlling the pH of forming the nanoscale polymer layer, and/or by controlling the number of introducing cycles.
  • the sacrificial polymer layer is from about 0.1 ⁇ thick to about 100 ⁇ thick. In some embodiments, the sacrificial polymer layer is from about 0.1 ⁇ thick to about 50 ⁇ thick. In some embodiments, the sacrificial polymer layer is from about 1 ⁇ thick to about 20 ⁇ thick. In some embodiments, the sacrificial polymer layer is from about 1 ⁇ thick to about 10 ⁇ thick. In some embodiments, the sacrificial polymer layer comprises a water soluble polymer. In some embodiments, the water soluble sacrificial polymer layer is made of and/or comprises polyvinyl alcohol (PVA). In some embodiments, the soluble polymer has a molecular weight of greater than 22 kDa. In some embodiments, the water soluble polymer is removable by renal filtration.
  • PVA polyvinyl alcohol
  • the water soluble sacrificial polymer layer is made of polyacrylic acid (PAA), polystyrene (PS), polymethyl methacrylate (PMMA), or, polyvinylacetate (PVAc).
  • PAA polyacrylic acid
  • PS polystyrene
  • PMMA polymethyl methacrylate
  • PVAc polyvinylacetate
  • the sacrificial polymer layer comprising a water soluble polymer dissolves when exposed to moisture on a surface so that the bioactive nanoscale polymer multilayer is deposited on the surface.
  • the processes further comprise introducing a bioactive agent into the sacrificial polymer layer.
  • the processes further comprise introducing microparticles or nanoparticles into the sacrificial polymer layer.
  • the microparticles or nanoparticles in the sacrificial polymer layer are loaded with bioactive agents.
  • the processes further comprise introducing magnetic microparticles or nanoparticles into the sacrificial polymer layer.
  • the bioactive agent is selected from the group consisting of an antimicrobial agent, a growth factor, a hemostatic agent, a bioactive peptide, a bioactive polypeptide, an analgesic, an anticoagulant, antiinflammatory agent, and a drug molecule or a drug compound.
  • the antimicrobial agent is selected from the goups consisting of charged small molecule antimicrobial agents, antimicrobial polypeptides, metallic particles, and metal ion antimicrobial agents.
  • the metal ion antimicrobial reagent is a metal ion, metal ion salt, or metal ion nanoparticle.
  • the metal ion nanoparticle is a silver nanoparticle.
  • the small molecule antimicrobial agent is selected from the group consisting of chlorhexidine, antibiotics, polyhexamethylene biguanide (PHMB), iodine, cadexomer iodine, povidone iodine (PVI), hydrogen peroxide, vinegar (acetic acid).
  • the substrate is selected from the group consisting of a polydimethylsiloxane (PDMS) substrate, a glass substrate, a plastic substrate, a metal substrate, and a Teflon substrate. In some embodiments, the substrate is
  • the substrate is functionalized with octadecyltricrhlorosilane.
  • the processes further comprise the step of removing the nanoscale polymer layer matrix microsheet comprising the bioactive nanoscale polymer layer and associated sacrificial polymer layer from the substrate. In some embodiments, greater than 90%, greater than 95%, greater than 97%, greater than 98%, or greater than 99% of the nanoscale polymer matrix microsheet comprising the bioactive nanoscale polymer layer and associated sacrificial polymer layer is removed from said substrate. In some embodiments, the processes further comprise incorporating nanoscale or microscale particles or beads into the nanoscale polymer layer. In some embodiments, the processes further comprise incorporating magnetic nanoparticles or microparticles into the nanoscale polymer layer.
  • the nanoscale polymer layer comprises a polymer selected from the group consisting of polyelectrolytes, lipids, proteins, collagen, hyaluornic acid, chitosan, keratin, fibronectin, vitronectin, laminin, polysaccharides, polyanhydrides, poly (lactic-co-glycolic acid) (PLGA), poly(l-lactic acid) (PLLA), and combinations thereof or fragments thereof.
  • the sacrificial polymer layer is applied to the nanoscale polymer layer by spin coating, dip coating, or spray coating.
  • the nanoscale polymer matrix microsheet has a Young modulus of from about 0.1 GPa to about 10 GPa after removal from the substrate.
  • forming the nanoscale polymer layer comprises depositing a positively charged electrolyte and a negatively charged polyelectrolyte to form a bilayer.
  • the processes comprise 2 to 50 depositing steps.
  • forming the nanoscale polymer layer comprises a step of providing solution conditions comprising a pH from 1.5 to 2.5, a pH from 6.5 to 8.5, and/or a pH from 4.5 to 6.5.
  • the processes further comprise drying the nanoscale polymer matrix microsheet.
  • the process further comprises indroducing a second or more bioactive agent(s) into the nanoscale polymer layer.
  • the present invention provides a nanoscale polymer layer matrix microsheet made by the process described above.
  • the present invention provides a wound active nanoscale polymer matrix microsheet comprising: a wound active nanoscale polymer layer about 0.5 nm to 1000 nm thick, the nanoscale wound active polymer layer having a wound active agent incorporated therein; and a sacrificial polymer layer adjacent to the wound active nanoscale polymer layer, the sacrificial polymer layer being dissolvable when exposed to a moist surface.
  • the nanoscale polymer layer is a polymer multilayer.
  • the nanoscale polymer multilayer is formed by alternating layers of at least one positively charged electrolyte and at least one negatively charged polyelectrolyte.
  • the at least one positively charged polyelectrolyte is selected form the group consisting of poly(allylamine hydrochloride) (PAH), polyl- lysine (PLL), poly(ethylene imine) (PEI), poly(histidine), poly( ,N-dimethyl aminoacrylate), poly(N,N,N- trimethylaminoacrylate chloride), poly(methyacrylamidopropyltrimethyl ammonium chloride), and natural or synthetic polysaccharides such as chitosan.
  • PAH poly(allylamine hydrochloride)
  • PLL polyl- lysine
  • PEI poly(ethylene imine)
  • poly(histidine) poly( ,N-dimethyl aminoacrylate)
  • poly(N,N,N- trimethylaminoacrylate chloride) poly(methyacrylamidopropyltrimethyl ammonium chloride)
  • natural or synthetic polysaccharides such as chitosan.
  • the at least one negatively charged polyelectrolyte is selected from the group consisting of poly(acrylic acid) (PAA), poly(styrenesulfonate) (PSS), alginate, hyaluronic acid, heparin, heparan sulfate, chondroitin sulfate, dextran sulfate, poly(meth)acrylic acid, oxidized cellulose, carboxymethyl cellulose, polyaspartic acid, and polyglutamic acid.
  • PAA poly(acrylic acid)
  • PSS poly(styrenesulfonate)
  • alginate hyaluronic acid
  • heparin heparan sulfate
  • chondroitin sulfate chondroitin sulfate
  • dextran sulfate poly(meth)acrylic acid
  • the at least one positively charged electrolyte and the at least one negatively charged polyelectrolyte are synthetic polyelectrolytes.
  • the wound active agent is incorporated into the nanoscale polymer layer so that the wound active agent is interspersed within the three dimensional structure of the nanoscale polymer layer. In some embodiments, the wound active agent is incorporated into the nanoscale polymer multilayer so that the wound active agent is interspersed within the layers the nanoscale polymer multilayer.
  • the wound active agent is selected from the group consisting of an antimicrobial agent, a growth factor, a hemostatic agent, a bioactive peptide, a bioactive polypeptide, an analgesic, an anticoagulant, anti-inflammatory agent, and a drug molecule or a drug compound.
  • the antimicrobial agent is selected from the goups consisting of small molecule antimicrobial agents, charged small molecule antimicrobial agents, antimicrobial polypeptides, metallic particles, and metal ion antimicrobial agents.
  • the metal ion antimicrobial reagent is a metal ion, metal ion salt, or metal ion nanoparticle.
  • the metal ion nanoparticle is a silver nanoparticle.
  • the charged small molecule antimicrobial agents or small molecule antimicrobial agent is selected from the group consisting of chlorhexidine, antibiotics, polyhexamethylene biguanide (PHMB), iodine, cadexomer iodine, povidone iodine (PVI), hydrogen peroxide, vinegar (acetic acid).
  • the sacrificial polymer layer is from about 0.1 ⁇ thick to about 100 ⁇ thick. In some embodiments, the sacrificial polymer layer is from about 0.1 ⁇ thick to about 50 ⁇ thick.
  • the sacrificial polymer layer is from about 1 ⁇ thick to about 20 ⁇ thick. In some embodiments, the sacrificial polymer layer is from about 1 ⁇ thick to about 10 ⁇ thick. In some embodiments, the sacrificial polymer layer comprises a water soluble polymer. In some embodiments, the sacrificial polymer layer comprises a wound active agent. In some embodiments, the wound active agent is selected from the group consisting of an
  • the antimicrobial agent is selected from the groups consisting of small molecule antimicrobial agents, antimicrobial polypeptides, metallic particles, and metal ion antimicrobial agents.
  • the metal ion antimicrobial reagent is a metal ion, metal ion salt, or metal ion nanoparticle.
  • the metal ion nanoparticle is a silver nanoparticle.
  • the small molecule antimicrobial agent is selected from the group consisting of chlorhexidine, antibiotics, polyhexamethylene biguanide (PHMB), iodine, cadexomer iodine, povidone iodine (PVI), hydrogen peroxide, and vinegar (acetic acid).
  • PHMB polyhexamethylene biguanide
  • iodine iodine
  • cadexomer iodine cadexomer iodine
  • PVI povidone iodine
  • hydrogen peroxide acetic acid
  • the microsheets further comprise nanoscale or microscale particles incorporated into the nanoscale polymer layer.
  • the nanoscale polymer layer comprises a polymer selected from the group consisting of polyelectrolytes, lipids, proteins, collagen, hyaluornic acid, chitosan, keratin, fibronectin, vitronectin, laminin, polysaccharides, polyanhydrides, poly (lactic -co-glycolic acid) (PLGA), poly(l-lactic acid) (PLLA), and combinations thereof or fragments thereof.
  • the microsheet comprises the wound active agent at a concentration of approximately 0.01 to 100 ⁇ g/cm 2 .
  • the bioactive agent is provided in an amount so that the wound active agent is released at a rate of about 0.01 and 100 ⁇ g/cm 2 per day.
  • the microsheet has an area of from about 0.2 to 600 cm 2 .
  • the sacrificial polymer layer has a uniform thickness with a variation of less than 500, 400, 300, 200, 100, 50, 20 or 10% of the average thickness when measured in cross section.
  • the microsheet has a Young modulus of from about 0.1 GPa to about 10 GPa, e.g., after removal from a substrate.
  • the sacrificial polymer layer dissolves when exposed to moisture to leave the nanoscale polymer layer on the surface.
  • the nanoscale polymer layer forms a barrier to exogenous pathogens when applied to a moist surface.
  • the microsheet further comprises a second or more wound active agent(s).
  • the microsheet is translucent and/or transparent.
  • the present invention provides a medical device comprising the microsheet described above.
  • the device comprises a surface in contact with the microsheet.
  • the medical device is selected from the group consisting of a medical device, a wound dressing, an implantable medical device, a medical device that contacts skin, a catheter, a stent, a membrane, a contact lens, and a surgical mesh.
  • the wound dressing is selected from the group consisting of a biologic wound dressing, an abiologic wound dressing, an absorbent material, a foam, a transparent thin film, a hydrogel, hydrofibers, hydrocolloids, alginate fibers, silica gel, sodium polyacrylate, potassium polyacrylamides, and combinations thereof.
  • the present invention provides a kit comprising the microsheet described above and a medical device.
  • the medical device is selected from the group consisting of a medical device, a wound dressing, an implantable medical device, a medical device that contacts skin, a catheter, a stent, a membrane, a contact lens, and a surgical mesh.
  • the wound dressing is selected from the group consisting of a biologic wound dressing, an abiologic wound dressing, an absorbent material, a foam, a transparent thin film, a hydrogel, hydrofibers, hydrocolloids, alginate fibers, silica gel, sodium polyacrylate, potassium polyacrylamides, and combinations thereof.
  • the present invention provides methods of treating a subject comprising applying the microsheet described above to a biological surface of a subject.
  • the biological surface is a moist surface.
  • the surface is selected from the group consisting of an external surface and an internal surface. In some embodiments, the surface is a wound.
  • the methods further comprise applying a wound dressing on top of the microsheet. In some embodiments, the methods further comprise applying a medical device on top of the microsheet. In some embodiments, the methods further comprise applying a surgical mesh on top of the microsheet. In some embodiments, the sacrificial polymer layer dissolves when the wound active nanoscale polymer layer article is applied to the surface leaving the wound active nanoscale polymer layer on the surface. In some embodiments, the nanoscale polymer layer acts as a barrier to exogenous pathogens. In some embodiments, the subject has a wound and application of the microsheet enhances the closure of the wound. In some embodiments, the wound active nanoscale polymer layer allows controlled release of the wound active agent.
  • the methods further comprise conforming the microsheet to the microcontours of a wound-bed of the subject.
  • the methods comprise dissolving the sacrificial polymer layer.
  • the methods comprise conforming the microsheet to the microcontours of a wound-bed of the subject within a time of from 30 seconds to an hour after dissolving the sacrificial polymer layer.
  • the dissolving dissolves greater than 90%, greater than 95%, greater than 97%, or greater than 98% of the sacrificial polymer layer during a time of from 30 seconds to 1 hour.
  • greater than 90%, greater than 95%, greater than 97%, or greater than 98% of the microsheet is transferred to the biological surface of the subject. In some embodiments, greater than 80%, greater than 85%, greater than 90%, or greater than 95% of the microsheet remains applied to the biological surface of the subject after rubbing the microsheet with a dressing. In some embodiments, greater than 80%, greater than 85%, or greater than 90% of the wound bed is covered by the microsheet after 1, after 2, after 3, after 4, or after 5 days. In some embodiments, applying the microsheet to the biological surface of the subject reduces bacterial counts on the biological surface of the subject by at least 1, 2, 3, 4, 5, or 6 log 10 . In some embodiments, applying the microsheet to the biological surface of the subject reduces Gram negative and/or Gram positive bacterial counts on the biological surface of the subject by at least 5 log 10 .
  • the methods further comprise observing a wound through the microsheet after applying the microsheet to said biological surface. In some embodiments, the methods further comprise testing the subject for wound healing and/or for wound infection. In some embodiments, the methods further comprise applying a second or more microsheet(s) to the biological surface of said subject. In some embodiments, the second microsheet comprises an amount of wound active agent based on a result of the testing step.
  • applying the microsheet to the biological surface of the subject does not affect normal growth and proliferation of epithelial cells of the subject. In some embodiments, applying the microsheet does not impair healing of a wound. In some embodiments, applying the microsheet does not cause excessive inflammation of a wound.
  • the present invention provides a process for imparting a desired bioactivity to a medical device comprising applying the wound active nanoscale polymer article to a surface of a medical device.
  • the present invention provides a nanoscale polymer microsheet comprising a first nanoscale polymer layer about 0.5 nm to 500 nm thick on a substrate having a bioactive agent incporated therein and a second polymer layer on the bioactive nanoscale polymer layer, wherein the second polymer layer is formed from a polymer different from the nanoscale polymer layer.
  • the present invention provides a nanoscale polymer microsheet comprising a first nanoscale polymer layer about 0.5 nm to 500 nm thick on a substrate and a second spin coated or dip coated polymer layer on the nanoscale polymer matrix layer.
  • Figure 1 provides a schematic of a wound bed modified with a polyelectrolyte multilayer.
  • Figure 2 provides a schematic of a wound bed modified with covalent modifying agents.
  • Figure 3 exemplifies the covalent immobilization of proteins to model amine- terminated treated glass surfaces.
  • FIG 4 shows ex vivo results for multilayer deposition of polyelectrolytes polystyrene sulfonate (PSS) and FITC-labelled poly (allylamine hydrochloride) (FITC-PAH).
  • PSS polyelectrolytes polystyrene sulfonate
  • FITC-PAH poly (allylamine hydrochloride)
  • Figure 5 demonstrates the difference in healing of full thickness cutaneous wounds in diabetic (db/db) mice compared to control (wild type) mice.
  • Figure 6 is exemplary of the use of beads for healing a wound bed.
  • carboxylic acid-terminated beads are activated outside the wound bed by using NHS and EDC.
  • the activated beads are introduced into the wound bed and are immobilized in the wound bed via reaction of the activated surfaces of the beads with amine groups present in the wound bed.
  • Growth factors are introduced into the wound bed and immobilized via reaction with the exposed surfaces of the activated beads.
  • Figure 7 provides a list of antimicrobial polypeptides, identified by name and AMSDb database ID number.
  • Figure 8 shows the viability of NIH-3T3 mouse fibroblasts after 24 hr incubation in growth media on silver-loaded polyelectrolyte multilayers (PEMs) (Example 13).
  • Figure 9 shows viable bacteria detected on silver-loaded PEMs 8 hr after incubation with 10 8 cfu/ml of S. epidermidis in buffer.
  • PEMs with varying silver loading were prepared by incubating them with serial decimal dilutions of bulk Ag + solution.
  • PEMs incubated with 5 mM Ag + (silver nitrate) solution as indicated in this figure contained -0.38 ⁇ g/cm 2 (where no cytotoxicity towards NIH-3T3 cells was observed in Figure 8), while silver loading in rest of the PEMs was below the detection limit of the elemental analysis spectrometer.
  • FIG 10 shows NIH 3T3 cells after 24 h incubation on glass surfaces coated with PEMs (10.5 bilayers of PAH7.5/PAA X ) without silver (a,c,e) or with silver nanoparticles at concentrations (b) 0.62, (d) 0.48, or (f) 0.39 ⁇ g/cm 2 .
  • PEMs were prepared with PAA solution of pH 5.5 (a, b), or 6.5 (c, d) or 7.5 (e, f).
  • Figure 1 1 provides a schematic depiction of one embodiment of polymer multilayers with microscale beads.
  • Figure 12 provides a graph depicting transfer of a polymer multilayer containing microscale beads to a soft surface as compared to transfer of a polymer multilayer without microscale beads.
  • Figure 13 provides an illustration of the fabrication of microsheets comprised of a polymer nanofilm and a sacrificial cast.
  • Figure 14 provides an illustration of application of microsheets as a microfilm wound dressing. Sacrificial cast of the microfilm dressing dissolves quickly in moist wounds and immobilizes polymer nanofilm on wound surface.
  • Figure 15 provides images of microsheets composed of a sacrificial water-soluble cast of PVA and a nanofilm made with PEMs containing silver-nanoparticles.
  • Microsheet ' ⁇ '
  • Polymer nanofilm l"xl
  • Figure 16 provides diagrams of showing assembly of polymer nanofilms deposited as PEMs of PAH and PAA on a substrate. PEMs are impregnated with silver ions (Ag+) and silver nanoparticles (AgNP).
  • Figure 17 provides a diagram of assembly of polymer nano films deposited on a substrate as PEMs of PAA and PAH with chlorhexidine acetate.
  • Figure 18 provides a graph showing sustained release of silver-ions in PBS from polymer nanofilms assembled as PEMs of PAH and PAA containing 1 1 ⁇ 2.1 ug/cm2 of silver-nanoparticles.
  • Figure 19 provides a graph showing sustained release of chlorhexidine (CX) in PBS from polymer nanofilms fabricated as PEMs containing chlorhexidine acetate molecules.
  • Figure 20 A and B provides images showing application of a silver-microfilm wound dressing on excisional wounds in mice.
  • A A 6 mm diameter full-thickness splinted wound on the flank of a mice,
  • Figure 21 provides a graph showing reduction in the bacterial colonization of excisional wounds in mice on day 3 post-surgery by silver-microfilm wound dressing containing silver-nanoparticles. All wounds were inoculated with S. aureus on day 0 and covered with Integra wound dressing, or covered with silver-microfilm wound dressing along with Integra dressing.
  • Figure 22 shows that silver-microfilm wound dressing prevents infection and expedites closure of contaminated wounds in mice.
  • Two surgical wounds (6 mm diameter) created on the flanks of each balb/c mouse were inoculated with 2xl0 5 CFU of S. aureus and (A) covered with a biosynthetic dressing- Biobrane in one group or (B) covered with a silver- microfilm wound dressing before placement of Biobrane on the wounds.
  • Figure shows representative images of wounds in group A and group B on day 9 post surgery.
  • Figure 22C shows area (average ⁇ SEM) of wounds (as percentage of original wound size) on day 9 post surgery in mice wounds that were treated either with only Biobrane dressing, or with Silver- microfilm wound dressing and Biobrane.
  • Figure 23 is a diagram of application of microsheets for surface modification of a medical device, such as surgical mesh, contact lens, or wound dressing. Sacrificial cast of the microsheet dissolves quickly on the moist surface and immobilizes polymer nanofilm on it.
  • Figure 24 provides images showing immobilization of polymer nanofilms by a microsheet on the surface of moist collagen matrix of Integra wound dressing.
  • Figure 25 provides images showing immobilization of a polymer nanofilm containing microspheres by a microsheet on the moist collagen matrix of Integra wound dressing.
  • A Micrograph of a microsheet with a polymer nanofilm containing 2 um size fluorescent microsphers, as assembled on an elastomeric sheet.
  • Figure 26 provides a graph showing reduction in bacterial colonization in solutions incubated on the surface of Integra wound dressing modified by silver-nanofilms (AgNP) using microsheets with water-soluble sacrificial casts of PVA. Solutions over test dressings were repeatedly inoculated withlO 7 CFU/ml of S. aureus every 24 h.
  • AgNP silver-nanofilms
  • Figure 27 provides a stress strain curve showing mechanical strength of a silver- microsheet.
  • Figure 28 shows a schematic diagram according to an embodiment of the technology described herein.
  • Figure 28a shows polyelectrolytes employed for layer-by-layer assembly of nanometer-thick PEMs.
  • Figure 28b is a schematic illustration of the procedure used to fabricate PEM/PVA microfilms and apply them to wound-beds: (1) PEMs are assembled on PDMS sheets, (2) post-fabrication, PEMs are impregnated with silver ions that are subsequently reduced to silver-nanoparticles, (3) PVA solution is spin-coated over silver- loaded PEMs, (4) PEM/PVA microfilm is peeled from the PDMS sheet and (5) placed onto a moist wound-bed. 6) Dissolution of the PVA layer in the moist wound leads to (7) immobilization of the PEMs on the wound-bed.
  • Figure 30 is a series of fluorescence microscopy images showing that microfilms of PEMs/PVA are uniformly peeled from PDMS sheets on which they are fabricated and retain their silver loadings.
  • Figure 30a, Figure 30b, and Figure 30b show representative fluorescent micrographs of a 6 mm diameter PEM/PVA microfilm with PEMs of (FITC- PAH/PAA5.5)io.5.
  • Figure 30a shows PEM on a PDMS sheet before peeling
  • Figure 30b shows PDMS after peeling
  • Figure 30c shows PEM placed on a glass slide for imaging.
  • Figure 31 is a series of fluorescence micrographs showing that PEMs of AF- PAH/PAA 5 5 ) 10 .5 (assembled using Alexa Fluor 560 labeled PAH) cannot be peeled as PEM/PVA microfilm from non-OTS functionalized silicon wafer ( Figure 31a, Figure 3 lb, and Figure 31c), but can be peeled uniformly from OTS functionalized silicon wafers ( Figure 3 Id, Figure 3 le, and Figure 3 If).
  • Figure 31a and Figure 3 Id show AF-PEMs fabricated on Si wafer substrates not functionalized and functionalized with OTS, respectively;
  • Figure 3 lb and Figure 3 le show PEM left on Si wafer not functionalized and functionalized with OTS, respectively, after peeling off as a PEM/PVA microfilm;
  • Figure 3 lc and Figure 3 If shows a PEM/PVA microfilm peeled off the Si wafer substrates not functionalized and functionalized with OTS, respectively, and placed on a glass slide for imaging.
  • Figure 32 is a plot showing silver loading of PEMs/PVA microfilms before and after peeling the PEMs from the PDMS sheets, illustrated using PEMs with different silver loadings. Data are presented as mean ⁇ SEM with n > 4.
  • Figure 33 is a plot showing silver loading in PEMs stored for 3 months at ambient temperature is not significantly different from the freshly assembled PEMs. Data presented as mean ⁇ SEM (n > 3).
  • Figure 34 is a series of fluorescence microscopy images and a plot showing hcaracterization of PEMs immobilized from PEM/PVA microfilms onto human cadaver skin dermis (GammaGraft).
  • Figure 34a shows a microfilm with PEMs of (FITC-PAH/PAA 2 .5)4o.5 on a PDMS sheet;
  • Figure34b shows a PEM/PVA microfilm placed onto skin dermis with the PEMs facing the surface of the tissue;
  • Figure 34c shows PEMs immobilized on skin dermis after repeated rinsing with 1 mL PBS; and
  • Figure 34d shows PEMs retained on human skin dermis after 3 days of continuous incubation in excess PBS on shaker plates.
  • the plot in Figure 34e shows the sustained release of silver ions in PBS from the skin dermis modified with PEMs impregnated with a range of silver loadings. Data are presented as mean ⁇ SEM with n > 4.
  • Figure 35 is a plot showing the PVA cast in the PEM/PVA microfilm dissolves completely in aqueous solutions within 10 minutes.
  • the plot presents absorbance intensity of a Malachite Green-dye incorporated in PVA cast and released in 3 mL PBS buffer along with the dissolution of the PVA cast at different time points.
  • Absorbance intensity of Malachite Green dye in PBS was measured on a UV-vis spectrophotometer at 595 nm wavelength. Data presented as mean ⁇ SEM (n > 5).
  • Figure 36 is a series of fluorescence micrographs showing the persistence of FITC- PEMs, e.g., (FITC-PAH/PAA 2 .5)4o.5, immobilized on skin dermis against mechanical pressure and abrasion.
  • Figure 36a shows FITC-PEMs immobilized on skin dermis;
  • Figure 36 shows intact FITC-PEMs on skin dermis after vertically applied mechanical pressure of ⁇ 8 kPa;
  • Figure 36c shows FITC-PEMs retained on skin dermis after lateral abrasion with Telfa dressings (1 mm/s) following mechanical pressure treatment described in Figure 36b.
  • Figure 37 is a series of fluorescence micrographs showing formation of cracks in the PEMs of (PAH/PAA2.5) with 40.5 bilayers.
  • Figure 37a is a fluorescent micrograph of a PEM of (FITC-PAH/PAA2.5) having 5.5 bilayers fabricated on an elastomeric PDMS sheet.
  • Figure 37b is a fluorescent micrograph of a PEM of (FITC-PAH/PAA2.5) having 10.5 bilayers fabricated on an elastomeric PDMS sheet.
  • Figure 37c is a fluorescent micrograph of a PEM of (FITC-PAH/PAA2.5) having 40.5 bilayers fabricated on an elastomeric PDMS sheet.
  • Figure 38 is a plot showing antibacterial activity in suspensions of S. aureus incubated for 24 h or 48 h over skin-dermis modified with PEM/PVA microfilms with a range of silver loadings. Modified skin-dermis was incubated in 96-well plates with 10 7 CFU of S. aureus in 100 mL HBSS buffer on shaker plates (150 rpm) at 37°C. Data are presented as mean ⁇ SEM with n > 4.
  • Figure 39 is a plot showing antibacterial activity in suspensions oiPs. aeruginosa incubated for 24 hours over skin-dermis modified with silver/PEMs (with silver loadings of 2.9 ⁇ 0.1 ⁇ g cm “2 ) using PEM/PVA microfilm. Modified skin dermis was placed in 96-well plates and incubated with 10 7 CFU oiPs. aeruginosa in 100 mL PBS buffer for 24 hours with shaking (150 rpm) at 37°C. After incubation, bacteria were rinsed off and collected from the test wells and their serial dilutions were plated on blood agar plates. Data presented as mean ⁇ SEM with n > 4.
  • Figure 40 is a series of images showing modification of full-thickness splinted wound in mice with a silver/PEM using a microfilm.
  • the photograph of Figure 40a shows splinted wounds in mice with PEM/PVA microfilm held by tweezers;
  • Figure 40b shows PEMs adhered on mice wounds.
  • Figure 40c, Figure 40d, and Figure 40e shows the persistence of fluorescence-tagged PEMs immobilized on the surface of excisional full-thickness.
  • Figure 40c is a fluorescent micrographshowing a PEM/PVA microfilm comprising a PEM of (FITC- PAH/PAA 2 .5)4o.5 on PDMS sheet before transfer;
  • Figure 40d is a fluorescent
  • Figure 41 is a plot showing silver loading in PEMs of (PAH/PAA 2 .5)io.5 tailored up to 16.8 ⁇ 0.5 ⁇ g cm "2 by repeating three cycles of silver ion exchange and their in situ reduction into silver nanoparticles. Data are presented as mean ⁇ SEM (n > 4).
  • Figure 42 is a plot showing sustained release of silver ions into PBS from PEMs of (PAH/PAA 2 .5)io.5 with silver loadings of 16.8 ⁇ 0.5 ⁇ g cm "2 .
  • Figure 43 is a plot showing inhibition of microbial colonization in contaminated murine wounds treated with PEM/PVA microfilms (with silver loading of 16.8 ⁇ 0.5 ⁇ g cm " 2 ).
  • Excisional 6 mm diameter splinted wounds topically inoculated with 3.0 x 10 6 CFU/cm 2 of S. aureus were treated with the PEM/PVA microfilm and covered with a biosynthetic wound dressing Biobrane®.
  • the plot shows bacterial counts recovered from wounds harvested and homogenized (along with Biobrane®) after 3 days post-surgery (*, P> 0.05, **, P ⁇ 0.001, P ⁇ 0.03).
  • Figure 44 is a plot showing inhibition of microbial colonization in contaminated murine wounds treated with PEM/PVA microfilms (with silver loading of 17.63 ⁇ 3.13 ⁇ g cm "2 ).
  • Excisional 6 mm diameter splinted wounds topically inoculated with 2.71 x 10 6 CFU/cm 2 of S. aureus were treated with the PEM/PVA microfilm and covered with a biosynthetic wound dressing Biobrane®.
  • Figure 45 is a series of images and a plot showing PEM/PVA microfilms promote normal wound healing in excisional splinted wounds in mice.
  • Figure 45a, Figure 45b, and Figure 45c show gross images of wounds on post-operative days 0, 7 and 14, respectively, that were modified post-surgery with silver/PEMs (with silver loading of 16.8 ⁇ 0.5 ⁇ g cm "2 ). Each line on the scale represents 1 mm.
  • Figure 45d shows the percentage of original wound size on post-operative days 3, 5, 7, 10, and 14 in wounds that did not receive PEMs and wounds that were modified with either PEMs containing no silver or PEMs containing 16.8 ⁇ 0.5 ⁇ g cm "2 silver. Each data point presents mean ⁇ SEM of relative wound size.
  • Figure 46 is a series of images showing PEM/PVA microfilms promote normal wound healing in excisional splinted wounds in mice.
  • the micrographs of Figure 46a, Figure 46b, and Figure 46c, respectively, show gross images of wounds without PEMs and the micrographs of Figure 46d, Figure 46e, and Figure 46f show gross images of wounds modified with PEMs containing no silver.
  • Figure 46a and Figure 46d are images from postoperative day 0;
  • Figure 46b and Figure 46e are images from post-operative 7; and
  • Figure 46c and Figure 46f are images from post-operative 14. Each line on the scale represents 1 mm.
  • Figure 47 is a series of images and a plot showing PEM/PVA microfilm (with 16.8 ⁇ 0.5 ⁇ g cnf 2 of silver) promotes epithelialization similar to the untreated wound in excisional splinted wounds in mice, as determined by histopathology.
  • Figure 47a and Figure 47b show representative H&E-stained sections of wounds post-operative days 7 and 14, respectively, in wounds modified with silver/PEMs.
  • Original wound edge (arrow), migrating epithelial tongue (arrow head), granulation tissue (G), and wound matrix (W) are marked.
  • Figure 47c shows the percentage of original wound size on post-operative days 7 and 14 in wounds that did not receive PEMs, and wounds that were modified with PEMs containing no silver or PEMs containing silver.
  • Each data point presents mean ⁇ SEM of relative wound size.
  • the sample sizes (n) for day 7 for the groups without PEMs, with PEM/PVA without Ag, and with PEM/PVA with Ag, were n 4, 9, and 7, respectively.
  • n 3 for each group.
  • Figure 48 shows PEM/PVA microfilm promotes epithelialization similar to the untreated wound in excisional splinted wounds in mice, as determined by histopathology.
  • Figure 48a and Figure 48b are micrographs showing H&E-stained sections from wounds without PEMs post-operative at days 7 and 14, respectively.
  • Figure 48c and Figure 48d are micrographs showing H&E-stained sections from wounds immobilized with PEMs containing no silver post-operative at days 7 and 14, respectively.
  • Original wound edge (arrow), migrating epithelial tongue (arrow head), granulation tissue (G), and wound matrix (W) are marked.
  • Figure 49 is a drawing comparing the coverage of a wound by conventional dressings and embodiments of the microfilm silver dressings provided herein.
  • Figure 49A depicts a wound covered with a conventional dressing and
  • Figure 49B depicts a wound covered with a microfilm dressing as discussed herein.
  • Figure 50 shows micrographs of haematoxylin and eosin (H&E) stained wounds on day 12 post-surgery that were created on the flanks of balb/c mice and inoculated with 2 x 10 5 CFU S. aureus.
  • Figure 50A shows a wound that was covered with a biosynthetic Biobrane dressing.
  • Figure 50B shows a wound covered with a silver-microfilm wound dressing before placement of Biobrane on the wounds.
  • the scale 0.5 mm.
  • Figure 51 is a plot showing inhibition of P. aeruginosa biofilms at the bottom of 48- well plates in TSB media with Ga( Os) 3 .
  • Figure 52 is a drawing showing an embodiment of a microfilm dressing comprising a water soluble polymeric cast (with antibiofilm Ga) that adheres to a polymer multilayer nanofilm (PEMs) containing silver nanoparticles on the wound-bed.
  • a water soluble polymeric cast with antibiofilm Ga
  • PEMs polymer multilayer nanofilm
  • Figure 53 is a plot showing the sustained release of Ga 3+ in PBS from PEMs of (PAA/PAH)io containing 16.1 ⁇ 0.8 ⁇ g/cm 2 of gallium.
  • Figure 54 is a drawing showing the sequential transfer of nanocoatings of PEMs containing gallium (Ga) or silver nanoparticles (AgNP) by stamping onto a silicone film dressing.
  • Figure 54A shows the sequential depostion of nanocoatings onto silicone film and
  • Figure 54B shows a removal of a stamp to leave the nanocoating on the silicone film.
  • wound refers broadly to injuries to the skin and subcutaneous tissue initiated in different ways (e.g., pressure sores from extended bed rest and wounds induced by trauma) and with varying characteristics.
  • the methods and compositions described herein are useful for treatment of all types of wounds, including wounds to internal and external tissues.
  • Wounds may be classified into one of four grades depending on the depth of the wound: i) Grade I: wounds limited to the epithelium; ii) Grade II: wounds extending into the dermis; iii) Grade III: wounds extending into the subcutaneous tissue; and iv) Grade IV (or full-thickness wounds): wounds wherein bones are exposed (e.g., a bony pressure point such as the greater trochanter or the sacrum).
  • Grade I wounds limited to the epithelium
  • Grade II wounds extending into the dermis
  • Grade III wounds extending into the subcutaneous tissue
  • Grade IV or full-thickness wounds
  • partial thickness wound refers to wounds that encompass Grades I-III; examples of partial thickness wounds include burn wounds, pressure sores, venous stasis ulcers, and diabetic ulcers.
  • deep wound is meant to include both Grade III and Grade IV wounds. The present invention contemplates treating all wound types, including deep wounds and chronic wounds.
  • chronic wound refers to a wound that has not healed within 30 days.
  • promote wound healing refers to either the induction of the formation of granulation tissue of wound contraction and/or the induction of epithelialization (i.e., the generation of new cells in the epithelium). Wound healing is conveniently measured by decreasing wound area.
  • wound active agent refers to known or potential chemical compounds that induce a desired pharmacological, physiological effect useful in the treatment and healing of a wound, wherein the effect may be prophylactic or therapeutic.
  • the terms also encompass pharmaceutically acceptable, pharmacologically active derivatives of those active agents specifically mentioned herein, including, but not limited to, trophic factors, extracellular matrices, enzymes, enzyme inhibitors, defensins, polypeptides, anti-infective agents
  • buffering agents including but not limited to ionic silver, elemental silver, and silver nanoparticles
  • buffering agents including but not limited to ionic silver, elemental silver, and silver nanoparticles
  • vitamins and minerals including but not limited to ionic silver, elemental silver, and silver nanoparticles
  • analgesics including but not limited to ionic silver, elemental silver, and silver nanoparticles
  • anticoagulants including but not limited to ionic silver, elemental silver
  • polymer multilayer refers to the composition formed by sequential and repeated application of polymer(s) to form a multilayered structure.
  • polyelectrolyte multilayers are polymer multilayers are formed by the alternating addition of anionic and cationic polyelectrolytes to a wound or support.
  • polymer multilayer also refers to the composition formed by sequential and repeated application of polymer(s) to a wound or to a solid support.
  • polymer layer can refer to a single layer composed of polymer molecules, such as anionic or cationic polyelectrolyte molecules, existing either as one layer within multiple layers, or as a single layer of only one type of polyelectrolyte molecules on a wound or support. While the delivery of the polymers to the wound bed or support is sequential in preferred embodiments, the use of the term “polymer multilayer” is not limiting in terms of the resulting structure of the coating. It is well understood by those skilled in the art that inter-diffusion of polymers such as polyelectrolytes can take place leading to structures that may be well-mixed in terms of the distribution of anionic and cationic polyelectrolytes.
  • polyelectrolyte includes polymer species as well as nanoparticulate species, and that it is not limiting in scope other than to indicate that the species possesses multiple charged or partially charged groups. It is also well understood by those skilled in the art that multilayer structures can be formed through a variety of interactions, including electrostatic interactions and others such as hydrogen bonding. Thus, the use of the term "polyelectrolyte" is not limiting in terms of the interactions leading to the formation of the wound bed constructs.
  • crosslinked refers to a composition containing intermolecular crosslinks and optionally intramolecular crosslinks as well, arising from the formation of covalent bonds.
  • Covalent bonding between two crosslinkable components may be direct, in which case an atom in one component is directly bound to an atom in the other component, or it may be indirect, through a linking group.
  • a crosslinked structure may, in addition to covalent bonds, also include intermolecular and/or intramolecular noncovalent bonds such as hydrogen bonds and electrostatic (ionic) bonds.
  • Covalent modification agent refers to any molecule that covalently links molecules to each other.
  • Covalent modification agents include homobifunctional and heterobifunctional cross-linkers as well as photoactivatable cross linkers.
  • the term "homobifunctional cross-linker” refers to a molecule used to covalently link identical or similar molecules to each other. Homobifunctional cross-linkers have two identical reactive groups; thus, a homobifunctional cross-linker can only link molecules of the same type to each other. Conversely, a “heterobifunctional cross-linker” refers to a molecule used to covalently link dissimilar molecules to each other, because it has two or more different reactive groups that can interact with various molecules of different types. Hetero- and homo-multifunctional crosslinkers refers to multivalent crosslinkers with both hetero- and homo- crosslinking functionalities. Activated dendrimers are an example of multifunctional crosslinkers.
  • subject refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, rodents, dogs, cats, and the like, which is to be the recipient of a particular treatment.
  • subject and patient are used
  • surfactant refers to an amphiphilic material that modifies the surface and interface properties of liquids or solids. Surfactants can reduce the surface tension between two liquids. Detergents, wetting agents, emulsifying agents, dispersion agents, and foam inhibitors are all surfactants.
  • block copolymer refers to a polymer consisting of at least two monomers.
  • adjacent blocks are constitutionally different, i.e. adjacent blocks comprise constitutional units derived from different species of monomer or from the same species of monomer but with a different composition or sequence distribution of
  • a block copolymer can be thought of as two homopolymers joined together at the ends.
  • solvent refers to a liquid that can dissolve a substance.
  • organic solvent refers to a solvent derived from a petroleum-based product.
  • polyelectrolyte refers to a water-soluble macromolecular polymer substance containing many repeating ionic constituent units, including cations and anions.
  • primary amine refers to a derivative of ammonia in which a hydrogen has been replaced by a hydrocarbon unit.
  • Primary amines have the general formula R H 2 and examples include, but are not limited to, aniline, methylamine, and 1 -propylamine.
  • DNA delivery agent refers to any molecule that can bring DNA into contact with an identified target.
  • a DNA delivery agent causes uptake of DNA into a cell or cells, in vitro or in vivo.
  • DNA delivery agents can be viruses including, but not limited to, adenoviruses and retroviruses.
  • DNA delivery agents can also be non-viral agents including, but not limited to, plasmids, lipids, liposomes, polymers and peptides.
  • exposable refers to anything that is capable of being exposed.
  • An exposable surface or molecule is one that is made available to interaction with other surfaces or molecules.
  • a covalent modification agent is exposable to a wound active agent; thus, the two agents can interact with each other and form covalent bonds.
  • the term "functionalized” refers to a modification of an existing molecular segment to generate or introduce a new reactive functional group (e.g., a maleimido or succinimidyl group) that is capable of undergoing reaction with another functional group (e.g., a sulfhydryl group) to form a covalent bond.
  • a new reactive functional group e.g., a maleimido or succinimidyl group
  • another functional group e.g., a sulfhydryl group
  • a component containing carboxylic acid (— COOH) groups can be functionalized by reaction with N-hydroxy-succinimide or N- hydroxysulfosuccinimide using known procedures, to form a new reactive functional group in the form of an activated carboxylate (which is a reactive electrophilic group), i.e., an N- hydroxysuccinimide ester or an N-hydroxysulfosuccinimide ester, respectively.
  • carboxylic acid groups can be functionalized by reaction with an acyl halide, e.g., an acyl chloride, again using known procedures, to provide a new reactive functional group in the form of an anhydride.
  • aqueous solution includes solutions, suspensions, dispersions, colloids, and the like containing water.
  • click chemistry refers to the use of chemical building blocks with built-in high-energy content to drive a spontaneous and irreversible linkage reaction with appropriate complementary sites in other blocks. These chemical reactions (e.g., including, but not limited to, those between azide and acetylene groups that combine readily with each other) are specific and result in covalent linkage between the two molecules.
  • non-chemical ligation refers to a chemos elective reaction of two unprotected peptide segments. The reaction results in an initial thioester-linked species, then spontaneous rearrangement of this transient intermediate occurs, yielding a full-length product with a native peptide bond at the ligation site.
  • specific protein binding refers to an interaction between two or more proteins that have high affinity and specificity for each other. Proteins must bind to specific other proteins in vivo in order to function. The proteins are required to bind to only one or a few other proteins of the few thousand proteins typically present in vivo; these interactions are employed in vitro in the present invention to attach wound active agents to the wound.
  • specific protein binding interactions include, but are not limited to, those between biotin and avidin, neutravidin, or streptavidin; glutathione-S- transferase and glutathione; and nickel-nitrilotriacetic acid and polyhistidine.
  • device refers to an object that contacts the body or bodily fluid of a subject for therapeutic or prophylactic purposes. Some devices may partially or indirectly contact the body or bodily fluid of a subject (e.g., catheter, dialysis tubing, diagnostic sensors, drug delivery devices), while other devices are completely imbedded in or encompassed by the body of a subject (e.g., stent, pacemaker, internally implanted defibrillator, angioplasty balloon, orthopedic device, spinal cage, implantable drug pump, artificial disc, ear disc).
  • stent e.g., pacemaker, internally implanted defibrillator, angioplasty balloon, orthopedic device, spinal cage, implantable drug pump, artificial disc, ear disc.
  • selective toxicity refers to the property of differentially toxic effects on mammalian versus microbial cells.
  • a selectively toxic agent may effectively kill bacterial cells while permitting growth and viability of mammalian cells.
  • nanoparticle and “nanoscale particles” are used interchangeably and refer to a nanoscale particle with a size that is measured in nanometers, for example, a nanoscopic particle that has at least one dimension of less than about 1000, 500, or 100 nm.
  • nanoparticles include nanobeads, nanofibers, nanohorns, nano- onions, nanorods, and nanoropes.
  • microparticle and “microscale particles” are used interchangeably and refers to a microscale particle with a size that is measured in
  • micrometers for example, a microscale particle that has at least one dimension of less than about 10 micrometers, 5 micrometers, or 2 micrometers.
  • wound dressing refers to materials placed proximal to a wound that have absorbent, adhesive, protective, osmoregulatory, pH-regulatory, or pressure-inducing properties. Wound dressings may be in direct or indirect contact with a wound. Wound dressings are not limited by size or shape. Indeed, many wound dressing materials may be cut or configured to conform to the dimensions of a wound.
  • wound dressing materials include but are not limited to gauze, adhesive tape, bandages, and commercially available wound dressings including but not limited to adhesive bandages and pads from the Band-Aid ® line of wound dressings, adhesive bandages and pads from the Nexcare ® line of wound dressings, adhesive bandages and non-adhesive pads from the Kendall Curity Tefla ® line of wound dressings, adhesive bandages and pads from the Tegaderm ® line of wound dressings, adhesive bandages and pads from the Steri-Strip ® line of wound dressings, the COMFEEL ® line of wound dressings, adhesive bandages and pads, the Duoderm ® line of wound dressings, adhesive bandages and pads, the TEGADERMTM line of wound dressings, adhesive bandages and pads, the OPSITE ® line of wound dressings, adhesive bandages and pads, and biologic wound dressings.
  • adhesive bandages and pads from the Band-Aid ® line of wound dressings, adhesive bandages and pads from the Nexcare ® line of wound dressings, adhesive
  • a "biologic wound dressing” is a type of wound dressing that comprises, e.g., is coated with or incorporates, cells and/or one or more biomolecules or fragments of biomolecules that can be placed in contact with the wound surface.
  • the biomolecules may be provided in the form of an artificial tissue matrix.
  • biomolecules include, but are not limited, to collagen, hyaluronic acid, glycosaminoglycans, laminin, vitronectin, fibronectin, keratin, antimicrobial polypeptides and combinations thereof.
  • suitable biologic wound dressings include, but are not limited to, BIOBRANETM, IntegraTM, Apligraf ® , Dermagraft ® , Oasis ® , Transcyte ® ,
  • the term "antimicrobial silver composition” refers to a composition that comprises silver as an active antimicrobial agent.
  • antimicrobial silver compositions include, but are not limited to silver nanoparticles, elemental silver, zero valent silver, multivalent silver ions carried by zirconium phosphate (ZP-Ag)(See, e.g., Wound Repair and Regeneration, 16: 800-804), and silver containing compounds such as silver sulfadiazine and related compounds.
  • ZP-Ag zirconium phosphate
  • releasable antimicrobial silver composition refers to a antimicrobial silver composition that can be released from a material, for example, a polymer multilayer solid support, so that antimicrobial activity can be observed. The release of the antimicrobial silver composition can be defined as an amount of the composition released from a defined area or volume of the material.
  • the microenvironment of the pathologic/chronic wound bed is dysregulated with alterations in extracellular matrix constituents, degradative enzymes, growth factor and other cytoactive factor activity.
  • the present invention provides compositions and methods for engineering of the wound bed itself by, for example, altering the surface chemistry/structure of the wound bed to promote favorable cell behaviors that accelerate wound healing.
  • the wound bed is first treated with a priming agent (i.e., primer) that provides a uniform, reactive bed on the wound surface.
  • a priming agent i.e., primer
  • the primed wound bed is then treated with a desired agent, such a wound active agent.
  • the present invention provides for the selection of a subset of cytoactive compounds from a list of candidates for immobilization into the wound bed so as to differentially modulate the endothelial, fibroblastic and epithelial components within the healing response.
  • the present invention provides the potential to achieve high quality healing responses in a variety of clinical conditions, thereby providing a strategy for engineering the wound bed for personalized therapeutics for each unique wound healing challenge encountered by a clinician.
  • differential modulation of the cellular responses within the wound would yield substantial benefit include chronic wounds in diabetics or venous stasis ulcers, where pancellular promotion of healing responses is desired but in particular a vibrant angiogenic response is needed to support all of the other aspects of wound healing. In other wounds, where the strength of the healed wound is a key concern, modulation to promote a fibroblastic response with a normal angiogenic and epithelial component is desirable.
  • Modulation of the fibroblastic response in this way has the potential to provide superior clinical outcomes and reduce the need for subsequent reconstructive procedures targeted at recovery of limb or other critical bodily functions.
  • the feasibility of such an approach has been demonstrated previously, such as in the report by Muehlberger and colleagues on the effects tretinoin on incisional wounds (Muehlberger et al, 2005, J. Am. Acad. Derm. 52:583).
  • application of tretinoin resulted in an increased fibroblastic proliferation but the production of collagen was diminished.
  • the layer-by-layer deposition process is not limited in applicability to polyelectrolytes, but can be applied to viruses, nanoparticles, non-ionic polymers, proteins and other forms of microscopic and nanoscopic matter.
  • a recent review provides information on a wide range of species and interfacial structures that can be formed by the layer-by-layer deposition procedure.
  • the scope of the invention described herein is not limited to polyelectrolytes but applies to all species that have been demonstrated to be incorporated into interfacial structures by the layer-by-layer deposition process.
  • wound modifying agent is applied to prime the wound bed.
  • wound modifying agents are agents that applied to a wound bed and either covalently or noncovalently modify the wound bed.
  • wound modifying agents include homobifunctional and heterobifunctional linkers, polyelectrolytes, non-ionic polymers, combinations of polyelectroloytes and non-ionic polymers, and nano- and micro-particles including beads and needles.
  • the wound modifying agent alters a property of the wound bed selected from the group consisting of compliance, pH, alkalinity, and oxidative or reductive strength, net charge, hydrophilicity, osmotic strength, nanoscale or submicron topographic features,
  • the wound modifying agents are used to incorporate wound active agents so that the wound active agents are localized to the wound bed.
  • the wound active agents can be covalently or noncovalently attached to the wound modifying agent.
  • the wound active agents may form a gradient via the wound modifying agent.
  • the wound modifying agents alter the compliance of the wound bed.
  • the polymers or nano- or micro-particles have a predetermined hardness.
  • the compliance gradients with varying levels of hardness may be formed by the polymers, nano- or micro-particles.
  • the wound active agent is silver or a form of silver.
  • Silver is a widely used nonspecific biocidal agent that acts against a very broad spectrum of bacterial species (Yin et al, 1999, J. Burn Care Rehabil. 20: 195; herein incorporated by reference in its entirety), yeast species, fungal species (Wright et al, 1999, Am. J Infect. Control 27:344; herein incorporated by reference in its entirety), and viruses (Hussain et al, 1991, Biochem. Biophys. Res. Comm. 189: 1444; herein incorporated by reference in its entirety), including several antibiotic resistant strains (Wright et al, 1998, Am. J. Infect.
  • Silver released from a leading commercial wound-dressing ActicoatTM that contains nanocrystalline silver (Dunn et al, Burns, 2004, 30(supplement 1):S1 ; herein incorporated by reference in its entirety), was shown to be toxic to in vitro monolayer cell cultures of keratinocytes and fibroblasts (Poon et al, 2004, Burns 30: 140; Trop et al, 2006, J. Trauma 60:648; each herein incorporated by reference in its entirety).
  • the challenges with current topical silver antimicrobials lie in their low silver release levels, the lack of penetration, the rapid consumption of silver ions, and the presence of silver nitrate or cream bases that are pro-inflammatory, negatively affecting wound healing. Issues like wound staining, electrolyte imbalance, and patient discomfort also exist.
  • the present invention comprises novel methods for providing controlled and localized loadings of non-cytotoxic levels of antimicrobial silver compositions to surfaces that circumvents using excess-loading of silver in the wound while retaining antibacterial activity and reduced cytotoxicity.
  • nanometer-thick polymeric films were assembled that were impregnated with silver nanoparticles to levels resulting in efficient killing of bacteria but no cytotoxic effects on the adherence and growth of mouse fibroblasts cells on the films.
  • the polymeric films are impregnated with an antimicrobial silver composition by incubating the film in an antimicrobial silver composition as described in Example 13.
  • the antimicrobial silver composition is directly incorporated into the polymer multilayer during synthesis of the multilayer. See, e.g., Langmuir. 2005 Dec 6;21(25): 11915-21.
  • the silver-nanoparticles impregnated thin films of some embodiments of the present invention exploit different principles for delivering silver into the wound-matrix.
  • the films can be applied directly on the exposed wound-bed, allowing them to release the silver ions locally into the wound. This reduces the amount of bactericidal silver needed to impregnate into the film by several orders compared to topical silver delivery agents, significantly reducing the silver-based toxicity.
  • Some molecularly-thin composite film embodiments of the present invention can be tuned to contain as low as 0.4 ⁇ g/cm 2 of soluble silver and release a total of less than 1 ppm silver ions in buffers. Such films display 99.9999% bacteria-killing efficiency without any measurable cytotoxicity to mammalian cells. Furthermore, films containing these levels of silver allow adherence and growth of mammalian cells (e.g., NIH-3T3 mouse fibroblasts).
  • mammalian cells e.g., NIH-3T3 mouse fibroblasts.
  • the releasable antimicrobial silver composition is loaded at an amount of from 1 or 10 to about 50, 100, 200, 300, 400, 500 or 1000 ⁇ g/cm 2 of the polymer multilayer and/or releasable in an amount of about 0.01 and 100 ⁇ g/cm 2 of the polymer multilayer per day. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 100 ⁇ g/cm 2 of the polymer multilayer. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 20 ⁇ g/cm 2 of the polymer multilayer.
  • the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 5 ⁇ g/cm 2 of the polymer multilayer. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 2 ⁇ g/cm 2 of the polymer multilayer. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.05 and 1 ⁇ g/cm 2 of the polymer multilayer. In some embodiments, the releasable antimicrobial silver composition is releasable in an amount of about 0.1 to 0.5 ⁇ g/cm 2 of the polymer multilayer.
  • ActicoatTM releases a total of over 120 ppm silver on dissolution in water for 24 hr (Taylor et al, 2005, Biomaterials 26:7221; herein incorporated by reference in its entirety), and has been shown to be cytotoxic to keratinocytes and fibroblasts (Poon et al, 2005, Burns 30: 140; Trop et al, 2006, J. Trauma 60:648; each herein incorporated by reference in its entirety).
  • Example 13 In experiments conducted during the course of developing certain embodiments of the present invention (e.g., Example 13), loading levels of silver in PEMs were identified and achieved that lead to silver-impregnated antibacterial molecularly-thin films permitting adhesion of mammalian cells without exhibiting cytotoxicity.
  • the films find use for the localized delivery of bactericidal silver to the wounds, reducing risks of toxicity from silver overdose observed with other topical delivery agents.
  • implantable medical devices can be coated with these silver-impregnated thin films to kill bacteria right during their initial attachment to these surfaces and prevent bacterial colonization, a leading cause of implant failure.
  • the silver-releasing moleculary-thin composite films of some embodiments of the present invention have advantage over: 1) other topical delivery agents of silver currently used in clinics; 2) wound-dressings that contain large amounts of silver in them; and 3) other bactericidal composite thin-films containing large amounts of silver, which are cytotoxic to mammalian cells and do not allow mammalian cells to adhere and grow over them.
  • PEMs polyelectrolyte multilayers
  • Their porous and supramolecular architecture allows incorporating a variety of molecules including DNA, enzymes, viruses, dendrimers, colloids, inorganic particles, and dyes (Decher, 1997, Science 277: 1232; herein incorporated by reference in its entirety).
  • bactericidal silver along with delivering bactericidal silver, in some embodiments they can be used for simultaneous localized delivery of other bioactive agents in the wound-matrix (e.g., cell recruiting growth factors, DNA plasmids encoding such growth factors).
  • bioactive agents in the wound-matrix e.g., cell recruiting growth factors, DNA plasmids encoding such growth factors.
  • PEMs can conformally coat substrates of any type, size or shape, including natural and synthetic polymers (Hammond, 1999, Curr. Opin. Colloid Interface Sci. 4:430; herein incorporated by reference in its entirety), they can be constructed on any wound-bed or implantable medical device.
  • the present invention provides for the deposition and
  • FIG. 1 provides a schematic diagram 100 of a wound bed 110 on which a polyelectrolyte multilayer 130 has been deposited.
  • the diagram 100 depicts that the wound bed 1 10 comprises a heterogeneous surface depicted by shapes 120 which represent different chemical moieties.
  • polyelectrolyte multilayer 130 provides a homogenous surface onto which functional groups can 140 can be attached to form a homogenous functionalized surface 150.
  • the functional groups are uniform, however, in some preferred embodiments, different functional groups are utilized.
  • a wide variety of active agents can then be attached to the surface via the functional groups 140.
  • the wound bed is covalently modified with covalent modification agents.
  • the covalent modification agents include, but are not limited to, homobifunctional and heterobifunctional cross-linkers as well as photoactivatable cross linkers.
  • Figure 2 provides a schematic diagram 200 of a wound bed 210 comprising a heterogeneous surface depicted by shapes 220 which represent different chemical moieties.
  • the wound bed is covalently modified by reacting covalent modification agents 230 with the different chemical moieties to provide a relatively homogenous functionalized surface 250.
  • covalent modification agents 230 present functional groups 240.
  • the functional groups are uniform, however, in some preferred embodiments, different functional groups are utilized.
  • a wide variety of active agents can then be attached to the surface via the functional groups 240. These embodiments are discussed in more detail below.
  • the wound bed is an extremely heterogeneous environment.
  • the compositions and methods of the present invention are designed to modify the wound bed to provide a homogenous environment that provides for uniform and predictable delivery or uniform incorporation of active agents into the wound bed.
  • the priming agent is optimized to react with the wound bed.
  • the priming agent provides an optimized surface for enhanced or optimized delivery of an active agent.
  • a chemical parameter of the wound bed is changed.
  • the wound bed may be modified to be more or less acidic, basic, alkaline, reducing, or oxidizing or have a higher or lower ionic strength.
  • extracellular matrices deposited and immobilized are constituents of native basement membrane.
  • Native ECMs comprise a mixture of glycoproteins, proteoglycans and hyaluronic acid. These glycoproteins and proteoglycans include, but are not limited to, fibrin, elastin, fibronectin, laminins, glycosaminoglycans, nidogens and collagens. Cytoactive factors such as growth factors are also part of ECMs.
  • extracellular matrix components such as collagen, laminin,
  • glycosaminoglycans, or hyaluronic acid are deposited and immobilized on a wound bed.
  • a synthetic matrix such as MATRIGELTM is deposited on a wound bed.
  • MATRIGELTM is a commercially available basement membrane like complex that retains many characteristics of a native basement membrane, including a three-dimensional nanoscale topographic surface. The present invention is not limited to a particular mechanism. Indeed, an understanding of the mechanism is not necessary to practice the present invention.
  • the nanoscale topographic features of a basement membrane modulate fundamental cell behaviors including migration, adhesion, proliferation and differentiation (Abrams et al, 2002, Biomimetic Materials and Design: Interactive Biointerfacial, Tissue Engineering, and Drug Delivery, Eds. Dillow and Lowman; Diehl et al, 2005, J. Biomed. Mater. Res. A 75:603; Foley et al, 2005, Biomaterials 26:3639; Karuri et al, 2004, J. Cell Sci. 1 17:3153; Liliensiek et al, 2006, J. Biomed. Mater. Res. A 79: 185).
  • the present invention further provides methods, formulations, compositions and kits for altering the compliance of the wound surface.
  • the present invention further provides methods, formulations, compositions and kits for altering the compliance of the wound surface.
  • the local compliance is altered by immobilizing a thin layer of extracellular matrix constituents such as MATRIGELTM or an appropriate hydrogel or other synthetic matrix or by enzymatic treatment of the wound bed.
  • compliance is altered by the addition of cross-linking agents to the wound bed to cross-link components already presenting the wound bed, or components deliberately introduced into the wound bed. It has also been demonstrated by Picart and coworkers that it is possible to control the compliance of multilayer structures formed from polyelectrolytes by the addition of cross-linking agents.
  • the cytoactive factors that are deposited and immobilized on a wound bed include, but are not limited to, those factors that are mitogenic for epithelial cells and vascular endothelial cells and other factors that are elements in wound closure.
  • growth factors such as platelet derived growth factor (PDGF), and/or epidermal growth factor (EGF), known to be mitogenic for epithelial cells are deposited in a wound bed.
  • vascular endothelial growth factor (VEGF) known to be mitogenic for vascular endothelial cells, comprise the cytoactive factors immobilized on the wound bed.
  • the present invention is not limited by the ECM components or cytoactive factors immobilized on the wound bed, indeed any extracellular matrix components and/or cytoactive factor that improves wound healing is equally applicable. Additional cytoactive and wound active agents that can be incorporated are provided below.
  • compositions and methods for priming the wound bed to provide uniform reactive surface for later modification include, but are not limited to, polyelectrolytes and chemical crosslinking agents that react covalently with functional groups found in wound beds such as carboxy, thiol, amide and sugar groups.
  • the present invention provides compositions, formulations, methods and kits for depositing a multilayer structure on a wound bed.
  • the multilayer structures comprise layers of polymers that form polyelectrolytes, while in other embodiments, the multilayers comprise polymers that do not have a charge (i.e., non- ionic polymers) or a combination of charged and uncharged polymer layers.
  • polyelectrolyte films built-up by the alternated adsorption of cationic and anionic polyelectrolyte layers constitute a novel and promising technique to modify wound surfaces in a controlled way (Decher et al, 1992, Thin Solid Films 210/21 1 :831; Decher, 1997, Science 277: 1232).
  • One ofthe most important properties of such multilayers is that they exhibit an excess of alternatively positive and negative charges (Caruso et al, 1999, J Am Chem Soc 121 :6039; Ladam et al, 2000, Langmuir 16: 1249). Not only can this constitute the motor of their buildup (Joanny, 1999, Eur. Phys. J.
  • the polymer multilayers are nanoscale in dimension. Accordingly, in some embodiments, the polymer multilayers are from about 1 nm to 1000 nm thick, from about 1 nm to 500 nm thick, from about 1 nm to 100 nm thick, from about 1 nm to about 25 nm thick, from about 1 nm to about 10 nm thick, or less than about 500 nm, 100 nm, 25 nm or 10 nm thick.
  • the nanoscale dimension ofthe polymer multilayers allows for the loading of a lower total amount of an active agent while still allowing delivery of an effective amount (i.e., an amount of active agent that accelerates wound healing as compared to controls) ofthe active agent as compared to matrix structures with greater thickness. It is contemplated that the lower total loading levels result in reduced toxicity in the wound environment, especially when antimicrobial compounds are incorporated into the polymer multilayer.
  • the compliance ofthe polymer multilayers is adjusted to facilitate cell migration in the wound.
  • the polymer multilayers exhibit a compliance, measured in kilopascals (kPa) of from about 3 to about 500 kPa, about 7 to about 250 kPa, about 10 to about 250 kPA or from about 10 to about 200 kPa.
  • the present invention provides a method of treating a wound with the sequential application of a cationic polyelectrolyte, an anionic polyelectrolyte, and a wound active agent to the wound.
  • the treatment includes the sequential and repeated application of a cationic polyelectrolyte, an anionic polyelectrolyte, and a wound active agent to the wound.
  • Polyelectrolyte layers are formed by alternating applications of anionic
  • a polyelectrolytes and cationic polyelectrolytes to surfaces to form a polyelectrolyte layer.
  • the layers can be used to deliver a wound active agent to a wound.
  • at least four layers, and, more preferably, at least six layers are used to form the polyelectrolyte multilayer.
  • more than six layers are used, e.g., 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 or more layers.
  • a polyelectrolyte multilayer comprises 10.5 layers (e.g., comprising 10 bilayers of the two components and an additional layer of one of the two components).
  • the method of treatment of the present invention is not limited to use on a wound surface.
  • the formation of a polyelectrolyte layer that includes a wound active agent may be formed on any surface to which delivery of a wound active agent is desirable.
  • the cationic polyelectrolyte used is PLL and the anionic polyelectrolyte used is poly(L-glutamic acid) (PGA).
  • PGA poly(L-glutamic acid)
  • PES poly(ethylene imine)
  • PAH poly(allylamine hydrochloride)
  • PSS poly(sodium 4-styrenesulfonate)
  • PAC poly(acrylic acid)
  • PMA-P poly(maleic acid-co-propylene)
  • PAA poly(acrylic acid)
  • PVS poly(vinyl sulfate)
  • PVS poly(vinyl sulfate)
  • the polymer is a dendrimer, grafted polymer, or star architecture polymer.
  • the multilayer responds to or is organized in the presence of an electric field, for example an electric field formed by placing electrodes on either side of a wound.
  • the polymer multilayer 130 can be comprised of polystyrene sulfonate, an amphiphillic polyelectrolyte with an affinity for hydrophobic regions of the wound bed, and an amphoteric polymer.
  • the polymer multilayer is preferably functionalized with one or more crosslinking agents presenting an alkyne so that a uniform surface is presented (e.g., 140 in Figure 1 where x represents an alkyne group). From this point, widely available click chemistries can be used to add desired wound active agents to the modified surface of the wound.
  • the wound modifying agent is an azide conjugate or otherwise comprises an azide group and is reacted with the alkyne groups displayed on the wound bed in a Huisgen Cycloaddition.
  • suitable methods for preparing polyelectrolyte multilayers include those described, for example, in Cho and Char, Langmuir 20:401 1-4016, 2004; Okamura et al, Adv. Mater. 21, 4388-92 (2009), Cho et al, Adv. Mat. 13(14): 1076-1078 (2001); and U.S. pat. Publ. 2010/0062258; the entire contents of each of which is incorporated herein by reference. Suitable methods include layer by layer deposition, formation on SAMs, and spin coating assisted assembly.
  • Cationic polymers useful in the present invention can be any biocompatible water- soluble polycationic polymer, for example, any polymer having protonated heterocycles attached as pendant groups.
  • water soluble means that the entire polymer must be soluble in aqueous solutions, such as buffered saline or buffered saline with small amounts of added organic solvents as co-solvents, at a temperature between 20 and 37°C.
  • the material will not be sufficiently soluble (defined herein as soluble to the extent of at least one gram per liter) in aqueous solutions per se but can be brought into solution by grafting the polycationic polymer with water-soluble polynonionic materials such as polyethylene glycol.
  • Representative cationic polymers include natural and unnatural polyamino acids having net positive charge at neutral pH, positively charged polysaccharides, and positively charged synthetic polymers.
  • suitable polycationic materials include polyamines having amine groups on either the polymer backbone or the polymer side chains, such as poly-L-lysine (PLL) and other positively charged polyamino acids of natural or synthetic amino acids or mixtures of amino acids, including, but not limited to, poly(D-lysine), poly(ornithine), poly(arginine), and poly(histidine), and nonpeptide polyamines such as poly(aminostyrene), poly(aminoacrylate), poly (N-methyl aminoacrylate), poly (N- ethylaminoacrylate), poly(N,N-dimethyl aminoacrylate), poly( ,N-diethylaminoacrylate), poly(aminomethacrylate), poly(N-methyl amino-methacrylate), poly( -ethyl
  • aminomethacrylate poly( ,N-dimethyl aminomethacrylate), poly(N,N-diethyl
  • the cationic polymer is poly(allylamine hydrochoride) (PAH).
  • PAH poly(allylamine hydrochoride)
  • the polymers must include at least five charges, and the molecular weight of the polycationic material must be sufficient to yield the desired degree of binding to a tissue or other surface, having a molecular weight of at least 1000 g/mole.
  • Polyanionic materials useful in the present invention can be any biocompatible water- soluble polyanionic polymer, for example, any polymer having carboxylic acid groups attached as pendant groups. Suitable materials include alginate, carrageenan, furcellaran, pectin, xanthan, hyaluronic acid, heparin, heparan sulfate, chondroitin s ulfate, dermatan sulfate, dextran sulfate, poly(meth)acrylic acid, oxidized cellulose, carboxymethyl cellulose and crosmarmelose, synthetic polymers and copolymers containing pendant carboxyl groups, such as those containing maleic acid or fumaric acid in the backbone.
  • Suitable materials include alginate, carrageenan, furcellaran, pectin, xanthan, hyaluronic acid, heparin, heparan sulfate, chondroitin s ulfate, dermatan sulf
  • Polyaminoacids of predominantly negative charge are also suitable.
  • these materials include polyaspartic acid, poly glutamic acid, and copolymers thereof with other natural and unnatural amino acids.
  • Polyphenolic materials such as tannins and lignins can be used if they are sufficiently biocompatible.
  • Preferred materials include alginate, pectin, carboxymethyl cellulose, heparin and hyaluronic acid.
  • the anionic polymer is poly(acrylic acid) (PAA).
  • the multilayer structures are formed from uncharged polymers or from a combination of charged and uncharged polymers.
  • uncharged polymers include, but are not limited to, dextran, dextran sulfate, diethylaminoethyl (DEAE)-dextran, hydroxyethyl cellulose, ethyl(hydroxyethyl) cellulose, acrylamide, polyethylene oxide, polypropylene oxide, polyethylene oxide - polypropylene oxide copolymers, PAAN a , Ficoll, polyvinylpyrolidine, and polyacrylic acid.
  • DEAE diethylaminoethyl
  • the multilayer structures are formed from one or more amphoteric polymers, alone in combination with the other polymers described herein.
  • the amphoteric polymers comprise one or more of acrylic acid (AA), DMAEMA (dimethylaminoethyl methacrylate), APA (2-aminopropyl acrylate), MorphEMA (morpholinoethyl methacrylate), DEAEMA (diethylaminoethyl methacrylate), t-ButylAEMA (t-butylaminoethyl methacrylate), PipEMA (piperidinoethyl methacrylate), AEMA (aminoethyl methacrylate), HEMA (2 -hydroxy ethyl methacrylate), MA (methyl acrylate), MAA (methacrylic acid) APMA (2-aminopropyl methacrylate), AEA (aminoethyl acrylate).
  • the amphoteric polymer comprises (a) carboxylic acid, (b) primary amine, and (c) secondary and/or tertiary amine.
  • the amphoteric polymers have an isoelectric point of 4 to 8, preferably 5 to 7 and have a number average molecular weight in the range of 10,000 to 150,000.
  • the wound modifying agent such as a polymer multilayer
  • a wound modifying agent can be applied to the wound by a variety of methods.
  • the polymer or polymer multilayers is applied, preferably sequentially, to the wound using either a pump (including syringes, ink jet printers, and electrojets) or aerosol spray.
  • particle bombardment is utilized.
  • the use of a brush including an air brush is contemplated.
  • a sponge is utilized.
  • a solid support or stamp such as an elastomeric material, for example, PDMS
  • polydimethylsiloxane silicone, hydrogel or latex
  • silicone silicone, hydrogel or latex
  • the polymer multilayers are pre-formed on the stamp.
  • nano- or micro- particles are arranged on the stamp for delivery to the wound.
  • electric fields or magnetic fields are used to facilitate transfer of the wound modifying agents into the wound bed.
  • a polymer multilayer is produced on a supporting substrate (e.g., PDMS), removed from the supporting substrate, then laid on a wound.
  • a polymer multilayer is produced on a supporting substrate (e.g., PDMS), overlaid with a support layer (e.g., a sacrificial support layer (e.g., a water soluble sacrificial support layer)), e.g., comprising a biocompatible polymer (e.g., polyvinyl alcohol (PVA)).
  • a support layer e.g., a sacrificial support layer (e.g., a water soluble sacrificial support layer)
  • a biocompatible polymer e.g., polyvinyl alcohol (PVA)
  • the sacrificial support layer facilitates the removal of the polymer multilayer fram the supporting substrate, facilitates manual handling of the polymer multilayer, and/or facilitates application of the polymer multilayer on a wound. Then, in some embodiments, after placement, the support layer dissolves and thus promotes the adherence of the polymer multilayer to the micro-topography and nano-topography of the wound.
  • the polymers are applied to a wound by a spray, such as via a pump or aerosol device.
  • the polymer layers are applied sequentially.
  • a solution, dispersion, or suspension of the wound modifying agent and wound active agent is sprayed onto the wound to form the polyelectrolyte layer.
  • a propellant is used to provide the force for expulsion from the container.
  • the wound modifying agent or the wound active agent and the propellant form a single liquid phase so that the composition is delivered consistently.
  • the ingredients of the composition are mixed to form a substantially homogenous solution, slurry, dispersion, or the like.
  • each part is mixed.
  • the compositions are placed in an appropriate container and the propellant is added using conventional techniques, such as cold filling or pressure filling techniques.
  • the composition can be delivered using a commercially available aerosol sprayer such as, for example, the PrevalTM aerosol spray unit available from Precision Valve Corporation, NY, USA, which has a modular power unit and refillable container jar.
  • the propellant is a mixture of propane, isobutane, and dimethyl ether.
  • the composition can also be delivered using a syringe outfitted with a spray head, or a dual spray device outfitted with a spray head and, optionally, a mixing chamber.
  • the device may include a meter so that the quantity of applied composition can be controlled.
  • propellants Any of a number of propellants known to those skilled in the art can be used, provided that it is chemically inert to the other ingredients of the composition. Suitable propellants include vinyl chloride and mixtures of vinyl chloride and
  • dichlorodifluoromethane other fluorochlorohydrocarbons known as the Freons and the Genetrons, and blends of fluorochlorohydrocarbons, chlorinated hydrocarbons, and hydrocarbons.
  • fluorochlorohydrocarbons include trichloromonofluoromethane, dichlorodifluoromethane, dichloromonofluoromethane, 2-tetrafluoroethane, 1, 1-dichloro- 1,2,2-tetraf- luoroethane, l-chloro-l, l-difluoroethane, 1, 1-difluoroethane, and
  • octofluorocyclobutane examples include liquefied petroleum gases like propane, isobutane, and N-butane and mixtures thereof.
  • Dimethyl ether is another propellant.
  • Compressed gas propellants that are preferably non-toxic, nonflammable, and inert can be used. Examples include carbon dioxide, nitrous oxide and N 2 and the like. Mixtures of the above are often used.
  • the quantity of propellant used is critical only in that if an insufficient amount is used, the driving force to expel the entire composition from the container will be lacking.
  • the composition will comprise from 75% to 95% by weight propellant.
  • the invention contemplates a kit comprising a container with a cationic polyelectrolyte, a second container containing an anionic polyelectrolyte, and a third container containing at least one wound active agent.
  • the kit in addition to a container with a cationic polyelectrolyte, a second container containing an anionic polyelectrolyte, and a third container containing at least one wound active agent, the kit provides an application device for administering the polyelectrolytes and at least one wound active agent to the wound.
  • the containers comprise a propellant.
  • the containers comprise a pump.
  • contacting comprises delivery of the polymer and the at least one wound active agent to the wound using a reaction chamber dressing (RCD).
  • RCD reaction chamber dressing
  • the RCD will comprise a solid barrier adhered to an area completely surrounding the wound. Within the solid barrier reside inflow and outflow orifices to which tubes from solution reservoirs can be connected.
  • the use of a variety of solid barriers is contemplated, including, but not limited to, Gortex, latex, Teflon, PVDF, plastic and rubber.
  • the wound modification agents are applied to the wound by micro fluidics printing, microstamping (U.S. Pat. Nos. 5,512,131 and 5,731, 152, both of which are incorporated by reference herein in their entirety), or microcontact printing (PCT Publication WO 96/29629, incorporated by reference herein in its entirety).
  • the wound modifying agents are applied to the wound via a pulse jet such as an inkjet printer. Examples of suitable inkjet printers for application of biological fluids include those described in U.S. Pat. No. 7, 128,398, WO 95/251 16 and WO 98/41531, each of which is incorporated by reference in its entirety.
  • the wound modifying agents are applied by a drop dispensers such as the tip of a pin or in an open capillary and, touch the pin or capillary to the surface of the substrate. Such a procedure is described in U.S. Pat. No. 5,807,522. When the fluid touches the surface, some of the fluid is transferred.
  • the wound modifying agents are applied be pipetting, micro-pipetting or positive displacement pumps such as the Biodot equipment (available from Bio-Dot Inc., Irvine Calif, USA).
  • wound active agents are preferably applied to the wound along with the wound modification agent.
  • the wound active agent is covalently attached to the wound modification agent.
  • the wound active agent is incorporated into the wound modifying agent, for example, by application during sequential application of polymer layers in a polymer multilayer.
  • the wound active agents are delivered by a microarrayer, pipette, positive displacement pump, inkjet printer, microneedle array, elastomeric stamp, gene gun, electrojet, or air brush as described above in relation to the wound modifying agents.
  • the wound modifying agent is a nano- or micro-particle.
  • nanometer to submicrometer sized biocompatible particles such as spherical (e.g., beads) and/or non-spherical (e.g., oblongs, needles, cubes, tetrahedral, mushroom-like structures, haybale-like structures) particles or electrospun polymers, are applied (e.g., either directly or indirectly) to the wound bed, thereby creating a three- dimensional topographic wound bed.
  • spherical e.g., beads
  • non-spherical particles e.g., oblongs, needles, cubes, tetrahedral, mushroom-like structures, haybale-like structures
  • electrospun polymers e.g., either directly or indirectly
  • application of biocompatible particles to a wound bed results in the creation of knobs, ridges, spikes, undulations, and the like in the wound bed.
  • Microbeads may further comprise micro- (i.e., from 1 to 100 micrometers) or nano-scale (0.1 to 1000 nanometer) features on the surface of the bead.
  • Nanobeads may further comprise nanoscale features (i.e., 0.1 to 500 nanometer features) on the surface of the bead.
  • a wound active agent is present in the form of a bead or particle, such as silver nanoparticles.
  • the biocompatible particles are biodegradable. In some embodiments, the biocompatible particles are not biodegradable.
  • the biocompatible particles for example, are modified with surface chemistry cross-linkers that allow attachment and immobilization of wound active agents, extracellular matrix compounds, polyelectrolytes, etc. as described further herein. It is contemplated that the incorporation of modified biocompatible particles, for example, facilitates the presentation of ECM constituents that support epithelial coverage of the wound, provides cytoactive factors for wound healing, and introduces topographic features that support cellular behaviors for promoting wound healing.
  • the biocompatible particles are functionalized with mesoscopic cross- linkers to, for example, broadly enable covalent chemistry in the wound bed.
  • cross-linkers are attached to negatively charged biocompatible particles.
  • the biocompatible particles comprise layers of multiple different constituents for wound healing, or a single constituent for wound healing.
  • spherical particles such as beads placed in a wound bed comprise, or upon which are layered, one or more intermixed species of polyelectrolytes, ECM agents, proteins with hydrolysable bonds, proteins with enzymatically cleavable bonds, and the like for wound healing as previously described.
  • antimicrobials either alone or in combination with other wound healing compositions, are also applied to the biocompatible particles.
  • Antimicrobials include, but are not limited to, antibiotics, metal based antimicrobial compositions comprising silver (e.g., ionic silver, elemental silver, silver nanoparticles), copper, selenium, triclosan-based antimicrobials, thiabendazole-based antimicrobials, isothiazolinone-based antimicrobials, zinc-pyrithione-based antimicrobials, and/or 10'- oxybisphenoxarsine-based antimicrobials (OBPA).
  • OBPA oxybisphenoxarsine-based antimicrobials
  • the present invention is not limited by the type of antimicrobial used.
  • the size of the biocompatible particles, such as beads are at least 1 nm, at least 5 nm, at least 10 nm, at least 20 nm, at least 50 nm, at least 100 nm, at least 200 nm, at least 300 nm, at least 500 nm, or at least 800 nm in diameter.
  • beads and other spherical and non-spherical particles contain their own surface topography.
  • the bead surface may comprise undulations, indentations, tunnels, holes, knobs, ridges, etc.
  • Spherical particles, such as beads may or may not be inert and may, for example, be magnetic.
  • Magnetic beads comprise, for example, a magnetic core or magnetic particles.
  • bead compositions are found at, for example, US Patents 5,268, 178, 6,458,858, 6,869,858, and 5,834, 121, each of which is incorporated herein by reference in its entirety.
  • biocompatible particles of the present invention used for wound healing are coated with layers of polyelectrolytes, ECM components, antimicrobials, proteins with hydrolysable bonds, proteins with enzymatically cleavable bonds, etc. and other wound healing compositions wherein the surface compliance of the beads is maintained for optimal wound healing.
  • the compliance of the layers for wound healing as deposited on the biocompatible particles are contemplated to be of optimal stiffness (e.g., not too soft, not too hard) such that cells within the wound bed are capable of optimal anchorage and spreading.
  • Engler et al. discusses substrate compliance for cell anchorage and spreading.
  • the biocompatible particles are layered with polyelectrolytes, ECM components, antimicrobials, etc. wherein substrate stiffness of at least 1 kPa, at least 5 kPa, at least 8 kPa, at leastlO kPa, at least 20 kPa, at least 40 kPa, at least 60 kPa, at least 80 kPa is realized as measured using the methods of Engler et al. (2004).
  • substrate compliance of the wound healing is realized as measured using the methods of Engler et al. (2004).
  • compositions as applied to biocompatible particles is at least 8 kPa to about 80 kPa or 100 kPa. It will be recognized that hardness within these limit are contemplated without specifically listing all such hardnesses, for example, 10, 20, 30 , 40, 50, 60, or 70 kPa limits as upper or lower ranges are all contemplated by the present invention. In some
  • the ECM composition preferentially used in conjunction with polyelectrolytes, antimicrobials, and other wound healing compositions is collagen.
  • the layers as applied to a wound bed or to a biocompatible particle comprise gradients of wound healing compositions, for example, wound active agents.
  • the concentrations of the compositions are layered in a wound bed or on a biocompatible particle in a gradient such that higher concentrations of a particular composition is greater proximal to the wound bed than distal to the wound bed in a vertical fashion.
  • concentrations of compositions is greater distal to the wound bed than proximal, is also contemplated.
  • Concentration of compositions in a wound bed or on a biocompatible particle wherein a horizontal gradient is deposited is also contemplated.
  • Topographical gradients are also contemplated, wherein compositions are deposited such that the concentrations of compositions in a wound bed or on a biocompatible particle follow the topography of the substrate, for example, a higher concentration of compositions is deposited in the valleys of undulations of an exemplary substrate compared to the peaks of the undulations.
  • compliance gradients can be formed in the wound bed by controlled application of micro- or nano-beads of varying hardness.
  • beads having one, two, three, four or more different hardnesses are applied to form a vertical gradient (i.e., a depth gradient) on the wound or a horizontal gradient (i.e., a gradient along the length or width of the wound), or a combination of vertical and horizontal gradients.
  • Horizontal and vertical gradients can also be formed with beads functionalized with 1, 2, 3, 4 or more different wound active agents. See Ichinose et al, Biomaterials. Volume 27, Issue 18, June 2006, Pages 3343-3350; Stefonek et al,
  • wound healing compositions applied to the wound bed or biocompatible particles are time released, such that wound healing compositions that are applied to the wound bed or biocompatible particles are released over a period of time, for example 3 hours, 5 hours, 10 hours, 1 day, several days, one week, several weeks, etc. thereby providing short and/or long term treatment for the wound bed.
  • biocompatible particles used in wound bed healing applications of the present invention are not, for example, spherical as previously described, but take on shapes such as oblongs, needles, mushroom-like structures, haybale-like structures, etc.
  • the biocompatible particle shape is preferably needles.
  • the manufacture of needles useful in embodiments of the present invention can be accomplished through microfabrication techniques, such as those found in, for example, McAllister et al, 2003, Proc. Natl. Acad. Sci. 100: 13755-13760.
  • biocompatible particles are coated and/or layered with wound healing compositions, antimicrobials, proteins that are hydrolyzably cleavable, proteins that are enzymatically cleavable, antimicrobials, etc. as described herein.
  • the coated and/or layered biocompatible particles are applied to a wound bed by stamping, spraying, or other methods as described herein.
  • the layers of wound healing compositions as described herein are deposited on a wound bed or on biocompatible particles by electrostatic bonding. In other compositions, non-electrostatic interactions are utilized, such as van der Waals interactions, metal ion-ligand coordination or hydrogen bonding.
  • the layers of wound healing compositions as described herein are deposited by piezoelectric application, using methods and systems as described in, for example, US Patent 6,368,079 and Sumerel et al, 2006, Biotechnol. J. 1 :976-987.
  • the wound healing compositions are directly or indirectly deposited into the wound bed by using electrojetting technologies, including electroextrusion, and electrospraying and electrospinning.
  • the layers deposited comprise one or more wound healing compositions.
  • the layers are biocompatible particles (e.g. spherical beads, needles, and the like) intermixed with wound healing compositions.
  • layered deposition is sequential. For example, sequential deposition of wound healing compositions alone, or sequential deposition of wound healing compositions followed by biocompatible particles, followed by wound healing compositions, etc.
  • the present invention is not limited by the constituents that make up a layer of deposition on a biocompatible particle, and many permutations of wound healing compositions and biocompatible particle layering would be apparent to a skilled artisan.
  • stamping also referred to as “contact printing”.
  • a stamp substrate is any substrate that can be used to transfer one or more than one entity or composition (e.g., polyelectrolytes, ECM components, proteins with hydrolysable or enzymatically cleavable bonds, etc.) that is (are) covalently or non-covalently bound to the surface of the stamp substrate to another surface.
  • entity or composition e.g., polyelectrolytes, ECM components, proteins with hydrolysable or enzymatically cleavable bonds, etc.
  • suitable stamp substrates include, but are not limited to, polydimethylsiloxane (PDMS) and other elastomeric (e.g., pliable) materials.
  • PDMS polydimethylsiloxane
  • elastomeric e.g., pliable
  • compositions are arrayed on the stamp substrate surface.
  • multiple wound healing compositions in multiple concentrations are arrayed on the stamp substrate surface.
  • the wound healing compositions are then introduced to the stamp substrate surface, which are in turn stamped into the wound bed or onto another substrate for introduction into the wound bed (e.g., biocompatible particles).
  • the biocompatible particles for example needles, are coated and/or layered with wound healing compositions, anti-microbials, proteins that are hydrolyzably cleavable, proteins that are enzymatically cleavable, etc., and applied to a pad which is subsequently applied to a wound.
  • Pads include, but are not limited to, band-aids, gauze, surgical packings, and the like.
  • the pad is impregnated with wound healing compositions, anti-microbials, proteins that are hydrolyzably cleavable, proteins that are enzymatically cleavable, etc.
  • the biocompatible particles e.g., covered and/or layered with wound healing compositions, anti-microbials, proteins that are hydrolyzably cleavable, proteins that are enzymatically cleavable, etc.
  • the biocompatible particles are affixed in a detachable or non-detachable manner to the pad prior to applying the pad to a wound.
  • the biocompatible particles when the pad is removed from the wound the biocompatible particles are retained (e.g., not detached) on the pad, whereas in other embodiments when the pad is removed from the wound the nanostructures are retained (e.g., detached) in the wound bed.
  • a pad is impregnated with compositions as described and further affixed with biocompatible particles that are themselves coated and/or layered with compositions as described for wound healing.
  • the pad with biocompatible particles is applied to the wound and while the pad is superficial to the wound bed, the biocompatible particles thereon reach down in proximity with the wound bed as compared to the location of the pad.
  • the pad releases (e.g., either over a short period of time or in a time-release manner) the impregnated wound healing compositions on or near the surface of the wound whereas the affixed biocompatible particles release the coated and/or layered wound healing compositions (e.g., either over a short period of time or in a time-release manner) more proximal to the wound bed.
  • a pad with affixed biocompatible particles (both pad and nanostructures comprising wound healing compositions as previously described) is first applied to a wound bed.
  • the pad is subsequently removed; however the detachable biocompatible particles remain in the wound bed.
  • the pad serves not only to deliver wound healing compositions to a wound bed, but further serves a purpose of delivering biocompatible particles, such as needles, into a wound bed.
  • the biocompatible particles left in the wound bed for example, continue releasing wound healing compositions to the wound bed for further healing.
  • a new (e.g., second, third, fourth, etc.) pad comprising impregnated wound healing compositions as previously described is re-applied to the wound wherein resides the biocompatible particles retained by the original application of the first pad/nanostructure.
  • the application of the new pad serves not only to impart fresh wound healing compositions to a wound but also serves to recoat the biocompatible particles with fresh would healing compositions that are released (e.g., either over a short period of time or in a time-release manner) proximal to the wound bed.
  • the present invention is not limited to a particular mechanism. Indeed, an understanding of the mechanism is not necessary to practice the present invention.
  • the negatively charged macromolecular species and beads do not readily pass across cell membranes, and therefore serve as a non-toxic means of wound bed healing.
  • the size of the beads used determines the nanostructure of the wound bed, thereby allowing for personalized wound bed healing therapies.
  • Figure 6 provides an exemplary embodiment of the use of beads for wound bed healing.
  • the present invention is not limited by the size of bead, the reactive groups found on the beads (e.g., carboxylic acid groups, thiol groups, amine groups, etc.), the cross-linkers used, or the cytoactive factors and other wound healing compositions that are associated with the beads.
  • a myriad of combinations of compounds e.g., small molecule, peptides, proteins, drugs, etc
  • for wound healing is contemplated for use with beads applied to a wound bed.
  • the particles modulate a wound response following an application of an electric or magnetic field to the wound bed. Accordingly, in some embodiments, the particles are charged or magnetized so that the particles migrate or reorganize in an electric or magnetic field. In other embodiments, the beads are dielectric so that the beads experience dielectrophoresis in an AC electrical field. In other embodiments, the beads are magnetic and migrate and/or transmit mechanical forces when exposed to a magnetic field. In other embodiments, the beads are charged so that mechanical forces are applied to the wound bed when an electric field is applied, for example, by placing electrodes on either side of a wound.
  • the nano- or micro-beads are applied to the wound by micro fluidics printing, microstamping (U.S. Pat. Nos. 5,512,131 and 5,731, 152, both of which are incorporated by reference herein in their entirety), or microcontact printing (PCT Publication WO 96/29629, incorporated by reference herein in its entirety).
  • the nano- or micro-beads are applied to the wound via a pulse jet such as an inkjet printer. Examples of suitable inkjet printers for application of biological fluids include those described in U.S. Pat. No. 7, 128,398, WO 95/251 16 and WO 98/41531, each of which is incorporated by reference in its entirety.
  • the nano- or micro-beads are applied by drop dispensers such as the tip of a pin or in an open capillary tube and, touch the pin or capillary tube to the surface of the substrate.
  • drop dispensers such as the tip of a pin or in an open capillary tube and, touch the pin or capillary tube to the surface of the substrate.
  • the wound modifying agents are applied be pipetting, micro-pipetting or positive displacement pumps such as the Biodot equipment (available from Bio-Dot Inc., Irvine Calif, USA).
  • the nano- or micro-beads are applied to the wound via a microneedle array.
  • the present invention provides for the covalent immobilization of factors to the wound bed.
  • the covalent modification occurs via homobifunctional or heterobifunctional linkers.
  • the covalent modifiers are used to directly modify the wound bed by covalently attaching the wound bed.
  • the covalent modifiers are used to covalently attach 1, 2, 3, 4 or more different wound active agents to the wound bed.
  • the covalent modifiers are used to establish gradients of the 1, 2, 3, 4 or more different wound active agents in a vertical or horizontal plane with respect to the wound.
  • the covalent modifiers are used in conjunction with the polymer layers or beads describes above.
  • the covalent modifies are used to attach wound active agents to the polymer layers or beads, while in other embodiments, the covalent modifies are used to cross link the polymers or beads.
  • the present invention provides methods of treatment, comprising providing a subject having a wound, at least one covalent modification agent and at least one wound active agent, and contacting the wound with the at least one covalent modification agent and the at least one wound active agent under conditions such that the at least one wound active agent is covalently attached to the wound.
  • the subject is a human.
  • the subject is a non-human vertebrate.
  • the at least one covalent modification agent is a homobifunctional cross-linker.
  • the at least one covalent modification agent is a heterobifunctional cross-linker.
  • the homobifunctional cross-linker is an N- hydroxysuccinimidyl ester (e.g., including, but not limited to, disuccinimidyl ester, dithiobis(succinimidylpropionate), 3,3 '-dithiobis(sulfosuccinimidylpropionate),
  • N- hydroxysuccinimidyl ester e.g., including, but not limited to, disuccinimidyl ester, dithiobis(succinimidylpropionate), 3,3 '-dithiobis(sulfosuccinimidylpropionate)
  • disuccinimidyl suberate bis(sulfosuccinimidyl)suberate, disuccinimidyl tartarate, disulfosuccinimidyl tartarate, bis[2-(succinimidyloxycarbonyloxy) ethyl] sulfone, bis[2- (sulfosuccinimidooxycarbonyloxy) ethyl] sulfone, ethylene glycolbis(succinimidyl-succinate), ethylene glycolbis(sulfosuccinimidyl-succinate), disuccinimidyl glutarate, and ⁇ , ⁇ '- disuccinimidylcarbonate).
  • the homobifunctional cross-linker is at a concentration between 1 nanomolar and 10 millimolar. In some preferred embodiments, the homobifunctional cross-linker is at a concentration between 10 micromolar and 1 millimolar.
  • the at least one covalent modification agent is a heterobifunctional cross-linker (e.g., including, but not limited to, N-succinimidyl 3-(2-pyridyldithio)propionate, succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate, sulfosuccinimidyl 6-(3'-[2- pyridyldithio]-propionamido)hexanoate, succinimidyloxycarbonyl-a-methyl-a-(2- pyridyldithio)toluene, sulfosuccinimidyl-6-[a-methyl-
  • the heterobifunctional cross-linker is modified with functional groups, rendering it soluble in aqueous solvents for delivery as an aqueous solution.
  • the aqueous solution contains additives (e.g., including, but not limited to, surfactants and block copolymers).
  • additives e.g., including, but not limited to, surfactants and block copolymers.
  • a multiplicity of hetero-bifunctional cross-linkers can be attached to a molecule, polymer or particle to serve as the cross-linking agent.
  • the heterobifunctional cross-linker is dissolved in an organic solvent (e.g., including, but not limited to, dimethyl sulfoxide).
  • the at least one wound active agent includes, but is not limited to, trophic factors, extracellular matrices, enzymes, enzyme inhibitors, defensins, polypeptides, anti-infective agents (including but not limited to silver (e.g., ionic silver, elemental silver, silver nanoparticles)), buffering agents, vitamins and minerals, analgesics, anticoagulants, coagulation factors, anti-inflammatory agents, vasoconstrictors, vasodilators, diuretics, and anti-cancer agents.
  • the at least one wound active agent contains one or more free -SH groups.
  • the covalent modifier is a photoactivatable crosslinker.
  • Suitable photoactivatable crosslinkers include, but are not limited to, aryl azide N-((2- pyridyldithio)ethyl)-4-azidosalicylamide, 4-azido-2,3,5,6-tetrafluorobenzoic acid, succinimidyl ester, 4-azido-2,3,5,6-tetrafluorobenzoic acid, STP ester, benzophenone maleimide, succinimidyl ester of 4-benzoylbenzoic acid, N-5-Azido-2- Nitrobenzoyloxysuccinimide, N-hydroxysulfosuccinimidyl-4-azidobenzoate, N- Hydroxysuccinimidyl-4-azidosalicylic acid, and (4-[p-Azidosalicylamido]butylamine).
  • a crosslinker e.g., 230 in Figure 2 comprising an activated acid is used to react with amine groups, for example nHS (n-hydroxy succinimidyl) and a second crosslinker (e.g., 235 in Figure 2) comprising a malemide is used to react with sulfhydryl groups.
  • the malimide and activated acid are conjugated to an alkyne so that a uniform surface is presented (e.g., 240 in Figure 2 where x represents an alkyne group). From this point, widely available click chemistries can be used to add desired wound active agents to the modified surface of the wound.
  • the wound modifying agent is an azide conjugate or otherwise comprises an azide group and is reacted with the alkyne groups displayed on the wound bed in a Huisgen Cycloaddition.
  • kits for treating a subject having a wound comprising at least one covalent modification agent, at least one wound active agent, and instructions for using the kit to covalently link the at least one wound active agent to the wound.
  • the at least one covalent modification agent is a
  • the at least one wound active agent includes, but is not limited to wound active agents described in detail below.
  • the present invention also provides a kit for treating a subject having a wound, comprising at least one covalent modification agent, at least one wound active agent, and instructions for using the kit to covalently link the at least one wound active agent to the wound.
  • the at least one covalent modification agent is a
  • the homobifunctional cross-linker is an N-hydroxysuccinimidyl ester (e.g., including, but not limited to, disuccinimidyl ester, dithiote(succinimidylpropionate), 3,3 '-dithio/? «(sulfosuccinimidylpropionate),
  • disuccinimidyl suberate Zra(sulfosuccinirnidyl)suberate, disuccinimidyl tartarate, disulfosuccinimidyl tartarate, te[2-(succinimidyloxycarbonyloxy) ethyl] sulfone, bis[2- (sulfosuccinimidooxycarbonyloxy) ethyl] sulfone, ethylene glycolfo ' s(succinimidylsuccinate), ethylene glycolte(sulfosuccinimidyl-succinate), disuccinimidyl glutarate, and N,N'- disuccinimidylcarbonate).
  • the at least one covalent modification agent is a heterobifunctional cross-linker (e.g., including, but not limited to, N-succinimidyl 3-(2- pyridyldithio)propionate, succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate, sulfosuccinimidyl 6-(3'-[2-pyridyldithio]-propionamido)hexanoate,
  • a heterobifunctional cross-linker e.g., including, but not limited to, N-succinimidyl 3-(2- pyridyldithio)propionate, succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate, sulfosuccinimidyl 6-(3'-[2-pyridyldithio]-propiona
  • the at least one wound active agent includes, but is not limited to, trophic factors (including polypetide growth factors, neuropeptides, neurotrophins, , extracellular matrices and their individual native constituents (exemplified by but not limited to laminin, fibronectin, vitronectin, collagens, also select amino acid sequences found in these proteins known to promote cell behaviors favorable to wound healing e.g.
  • trophic factors including polypetide growth factors, neuropeptides, neurotrophins, , extracellular matrices and their individual native constituents (exemplified by but not limited to laminin, fibronectin, vitronectin, collagens, also select amino acid sequences found in these proteins known to promote cell behaviors favorable to wound healing e.g.
  • integrin binding sequences exemplified by but not limited to RGD, EILDV,VCAM- 1 and their recombined or synthetic analogs, enzymes, enzyme inhibitors, polypeptides, antimicrobial peptides (exemplified by but not limited to defensins, magaignins, cathelocidins, bactenicin) anti-infective agents (including but not limited to silver (e.g., ionic silver, elemental silver, silver nanoparticles)), buffering agents, vitamins and minerals, compounds that promote generation/stabilization of nitic oxide, energy sources for cells, analgesics, anticoagulants, coagulation factors, anti-inflammatory agents, vasoconstrictors, vasodilators, diuretics, and anti-cancer agents.
  • kits include small interfering RNAs (siRNAs- also referred to as micro RNAs) that are capable of promoting cellular behaviors conducive to the wound healing process.
  • the kits include compounds that promote/stabilize a favorable pH, osmotic environment, surface energy, surface charge, surface functionalities that enhance galvano and magneto positive effects on wound healing, or balance of MMP/other peptidase/protease activity (i.e. inhibitors/promoters).
  • wound active agents are delivered to a wound bed or incorporated into a wound bed using the systems described above.
  • the wound active agent is bound covalently or non-covalently with the polyelectrolyte layer, bead, non-covalent modifier, etc.
  • the present invention is not limited to a particular mechanism by which the wound active agent binds to the polyelectrolyte layer, bead, non- covalent modifier, etc.
  • the polyelectrolyte layer, beads, or non-covalent modifier may function as a drug delivery scaffold to deliver one or more wound active agents to the wound.
  • Wound active agents that may be desirable to deliver include, but are not limited to, trophic factors, extracellular matrices (ECMs), ECM fragments or synthetic constructs, enzymes, enzyme inhibitors, defensins, polypeptides, anti-infective agents (including antimicrobials, antivirals and antifungals), buffering agents, vitamins and minerals, analgesics,
  • anticoagulants include chlorhexidine, iodine based antimicrobials such as PVP-iodine; selenium based antimicrobials such as 7- azabenzisoselenazol-3(2H)-ones, selenium disulfide, and selenides; and silver based antimicrobials (e.g., silver sulfadiazine, ionic silver, elemental silver, silver nanoparticles)).
  • iodine based antimicrobials such as PVP-iodine
  • selenium based antimicrobials such as 7- azabenzisoselenazol-3(2H)-ones, selenium disulfide, and selenides
  • silver based antimicrobials e.g., silver sulfadiazine, ionic silver, elemental silver, silver nanoparticles
  • carboxyl and amino containing selenides may be routinely attached to many polymers, peptides, antibodies, steroids and drugs. Polymers and other molecules with attached selenides generate superoxide in a dose dependent manner in biological solutions, in cells or attached to insoluble matrixes such as silicones.
  • wound active agents can be incorporated into the polyelectrolyte layer, beads, or covalent or non-covalent modifier.
  • the present invention is not limited to a particular mechanism by which one or more wound active agents are released from the polyelectrolyte layer, beads, or covalent or non-covalent modifier into the wound. Indeed, an understanding of the mechanism is not necessary to practice the present invention.
  • the present invention contemplates release of the one or more incorporated agents from the polyelectrolyte layer, beads, or non-covalent modifier to the wound by diffusion from the polyelectrolyte layer.
  • the one or more wound active agents may be released from the polyelectrolyte layer, beads, or non-covalent modifier over time or in response to an environmental condition.
  • the one or more wound active agents may be attached by a degradable linkage, such as a linkage susceptible to degradation via hydrolysis or enzymatic degradation.
  • the linkage may be one that is susceptible to degradation at a certain pH, for example.
  • the one or more wound active agents are applied to form a gradient with respect to the wound modifying agent.
  • the gradients present a higher contraction of wound active agent at one or more first desired locations in the wound following application of the wound modifying agent to the wound and a lower concentration of wound active agent at one or second location in the wound following application of the wound modifying agent to the wound.
  • the concentrations of the wound active agents are layered in a wound bed in a gradient such that higher concentrations of a particular composition is greater proximal to the wound bed than distal to the wound bed in a vertical fashion. The converse, where concentrations of compositions is greater distal to the wound bed than proximal, is also contemplated.
  • compositions in a wound bed wherein a horizontal gradient is deposited Concentration of compositions in a wound bed wherein a horizontal gradient is deposited is also contemplated. Topographical gradients are also contemplated, wherein compositions are deposited such that the concentrations of compositions in a wound bed or on a biocompatible particle follow the topography of the substrate, for example, a higher concentration of compositions is deposited in the valleys of undulations of an exemplary substrate compared to the peaks of the undulations.
  • the gradient comprises a higher concentration of the wound active agent in the center of the wound modifying agent which transitions to a lower concentration of the wound active agent away from the center of the wound modifying agent. Accordingly, when the wound modifying agent is applied to a wound, the gradient results in a higher concentration of wound active agent in the center of the wound and a lower concentration of wound active agent as one moves to the periphery of the wound. In some embodiments, the gradient comprises a lower concentration of the wound active agent in the center of the wound modifying agent which transitions to a higher concentration of the wound active agent away from the center of the wound modifying agent.
  • the gradient results in a lower concentration of wound active agent in the center of the wound and a higher concentration of wound active agent as one moves to the periphery of the wound.
  • two or more wound active agents are utilized, they can be presented as similar gradients or the gradients can be varied so that the concentrations of the two or more wound active agents vary across the wound.
  • the gradients of high or low concentration can be any shape, such as circular, square, rectangular, oval, oblong, etc. so that the matrix and gradient can conform to a variety of wound shapes.
  • the gradient may be centered on a longitudinal axis that extends along the length of the wound and can be centered on the wound.
  • the gradient can be circular or oval-shaped for application to open type wounds, burns, sores and ulcers that are roughly circular or oval.
  • the gradients comprise a series of features arranged in a pattern.
  • the gradients can form a series of stripes or high and low concentrations of one or more wound active agents along a longitudinal axis of the matrix.
  • the gradients can form a checkerboard pattern, array, concentric circles, overlapping circles or oval, etc.
  • the present invention contemplates delivery of a wide variety of wound active agents to the wound.
  • the present invention provides the delivery of trophic factors, including, but not limited to, agrin, amphiregulin, artemin, cardiotrophin-1, epidermal growth factors including EGF; fibroblast growth factors (e.g., FGF-1, FGF-2, FGF-3, FGF-4, FGF-5, FGF-6, and FGF-7); LIF, CSF-1, CSF-2, CSF-3, erythropoietin, endothelial cell growth factors including ECGF; FGF- related and ECGF-related growth factors (e.g., endothelial cell stimulating angiogenesis factor, tumor angiogenesis factor, retina-derived growth factor (RDGF), vascular endothelium growth factor (VEGF), brain-derived growth factors (BDGF-A and B), astroglial growth factors (AGF 1 and 2), omentum-derived growth factor, fibroblast-stimulating factor (FSF),
  • heregulin/neuregulin IL-1, osteoclast-activating factor (OAF), lymphocyte-activating factor (LAF), hepatocyte-stimulating factor (HSF), B-cell-activating factor (BAF), tumor inhibitory factor 2 (TIF -2), keratinocyte-derived T-cell growth factor (KD-TCGF), IL-2, IL-3, IL-4, IL- 5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-1 1, stromal cell-derived cytokine (SCDC), IL-12, IL-13, IL-14, IL-15, insulin, insulin-like growth factors including IGF-1, IGF-2, and IGF-BP;
  • the wound active agent is a peptide such as AcEEED, which is the N terminal peptide for alpha smooth muscle actin and has been shown to inhibit contractile properties of myofibroblasts.
  • the present invention provides the delivery of ECMs, including, but not limited to native constructs, fragments of native constructs and synthetic analogs of: extracellular matrix proteins, reconstituted basement membrane-like complexes derived from eukaryotic cell lines, collagens, fibronectin, laminin, VCAM-1, vitronectin and gelatin, a bacterial extracellular matrix, a gel matrix, and polymeric matrices.
  • the wound active agents are integrin binding sequences exemplified by, but not limited to RGD, EILDV, VCAM- 1 and their recombined or synthetic analogs, enzymes, enzyme inhibitors, and polypeptides.
  • the present invention provides the delivery of enzymes, including, but not limited to, exopeptidases and endopeptidases (also known as proteases and proteinases), including but not limited to the serine proteinases chymotrypsin, trypsin, elastase, and kallikrein, bacterial enzymes, the cysteine proteases papain, actinin, bromelain, cathepsins, cytosolic calpains, parasitic proteases, aspartic proteinases, the pepsin family of proteases pepsin and chymosin, lysosomal cathepsins D, renin, fungal proteases, the viral proteases, AIDS virus retropepsin, and the metalloproteinases (MMPs), collagenases, Maggott enzyme, MMP1, MMP2, MMP8, MMP13, gelatinases, MMP2, MMP9, MMP3, MMP7, MMP10, MMP
  • the present invention provides the delivery of enzyme inhibitors, including, but not limited to captopril, thiorphan, phosphoramidon, teprotide, protease and proteinase inhibitors, metalloproteinase inhibitors and exopeptidase inhibitors.
  • enzyme inhibitors including, but not limited to captopril, thiorphan, phosphoramidon, teprotide, protease and proteinase inhibitors, metalloproteinase inhibitors and exopeptidase inhibitors.
  • the present invention provides the delivery of defensins, including, but not limited to, alpha-defensins HNP 1, 2, 3 and 4, and beta-defensins HBD-1 and HBD-2.
  • defensins including, but not limited to, alpha-defensins HNP 1, 2, 3 and 4, and beta-defensins HBD-1 and HBD-2.
  • the present invention provides the delivery of polypeptides, including, but not limited to, fibronectin, serotonin, PAF, PDEGF, TNFa, ILl, IL6, IGF, IGF- 1, IGF-2, IL-1, PDGF, FGF, KGF, VEGF, bradykinin, prothymosin-alpha, and thymosin- alphal .
  • polypeptides including, but not limited to, fibronectin, serotonin, PAF, PDEGF, TNFa, ILl, IL6, IGF, IGF- 1, IGF-2, IL-1, PDGF, FGF, KGF, VEGF, bradykinin, prothymosin-alpha, and thymosin- alphal .
  • the present invention provides the delivery of antimicrobials, including, but not limited to, magainin (e.g., magainin I, magainin II, xenopsin, xenopsin precursor fragment, caerulein precursor fragment), magainin I and II analogs (e.g., PGLa, magainin A, magainin G, pexiganin, Z-12, pexigainin acetate, D35, MSI-78A, MGO (K10E, Kl IE, F12W-magainin 2), MG2+ (K10E, F12W-magainin-2), MG4+ (F 12W-magainin 2), MG6+ (fl2W, E19Q-magainin 2 amide), MSI-238, reversed magainin II analogs (e.g., 53D, 87-ISM, and A87-ISM), Ala-magainin II amide, magainin II amide), cecropin P I,
  • the antimicrobial peptides are synthesized from L-amino acids, while in other embodiments, the peptides are synthesized from, or comprise, D-amino acids. Additional antimicrobial polypeptides of use in the present invention are listed in Figure 7.
  • cecropin C Drosophila mnfykiivivalilaisigqseagwlkklgkrierigqht melanogaster rdatiqglgiaqqaanvaatarg
  • cecropin P 1 Sus scrofa swlsktakklensakkrisegiaiaiqggpr indolicidin Bos taurus ilpwkwpwwpwrr
  • protegrin-1 Sus scrofa rggrlcycrrrfcvcvgrx
  • protegrin-2 Sus scrofa ggrlcycrrrfcicvg
  • cathelicidin Homo sapiens mktqrnghslgrwslvllllglvmplaiiaqvlsykeavl antimicrobial peptide raidginqrssdanlyrlldldprptmdgdpdtpkpvsft vketvcprttqqspedcdfkkdglvkrcmgtvtlnqargs fdiscdkdnkrfallgdffrkskekigkefkrivqrikdf lrnlvprtes myeloid cathelicidin 3 Equus caballus metqrntrclgrwsplllllglvippattqalsykeavlr avdglnqrssdenlyrlleldplpkgdkdsdtpkpvsfmv ketvcprimkqtpeqcdfkenglvkqcvgtvild
  • HNP-1 Homo sapiens acycripaciagerrygtciyqgrlwafcc
  • HNP-2 Homo sapiens cycripaciagerrygtciyqgrlwafcc
  • HNP-3 Homo sapiens dcycripaciagerrygtciyqgrlwafcc
  • HNP-4 Homo sapiens vcscrlvfcrrtelrvgncliggvsftycctrv
  • beta defensin-3 Homo sapiens mrihyllfallflflvpvpghggiintlqkyycrvrggrc avlsclpkeeqigkcstrgrkccrrkk theta defensin-1 Macaca mulatta rcictrgfcrclcrrgvc defensin CUA1 Helianthus mkssmkmfaalllwmcllanemggplvveartcesqshk annuus fkgtclsdtncanvchserfsggkcrgfrrrcfctthc defensin SD2 Helianthus mkssmkmfaalllvvmcllanemggplweartcesqshk annuus fkgtclsdtncanvchserfsggkcrgfrrrcfctthc neutrophil de
  • defensin AMP 1 Heuchera dgvklcdvpsgtwsghcgssskcsqqckfanfayggach sanguinea yqfpsvkcfckrqc defensin AMP1 Clitoria nlcerasltwtgncgntghcdtqcrnwesakhgachkrgn tematea wkcfcyfnc cysteine-rich Mus musculus mkklvllfalvllafqvqadsiqntdeetkteeqpgekdq cryptdin-1 homolog avsvsfgdpqgsalqdaalgwgrrcpqcprcpscpscprc prcprckcnpk beta-defensin-9 Bos taurus qgvrnfVtcrinrgfcvpircpghrrq
  • beta-defensin-2 Pan troglodytes mrvlyllfsflfiflmplpgvfggisdpvtclksgaichp vfcprrykqigtcglpgtkcckkp
  • the present invention provides the delivery of antimicrobials, including, but not limited to, loracarbef, cephalexin, cefadroxil, cefixime, ceftibuten, cefprozil, cefpodoxime, cephradine, cefuroxime, cefaclor, neomycin/polymyxin/bacitracin, dicloxacillin, nitrofurantoin, nitrofurantoin macrocrystal, nitrofurantoin/nitrofuran mac, dirithromycin, gemifloxacin, ampicillin, gatifloxacin, penicillin V potassium, ciprofloxacin, enoxacin, amoxicillin, amoxicillin/clavulanate potassium, clarithromycin, levofloxacin, moxifloxacin, azithromycin, sparfloxacin, cefdinir, ofloxacin, trovafloxacin, lomefloxacin, methenamine, erythromycin
  • quinupristin/dalfopristin doxycycline, amikacin sulfate, vancomycin, kanamycin, netilmicin, streptomycin, tobramycin sulfate, gentamicin sulfate, tetracyclines, framycetin, minocycline, nalidixic acid, demeclocycline, trimethoprim, miconazole, colistimethate, piperacillin sodium/tazobactam sodium, paromomycin, colistin/neomycin/hydrocortisone, amebicides, sulfisoxazole, pentamidine, sulfadiazine, clindamycin phosphate, metronidazole, oxacillin sodium, nafcillin sodium, vancomycin hydrochloride, clindamycin, cefotaxime sodium, co- trimoxazole, ticarcillin disodium, piperacill
  • the present invention provides the delivery of antivirals, including, but not limited to, amantadine, acyclovir, foscarnet, indinavir, ribavirin, enfuvirtide, emtricitabine, lamivudine, abacavir sulfate, fomivirsen, valacyclovir, tenofovir, cidofovir, atazanavir, amprenavir, delavirdine mesylate, famciclovir, adefovir, didanosine, efavirenz, trifluridine, inidinavir, lamivudine, vidarabine, lopinavir/ritonavir, ganciclovir, zanamivir, abacavir/lamivudine/zidovudine, lamivudine/zidovudine, nelfinavir, nelfinavir mesy
  • the present invention provides the delivery of antifungals, including, but not limited to, amphotericin B, nystatin, nystatin/triamcinolone, itraconazole, ketoconazole, miconazole, sulconazole, clotrimazole, clotrimazole/betamethasone, enilconazole, econazole, oxiconazole, tioconazole, terconazole, butoconazole, thiabendazole, flucytosine, butenafine, ciclopirox, haloprogin, naftifine, tolnaftate, natamycin, undecylenic acid, mafenide, dapsone, clioquinol, clioquinol/hydrocortisone, potassium iodide, silver sulfadiazine, gentian violet, carbol-fuchsin, cilofungin, sertaconazole
  • the present invention provides the use and delivery of buffering agents, including, but not limited to, Maleic acid, Phosphoric acid, Glycine, Chloroacetic acid, Formic acid, Benzoic acid, Acetic acid, Pyridine, Piperazine, MES, Bis- tris, Carbonate, ACES, ADA MOPSO, PIPES, Phosphoric acid, BES, MOPS, TES, HEPES, DIPSO, TAPSO, Triethanolamine, HEPSO, Tris, Tricine, Bicine, TAPS, Borate, Ammonia, CHES, Ethanolamine, CAPSO, Glycine, Carbonate, CAPS, Methylamine, Piperidine, and Phosphoric acid.
  • buffering agents including, but not limited to, Maleic acid, Phosphoric acid, Glycine, Chloroacetic acid, Formic acid, Benzoic acid, Acetic acid, Pyridine, Piperazine, MES, Bis- tris, Carbonate, ACES, ADA M
  • the present invention provides the delivery of vitamins and minerals, including, but not limited to, Vitamin A, Carotenoids, Vitamin D, Vitamin E, Vitamin K, Vitamin C/ascorbic acid, Bl/thiamin, B2/riboflavin, B3/niacin, B5/pantothenic acid, B6/pyridoxine, B12/cobalamin, Biotin, Calcium, Magnesium, Phosphorus, Sodium, Chloride, Potassium, Boron, Chromium, Copper, Iodine, Iron, Manganese, Selenium, and Zinc.
  • the present invention provides the delivery of analgesics, including, but not limited to, acetaminophen, anileridine, acetylsalicylic acid, buprenorphine, butorphanol, fentanyl, fentanyl citrate, codeine, rofecoxib, hydrocodone, hydromorphone, hydromorphone hydrochloride, levorphanol, alfentanil hydrochloride, meperidine, meperidine hydrochloride, methadone, morphine, nalbuphine, opium, levomethadyl, hyaluronate sodium, sufentanil citrate, capsaicin, tramadol, leflunomide, oxycodone, oxymorphone, celecoxib, pentazocine, propoxyphene, benzocaine, lidocaine, dezocine, clonidine, butalbital, phenobarbital, tetracaine,
  • the present invention provides the delivery of anticoagulants, including, but not limited to, coumarins, 1,3-indandione, anisindione, fondaparinux, heparin, lepirudin, antithrombin, warfarin, enoxaparin, dipyridamole, dalteparin, ardeparin, nadroparin, and tinzaparin.
  • anticoagulants including, but not limited to, coumarins, 1,3-indandione, anisindione, fondaparinux, heparin, lepirudin, antithrombin, warfarin, enoxaparin, dipyridamole, dalteparin, ardeparin, nadroparin, and tinzaparin.
  • the present invention provides the delivery of coagulation factors, including, but not limited to, Factor I (fibrinogen), Factor II (prothrombin), Factor III (thromboplastin, tissue factor), Factor IV (calcium), Factor V (labile factor), Factor VII (stable factor), Factor VIII (antihemophilic globulin, antihemophilic globulin, antihemophilic factor A), Factor IX (plasma thromboplastin component, Christmas factor, antihemophilic factor B), Factor X (Stuart factor, Prower factor, Stuart-Prower factor), Factor XI (plasma thromboplastin antecedent, antihemophilic factor C), Factor XII (Hageman factor, surface factor, contact factor), and Factor XIII (fibrin stabilizing factor, fibrin stabilizing enzyme, fibri-nase).
  • Factor I fibrinogen
  • Factor II prothrombin
  • Factor III thromboplastin, tissue factor
  • Factor IV calcium
  • the present invention provides the delivery of antiinflammatory agents, including, but not limited to, non steroidal anti-inflammatory drugs ( SAIDs) including diclofenac (also known as Voltaren, Abitren, Allvoran, Almiral, Alonpin, Anfenax, Artrites, Betaren, Blesin, Bolabomin, Cataflam, Clofec, Clofen,
  • SAIDs non steroidal anti-inflammatory drugs
  • diclofenac also known as Voltaren, Abitren, Allvoran, Almiral, Alonpin, Anfenax, Artrites, Betaren, Blesin, Bolabomin, Cataflam, Clofec, Clofen,
  • ketoprofen also known as Orudis, Alrheumat, Alrheumun, Alrhumat, Aneol, Arcental, Dexal, Epatec, Fastum, Keduril, Kefenid, Keprofen, Ketofen, Ketonal, Ketosolan, Kevadon, Mero, Naxal, Oruvail, Profenid, Salient, Tofen, and Treosin
  • ketorolac also known as Toradol
  • meclofenamate also known as Meclofen, Meclomen, and Movens
  • mefenamic acid also known as Ponstel, Alpain, Aprostal, Benostan, Bonabol, Coslan, Dysman, Dyspen, Ecopan, Lysalgo, Manic, Mefac, Mefic, Mefix, Parkemed, Pondex, Ponsfen, Ponstan, Ponstyl, Pontal, Ralgec, and Youfenam
  • nabumetone also known as Relafen
  • naproxen also known as Naprosyn, Anaprox, Aleve, Apranax, Apronax, Arthrisil, Artrixen, Artroxen, Bonyl, Congex, Danaprox, Diocodal, Dysmenalgit, Femex, Flanax, Flexipen, Floginax, Gibixen, Headlon, Laraflex, Laser, Leniartil, Nafasol, Naixan, Na
  • the present invention provides the delivery of vasoconstrictors, including, but not limited to, epinephrine (adrenaline, Susphrine), phenylephrine
  • the present invention provides the delivery of vasodilators, including, but not limited to, bosentan (Tracleer), epoprostenol (Flolan), treprostinil
  • vasodilators including, but not limited to, bosentan (Tracleer), epoprostenol (Flolan), treprostinil
  • Noniten isosorbide dinitrate (Dilatrate-SR, Iso-Bid, Isonate, Isorbid, Isordil, Isotrate, Sorbitrate), isorbide mononitrate (IMDUR), prazosin (Minipress), cilostazol (Pletal), treprostinil (Remodulin), cyclandelate, isoxsuprine (Vasodilan), nylidrin (Arlidin), nitrates (Deponit, Minitran, Nitro-Bid, Nitrodisc, Nitro-Dur, Nitrol, Transderm-Nitro), benazepril (Lotensin), benazepril and hydrochlorothiazide (Lotensin HCT), captopril (Capoten), captopril and hydrochlorothiazide (Capozide), enalapril (Vasotec), enalapril (
  • hydrochlorothiazide (Vaseretic), fosinopril (Monopril), lisinopril (Prinivil, Zestril), lisinopril and hydrochlorothiazide (Prinzide, Zestoretic), moexipril (Univasc), moexipril and hydrochlorothiazide (Uniretic), perindopril (Aceon), quinapril (Accupril), quinapril and hydrochlorothiazide (Accuretic), ramipril (Altace), trandolapril (Mavik), papaverine (Cerespan, Genabid, Pavabid, Pavabid HP, Pavacels, Pavacot, Pavagen, Pavarine, Pavased, Pavatine, Pavatym, Paverolan).
  • the present invention provides the delivery of diuretics, including, but not limited to, acetazolamide (Diamox), dichlorphenamide (Daranide), methazolamide (Neptazane), bendroflumethiazide ( aturetin), benzthiazide (Exna), chlorothiazide (Diuril), chlorthalidone (Hygroton), hydrochlorothiazide (Esidrix,
  • methyclothiazide (Enduron), metolazone (Zaroxolyn, Mykrox), polythiazide (Renese), quinethazone (Hydromox), trichlormethiazide (Naqua), bumetanide (Bumex), ethacrynic acid (Edecrin), furosemide (Lasix), torsemide (Demadex), amiloride (Midamor), amiloride and hydrochlorothiazide (Moduretic), spironolactone (Aldactone), spironolactone and
  • hydrochlorothiazide Aldactazide
  • triamterene Dyrenium
  • triamterene triamterene
  • hydrochlorothiazide (Dyazide, Maxzide).
  • the present invention provides the delivery of anti-cancer agents, including, but not limited to, aldesleukin, alemtuzumab, alitretinoin, allopurinol, altretamine, amifostine, anagrelide, anastrozole, arsenic trioxide, asparaginase, bexarotene, bicalutamide, bleomycin, busulfan, calusterone, capecitabine, carboplatin, carmustine, celecoxib, chlorambucil, cisplatin, cladribine, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, darbepoetin alpha, daunorubicin, daunomycin, dexrazoxane, docetaxel, doxorubicin, epoetin alpha, estramustine, etoposide, etoposide phosphate,
  • nofetumomab nofetumomab, oprelvekin, oxaliplatin, paclitaxel, pamidronate, pegademase, pegaspargase, pegfilgrastim, pentostatin, pipobroman, plicamycin, porfimer sodium, procarbazine, quinacrine, rasburicase rituximab, sargramostim, streptozocin, tacrolimus, tamoxifen, temozolomide, teniposide, testolactone, thioguanine, thiotepa, topotecan, toremifene, tositumomab, trastuzumab, tretinoin, uracil mustard, valrubicin, vinblastine, vincristine, vinorelbine, and zoledronate.
  • the wound active agent is an siRNA.
  • the RNAi constructs of the present invention are gene(s) that express RNAs that base pair to form a dsRNA RNA region.
  • the RNAs may be a part of the same molecule or different molecules.
  • the RNAi construct comprises a promoter operably linked to a nucleic acid sequence encoding two complementary sequences separated by a loop sequence.
  • the complementary regions correspond to a target RNA sequence separated by a loop sequence.
  • the RNAi construct is expressed, the complementary regions of the resulting RNA molecule pair with one another to form a double stranded RNA region.
  • the present invention is not limited to loop sequences of any particular length.
  • the loop sequences range from about 4 to about 20 nucleotides in length. In more preferred embodiments, the loop sequences are from about 6 to about 12 nucleotides in length. In other preferred embodiments, the dsRNA regions are from about 19 to about 23 in length.
  • the dsRNA is formed from RNA transcribed from a vector as two separate stands.
  • the two strands of DNA used to form the dsRNA may belong to the same or two different duplexes in which they each form with a DNA strand of at least partially complementary sequence.
  • the DNA sequence to be transcribed is flanked by two promoters, one controlling the
  • RNA duplex formation may be initiated either inside or outside the cell.
  • the resulting siRNA can comprise two blunt ends, one blunt end and one end with an overhang, or two ends with overhangs.
  • the end or ends with overhangs comprise an overhang of either one or two nucleotides.
  • a siRNA of 23 nucleotides in length comprises two 19mers with a two nucleotide overhang at each end.
  • a siRNA of 21 nucleotides in length comprises two 19mers with a single nucleotide overhang at each end.
  • a siRNA of 22 nucleotides in length comprises two 22mers with no overhangs at either end.
  • Inhibition is sequence-specific in that nucleotide sequences corresponding to the duplex region of the RNA are targeted for genetic inhibition. RNA molecules containing a nucleotide sequence identical to a portion of the target gene are preferred for inhibition. RNA sequences with insertions, deletions, and single point mutations relative to the target sequence have also been found to be effective for inhibition.
  • sequence identity may optimized by sequence comparison and alignment algorithms known in the art (see Gribskov and Devereux, Sequence Analysis Primer, Stockton Press, 1991, and references cited therein) and calculating the percent difference between the nucleotide sequences by, for example, the Smith- Waterman algorithm as implemented in the BESTFIT software program using default parameters (e.g., University of Wisconsin Genetic Computing Group).
  • the duplex region of the RNA may be defined functionally as a nucleotide sequence that is capable of hybridizing with a portion of the target gene transcript.
  • the dsRNA can range from about 21 base pairs (bp) of the gene to the full length of the gene or more.
  • the dsRNA used in the methods of the present invention is about 1000 bp in length.
  • the dsRNA is about 500 bp in length.
  • the dsRNA is about 22 bp in length.
  • the sequences that mediate RNAi are from about 21 to about 23 nucleotides.
  • the isolated iRNAs of the present invention mediate degradation of the target RNA.
  • the double stranded RNA of the present invention need only be sufficiently similar to natural RNA that it has the ability to mediate RNAi for the target RNA.
  • the present invention relates to RNA molecules of varying lengths that direct cleavage of specific mRNA to which their sequence corresponds. It is not necessary that there be perfect correspondence of the sequences, but the correspondence must be sufficient to enable the RNA to direct RNAi cleavage of the target mRNA.
  • the RNA molecules of the present invention comprise a 3' hydroxyl group.
  • the present invention provides compositions comprising a nanoscale polymer matrix that can be applied to a wound, a biologic tissue, a cornea, a lens, a bone, a tendon, a surgical mesh, a wound dressing, a biomedical device, a device used for healthcare, or other surface.
  • the nanoscale polymer matrix is functionalized.
  • the nanoscale polymer matrix is not functionalized.
  • the nanoscale polymer matrix comprises one or more polymers, preferably biocompatible, or is formed from one or more proteins, or is a combination of polymers and proteins.
  • the nanoscale polymer layer is formed from synthetic polymers such as synthetic polyelectrolytes.
  • the nanoscale polymer layer is formed from naturally occurring polymers such as polysaccharides.
  • the nanoscale polymer matrix is functionalized to allow for covalent interaction and/or binding to the tissue surface or the wound bed, or to allow application of - bioactive agents to the nanoscale polymer matrix.
  • a - bioactive agent for example an antimicrobial agent such as silver, polyhexamethylene biguanide (PHMB), - chlorhexidine, or iodine compound, or an antibiotic, is incorporated into the nanoscale polymer matrix.
  • the - bioactive agent is preferably impregnated, incorporated or interspersed throughout the three dimensional structure of the nanoscale polymer matrix.
  • the nanoscale polymer matrix is polyelectrolyte multilayer (PEM)
  • the - bioactive agent is preferably incorporated between or within the layers of the polymer multilayer.
  • a polymer matrix (e.g., a nanoscale polymer matrix and/or a second (e.g., a sacrificial and/or a non-sacrificial) polymer layer) comprises an antibiofilm agent.
  • the technology is not limited in the antibiofilm agent that is used in embodiments of the device and associated method, kit, and method of treatment embodiments.
  • the antibiofilm agent is a small molecule antibiofilm agent, a charged small molecule antibiofilm agent, an antibiofilm polypeptide, an antibiofilm enzyme (e.g., Dispersin B), a metallic particle, or a metal ion antibiofilm agent (e.g., a metal ion, metal ion salt, or metal ion nanoparticle).
  • the metal ion antibiofilm agent is a gallium ion, a gallium ion salt, a gallium ion nanoparticle, an alloy of gallium, or an alloy of gallium and silver.
  • the nanoscale polymer matrices are nanoscale to microscale in dimension. Accordingly, in some embodiments, the nanoscale polymer matrices are from about 1 nm to 1000 nm thick, from about 1 nm to 500 nm thick, from about 1 nm to 100 nm thick, from about 1 nm to about 25 nm thick, from about 1 nm to about 10 nm thick, or less than about 500 nm, 100 nm, 25 nm or 10 nm thick.
  • the nanoscale dimension of the matrices allows for the loading of a lower total amount of an active agent while still allowing delivery of an effective amount (i.e., an amount of active agent that accelerates wound healing as compared to controls) of the active agent as compared to matrix structures with greater thickness. It is contemplated that the lower total loading levels result in reduced toxicity in the wound environment, especially when antimicrobial compounds are incorporated into the polymer multilayer.
  • the compliance of the nanoscale polymer matrices is adjusted to facilitate cell migration in the wound.
  • the matrices have a compliance, measured in kilopascals (kPa) of from about 100 Pa to about 500 kPa, about 7 to about 250 kPa, about 10 to about 250 kPA or from about 10 to about 200 kPa.
  • the matrices, e.g., polymer multilayers have a compliance of from about 3 kPa to 5, 4, 3, 2, 1, 0.5, 0.1 and 0.05 GPa (gigapascals).
  • the nanoscale polymer matrix is formed or provided on a solid support.
  • the solid support can form an outer permeable, semi-permeable, or impermeable barrier after application of the matrix to a wound or can serve as a removed support for transfer and application of the matrix to the wound followed by removal of the support.
  • the present invention is not limited to any particular solid support.
  • solid supports including, but not limited to, solid supports formed from elastomeric materials such PDMS, nylon, Teflon ® , Gortex ® , silk, polyurethane, silicon, preferably medical grade silicon, glass, plastic, PVDF, and solids supports formed from polyvinyl alcohol (PVA), polyvinyl acetate (PVAc), polystyrene (PS), polymethyl methacrylate (PMMA), polyvinylacetate (PVAc), and polyethylene oxide.
  • PVA polyvinyl alcohol
  • PVAc polyvinyl acetate
  • PS polystyrene
  • PMMA polymethyl methacrylate
  • PVAc polyvinylacetate
  • the nanoscale polymer matrix is supported by a second polymer layer, e.g., a non-sacrificial polymer layer.
  • the nanoscale polymer matrix is supported by a second polymer layer, e.g., a non-sacrificial polymer layer, that comprises a hydrogel, a hydrocolloid, and/or collagen as a support.
  • a second polymer layer e.g., a non-sacrificial polymer layer, that comprises a hydrogel, a hydrocolloid, and/or collagen as a support.
  • the second (e.g., non-sacrificial) polymer matrix support is peeled from the device prior to application and/or after application.
  • the nanoscale polymer matrix is supported on a sacrificial polymer layer, preferably a sacrificial polymer layer, formed from a degradable or dissolvable support material such as a dissolvable polymer.
  • the nanoscale polymer matrix is first formed on a solid support and then a sacrificial polymer layer is formed on the nanoscale polymer matrix, for example, by spin coating, spraying or casting the sacrificial polymer layer material on the nanoscale polymer matrix.
  • the sacrificial polymer layer material is dissolvable in aqueous environments or environments where moisture is present, such as moist surfaces like wound beds, internal body surfaces, epithelial surfaces and the like.
  • the sacrificial polymer layer material is dissolvable in aqueous solutions after application of the nanoscale polymer matrix on the surface.
  • the sacrificial polymer layer is microscale in dimension, and may range from 0.2 ⁇ to 1000 ⁇ , 0.2 ⁇ to 500 ⁇ , 0.2 ⁇ to 200 ⁇ , 0.2 ⁇ to 100 ⁇ , 1 ⁇ to 50 ⁇ , 1 ⁇ to 20 ⁇ , 0.2 ⁇ to 10 ⁇ or 1 ⁇ to 10 ⁇ , and is preferably less than 100, 50, 20, or 10 ⁇ in thickness.
  • the present invention provides article comprising two layers, a first nanoscale polymer matrix layer adjacent to a sacrificial polymer layer.
  • microsheet This article may be referred to as a microsheet.
  • the sacrificial polymer layer dissolves when applied to a moist surface so that the nanoscale polymer matrix is left in contact with the moist surface.
  • the nanoscale polymer matrix when adhered to a surface forms a barrier to ingress of exogenous pathogens to the surface from the environment.
  • microsheet comprises at least two layers, the first layer being the sacrificial polymer layer and the second layer being the nanoscale polymer matrix so that nanoscale polymer matrix is exposed, i.e., the nanoscale polymer matrix is not sandwiched between an additional layer.
  • the exposed nanoscale polyer matrix is contacted with a desired surface when the surface is contacted with the microsheet.
  • the microsheets of the present invention consist essentially of a sacrificial polymer layer and a nanoscale polymer layer.
  • the nanoscale polymer matrix is transferred to a wound or tissue using a sacrificial polymer layer that lies on top of nanoscale polymer matrix after transfer to the wound or tissue.
  • the nanoscale polymer matrix is transferred to a wound or tissue using a sacrificial polymer layer that lies underneath the nanoscale polymer matrix after transfer to the wound or tissue.
  • a wound dressing is placed on top of the sacrificial polymer layer before or after the sacrificial polymer layer is dissolved or partially dissolved in an aqueous liquid.
  • a nanoscale polymer matrix is transferred to a wound or tissue surface, and there is no insoluble polymeric microfilm between a wound dressing placed onto the treated wound or tissue and the nanoscale polymer matrix on the wound or tissue.
  • a nanoscale polymer matrix made with PEMs and a dissolvable sacrificial cast is transferred to a wound or tissue surface such that sacrificial cast dissolves completely in wound and PEMs are in direct contact with the wound tissue and a primary/secondary wound dressing placed over the wound.
  • the primary dressing is a biologic dressing and the nanoscale polymer matrix does not hinder integration of biologic dressing in the wound-bed.
  • a nanoscale polymer matrix is transferred to the surface of a biomedical device using a dissolvable microfilm without an insoluble polymeric microfilm overlying the nanoscale polymer matrix.
  • the nanoscale polymer matrix containing one or more bioactive agents is transferred to a wound or tissue using a sacrificial polymer layer that lies on top of nanoscale polymer matrix after transfer to the wound or tissue.
  • a wound dressing is placed on top of the sacrificial polymer layer before or after the sacrificial polymer layer is dissolved or partially dissolved in an aqueous liquid.
  • a nanoscale polymer matrix containing one or more bioactive agents is transferred to a wound or tissue surface, and there is no insoluble polymeric microfilm between a wound dressing placed onto the treated wound or tissue and the nanoscale polymer matrix containing one or more bioactive agents on the wound or tissue.
  • a nanoscale polymer matrix made with PEMs containing one or more bioactive agents and a dissolvable sacrificial cast is transferred to a wound or tissue surface such that sacrificial cast dissolves completely in wound and PEMs are in direct contact with the wound tissue and a primary/secondary wound dressing placed over the wound.
  • the primary dressing is a biologic dressing and the nanoscale polymer matrix does not hinder integration of biologic dressing in the wound-bed.
  • a nanoscale polymer matrix containing one or more bioactive agents transferred to the surface of a biomedical device using a dissolvable microfilm without an insoluble polymeric microfilm overlying the nanoscale polymer matrix containing one or more bioactive agents.
  • the nanoscale polymer matrix is a polyelectrolyte multilayer (PEM).
  • PEM polyelectrolyte multilayer
  • the nanoscale polymer matrix is used to modify a medical device such as a wound dressing.
  • a medical device such as a wound dressing.
  • wound dressings that can be modified by addition of a matrix as described below include, but are not limited to, BiobraneTM, IntegraTM Matrix Wound Dressing, gauze, adhesive tape, bandages such as Band-Aids ® , and other commercially available wound dressings including but not limited to COMPEEL ® , DUODERMTM, TAGADERMTM and OP SITE ® .
  • COMPEEL ® DUODERMTM
  • TAGADERMTM TAGADERMTM
  • OP SITE ® commercially available wound dressings
  • a microsheet with the nanoscale polymer matrix is first applied to a surface, such as wound or other moist body surface, and then the wound dressing is applied.
  • the nanoscale polymer matrix is used to modify a medical device such as a surgical mesh.
  • a medical device such as a surgical mesh.
  • surgical meshes that can be modified by addition of a matrix as described below include, but are not limited to, polypropyelene, polyester, polytetrafluoroethylene meshes, or absorbable biomeshes, or biological meshes (biomeshes), including but not limited to ULTRAPROTM mesh,
  • PROCEEDTM mesh PROCEEDTM mesh
  • PROLENETM polypropyelene mesh PROLENETM polypropyelene mesh
  • Ethicon PhysiomeshTM Ethicon Physiomesh
  • MERSILENETM polyester mesh PARIETEXTM mesh, DOLPHINTM polypropylene mesh, GORE INFI IT mesh, PERFIX , KUGEL , 3DMAX , BARD , VISILEX , XENMATRIXTM, ALLOMAXTM, SURGISIS BIODESIGNTM, and TIGR MATRIXTM.
  • sacrificial polymer layer of a microsheet contains bioactive agents, antimicrobial agents, antibiofilm agents, microparticles, nanoparticles, magnetic particles.
  • microparticles or nanoparticles in the sacrificial polymer layer contain bioactive agents or antimicrobial agents.
  • a polymer matrix (e.g., a second (e.g., sacrificial and/or nonsacrificial) polymer matrix) comprises an antibiofilm agent.
  • the technology is not limited in the antibiofilm agent that is used in embodiments of the device and associated method, kit, and method of treatment embodiments.
  • the antibiofilm agent is a small molecule antibiofilm agent, a charged small molecule antibiofilm agent, an antibiofilm polypeptide, an antibiofilm enzyme (e.g., Dispersin B), a metallic particle, or a metal ion antibiofilm agent (e.g., a metal ion, metal ion salt, or metal ion nanoparticle).
  • the metal ion antibiofilm agent is a gallium ion, a gallium ion salt, a gallium ion nanoparticle, an alloy of gallium, or an alloy of gallium and silver.
  • sacrificial polymer layer of a microsheet is water soluble.
  • the sacrificial polymer layer is made of non-toxic polymer, and in some embodiments the sacrificial polymer layer is poly vinyl alcohol (PVA).
  • the sacrificial polymer layer is made of polyacrylic acid (PAA), polystyrene (PS), PMMA polymethyl methacrylate (PMMA), or, polyvinylacetate (PVAc).
  • the matrix is a polymer multilayer.
  • the multilayer structures comprise layers of polyelectrolytes (i.e., forming a polyelectrolyte multilayer), while in other embodiments, the multilayers comprise polymers that do not have a charge (i.e., non-ionic polymers) or a combination of charged and uncharged polymer layers.
  • polyelectrolyte films built-up by the alternated adsorption of cationic and anionic polyelectrolyte layers constitute a novel and promising technique to modify wound surfaces in a controlled way (Decher et al, 1992, Thin Solid Films 210/21 1 :831 ; Decher, 1997, Science 277: 1232).
  • One of the most important properties of such multilayers is that they exhibit an excess of alternatively positive and negative charges (Caruso et al, 1999, J Am Chem Soc 121 :6039; Ladam et al, 2000, Langmuir 16: 1249). Not only can this constitute the motor of their buildup (Joanny, 1999, Eur. Phys.
  • Polyelectrolyte layers are formed by alternating applications of anionic
  • polyelectrolytes and cationic polyelectrolytes to surfaces to form a polyelectrolyte multilayer.
  • one or more wound active agents such as those described above, are incorporated into the multilayer.
  • at least four layers, and, more preferably, at least six layers are used to form the polyelectrolyte multilayer.
  • Cationic polyelectrolytes useful in the present invention can be any biocompatible water-soluble polycationic polymer, for example, any polymer having protonated
  • water soluble means that the entire polymer must be soluble in aqueous solutions, such as buffered saline or buffered saline with small amounts of added organic solvents as co-solvents, at a temperature between 20 and 37° Centigrade.
  • the material will not be sufficiently soluble (defined herein as soluble to the extent of at least one gram per liter) in aqueous solutions per se but can be brought into solution by grafting the polycationic polymer with water-soluble polynonionic materials such as polyethylene glycol.
  • Representative cationic polyelectrolytes include natural and unnatural polyamino acids having net positive charge at neutral pH, positively charged polysaccharides, and positively charged synthetic polymers.
  • suitable polycationic materials include polyamines having amine groups on either the polymer backbone or the polymer side chains, such as poly-L- lysine (PLL) and other positively charged polyamino acids of natural or synthetic amino acids or mixtures of amino acids, including, but not limited to, poly(D- lysine), poly(ornithine), poly(arginine), and poly(histidine), and nonpeptide polyamines such as poly(aminostyrene), poly(aminoacrylate), poly ( -methyl aminoacrylate), poly (N- ethylaminoacrylate), poly(N,N-dimethyl aminoacrylate), poly( ,N-diethylaminoacrylate), poly(aminomethacrylate), poly(N-methyl amino-methacrylate), poly( -ethyl
  • aminomethacrylate poly( ,N-dimethyl aminomethacrylate), poly(N,N-diethyl
  • polymers must include at least five charges, and the molecular weight of the polycationic material must be sufficient to yield the desired degree of binding to a tissue or other surface, having a molecular weight of at least 1000 g/mole.
  • Polyanionic materials useful in the present invention can be any biocompatible water- soluble polyanionic polymer, for example, any polymer having carboxylic acid groups attached as pendant groups. Suitable materials include alginate, carrageenan, furcellaran, pectin, xanthan, hyaluronic acid, heparin, heparan sulfate, chondroitin sulfate, polyacrylic acid (PAA), dermatan sulfate, dextran sulfate, poly(meth)acrylic acid, oxidized cellulose, carboxymethyl cellulose and crosmarmelose, synthetic polymers and copolymers containing pendant carboxyl groups, such as those containing maleic acid or fumaric acid in the backbone.
  • PAA polyacrylic acid
  • PAA polyacrylic acid
  • dermatan sulfate dextran sulfate
  • poly(meth)acrylic acid oxidized cellulose, carboxymethyl cellulose and crosmarmelose
  • Polyaminoacids of predominantly negative charge are also suitable.
  • these materials include polyaspartic acid, polyglutamic acid, and copolymers thereof with other natural and unnatural amino acids.
  • Polyphenolic materials such as tannins and lignins can be used if they are sufficiently biocompatible.
  • Preferred materials include alginate, pectin, carboxymethyl cellulose, heparin and hyaluronic acid.
  • the cationic polyelectrolyte used is PLL and the anionic polyelectrolyte used is poly(L-glutamic acid) (PGA).
  • PGA poly(L-glutamic acid)
  • PES poly(ethylene imine)
  • PAH poly(allylamine hydrochloride)
  • PSS poly(sodium 4-styrenesulfonate)
  • PAC poly(acrylic acid)
  • PMA-P poly(maleic acid-co-propylene)
  • PVS poly(vinyl sulfate)
  • the polymer is a dendrimer, grafted polymer, or star architecture polymer.
  • the multilayer structures are formed from uncharged polymers or from a combination of charged and uncharged polymers.
  • uncharged polymers include, but are not limited to, dextran, dextran sulfate, diethylaminoethyl (DEAE)-dextran, hydroxyethyl cellulose, ethyl(hydroxyethyl) cellulose, acrylamide, polyethylene oxide, polypropylene oxide, polyethylene oxide - polypropylene oxide copolymers, PAAN a , Ficoll, polyvinylpyrolidine, and polyacrylic acid.
  • DEAE diethylaminoethyl
  • the multilayer structures are formed from one or more amphoteric polymers, alone in combination with the other polymers described herein.
  • the amphoteric polymers comprise one or more of acrylic acid (AA), DMAEMA (dimethylaminoethyl methacrylate), APA (2-aminopropyl acrylate), MorphEMA (morpholinoethyl methacrylate), DEAEMA (diethylaminoethyl methacrylate), t-ButylAEMA (t-butylaminoethyl methacrylate), PipEMA (piperidinoethyl methacrylate), AEMA
  • the amphoteric polymer comprises (a) carboxylic acid, (b) primary amine, and (c) secondary and/or tertiary amine.
  • the amphoteric polymers have an isoelectric point of 4 to 8, preferably 5 to 7 and have a number average molecular weight in the range of 10,000 to 150,000.
  • Polymer layers may be formed by a variety of methods.
  • the polymer layers are formed on solid supports as described in detail below.
  • the polymer or polymer multilayer is formed by sequential application of polymers using either a pump (including syringes, ink jet printers, and electrojets) or spray, such as an aerosol spray, or by dip coating.
  • particle bombardment is utilized.
  • the use of a brush including an air brush is contemplated.
  • a sponge is utilized.
  • a solid support or stamp such as an elastomeric material, for example, PDMS
  • polydimethylsiloxane silicone, hydrogel or latex
  • silicone silicone, hydrogel or latex
  • the nanoscale polymer matrix is formed on a solid support, a sacrificial polymer layer is formed on the nanoscale polymer matrix, and the resulting microsheet is peeled from the solid support.
  • the matrix comprises one or more proteins.
  • the proteins form a hydrogel.
  • the matrix comprises one or more extracellular matrix proteins.
  • the matrix comprises at least one of collagen, laminin, vitronectin, fibronectin, keratin, and
  • the protein matrix may preferably be formed by a variety of methods.
  • the protein matrix is formed on solid supports as described in detail below.
  • the protein matrix is formed by application of proteins or solutions or gels of proteins using either a pump (including syringes, ink jet printers, and electrojets) or spray, such as an aerosol spray.
  • a pump including syringes, ink jet printers, and electrojets
  • spray such as an aerosol spray.
  • a brush including an air brush is contemplated.
  • a sponge is utilized.
  • a solid support or stamp such as an elastomeric material, for example, PDMS (polydimethylsiloxane), silicone, hydrogel or latex, is used to support the protein matrix and mechanically transfer the protein matrix into or onto the wound bed.
  • the matrix is further modified to include cells, including, but not limited to, stem cells, keratinocytes, 3-D skin constructs, corneal epithelial cells, conjunctival cells, corneal limbal stem cell, human embryonic stem cells, pluripotential stem cells, adult induced stem cells, hematopoietic stem cells, hepatocytes, pancreatic cells and the like.
  • compositions and methods described herein are used to functionalize harvested and processed (frozen, freeze dried, fixed and stored dry or wet, fresh tissue for direct transplant) animal and human tissue (pig/human aortic valve, harvested human amniotic membrane, human cadaver skin, harvested sclera and cornea, harvested cadaver bone, harvested blood vessels and the like.
  • animal and human tissue pig/human aortic valve, harvested human amniotic membrane, human cadaver skin, harvested sclera and cornea, harvested cadaver bone, harvested blood vessels and the like.
  • the compositions and methods described herein are used to functionalize skin constructs, including, but not limited to, autograft skin (i.e., skin is harvested from a patient, functionalized as described herein, and returned to the patient), organotypically cultured human skin equivalents, and other keratinocyte products such as DermagraftTM.
  • the present invention provides polymer multilayers that comprise nano- or microscale particles.
  • the particles are dispersed in the polymer multilayer, for example, in between the polymer layers.
  • the particles are displayed on a surface, such as a top or a bottom surface, of the polymer multilayer.
  • the particles are associated with said polymer multilayer in a manner selected from the group consisting of interspersed or dispersed in said polymer multilayer; displayed on a surface of said polymer multilayer; and underneath the polymer multilayer.
  • the polymer multilayers are formed as described above.
  • the particles have diameter or other linear measurement of a feature, such as a length or width, which is greater than the thickness of polymer multilayer.
  • the diameter or other linear measurement is from about 1, 1.5, 2, 3, or 4 times greater than the thickness of the polymer multilayer up to about 5, 10 or 20 times greater than thickness of the polymer multilayer.
  • nanometer to micrometer sized biocompatible particles such as spherical (e.g., beads) and/or non-spherical (e.g., oblongs, needles, cubes, tetrahedral, mushroom-like structures, haybale-like structures) particles or electrospun polymers, are utilized in or on the polymer multilayer.
  • spherical e.g., beads
  • non-spherical particles e.g., oblongs, needles, cubes, tetrahedral, mushroom-like structures, haybale-like structures
  • electrospun polymers are utilized in or on the polymer multilayer.
  • Microbeads have a size generally ranging from about 1 to about 500 micrometers, while nanobeads have a size generally ranging from about 1 to about 1000 nanometers.
  • Microbeads may further comprise micro- (e.g., from 1 to 100 micrometers) or nano-scale (e.g., 0.1 to 1000 nanometer) features on the surface of the bead. Nanobeads may further comprise nanoscale features (e.g., 0.1 to 500 nanometer features) on the surface of the bead.
  • a wound active agent is present in the form of a bead or particle, such as silver nanoparticles.
  • the biocompatible particles are biodegradable.
  • the biocompatible particles for example, are modified with surface chemistry cross-linkers that allow attachment and immobilization of wound active agents, extracellular matrix compounds, etc. as described elsewhere herein.
  • the size of the biocompatible particles, such as beads are at least lnm, at least 5nm, at least lOnm, at least 20nm, at least 50nm, at least lOOnm, at least 200nm, at least 300nm, at least 500nm, or at least 800nm in diameter.
  • beads and other spherical and non-spherical particles contain their own surface topography.
  • the bead surface may comprise undulations, indentations, tunnels, holes, knobs, ridges, etc.
  • Spherical particles, such as beads may or may not be inert and may, for example, be magnetic.
  • Magnetic beads comprise, for example, a magnetic core or magnetic particles.
  • the particles comprise or are impregnated with a wound active agent.
  • polymer multilayers such as those described above offer the opportunity to chemically and topographically engineer the surface of substrates.
  • nanostructures or organic films like polymer- multilayers
  • active agents active agents. Since these procedures are laborious (it can take 6 hrs to fabricate a multilayer films containing 20 layers, which is prohibitively long for say treatment of a wound), can involve harsh chemicals, solutions having non-physiological pHs, and possible mechanical shear forces, they may damage or compromise the substrates on which they are formed (particularly biological tissues and sensitive biomedical devices).
  • the polymer multilayers of the present invention are pre-fabricated on elastomeric stamps (such as PDMS stamps) and then mechanically transferred to a substrate of interest by stamping onto the substrates of interest.
  • elastomeric stamps such as PDMS stamps
  • the concept of contact printing pre-fabricated nano and microstructures on hard substrates has been employed for microfabrication of electromechanical systems; those methods fail when used on soft substrates, particularly substrates with mechanical properties typically of a range of biological tissues.
  • the present invention provides methods and compositions of matter that make possible the transfer of organic and inorganic thin films, including polymer multilayers, onto compliant substrates, including soft-substrates with mechanical properties equivalent to those of biological tissues (elastic modulus, E', of about 1-500 kPa, preferably about 10-100 kPa).
  • E' elastic modulus
  • Example 14 and Figure 12 facilitates transfer of polymer-multilayers onto soft-surfaces, including biological tissues, including skin-grafts and mouse pelts.
  • This method allows engineering the surface of soft-substrates (E' ⁇ 100 kPa) by contact printing pre-fabricated functionalized polymer-multilayers onto their surface.
  • This opens up a vast area of opportunities to chemically and topographically modify surfaces of biological tissues and soft implantable biomedical devices, like biomedical grade silicone, and generate surfaces with tailored functionality, chemistry and topography at nanometer scale.
  • This is a versatile solution to engineer or pattern, for example, a wound-bed, from two perspectives.
  • First, from a product development view-point, fabrication and functionalization of polymer multilayers used in this approach can be easily automated in a manufacturing environment using robots.
  • the present invention provides methods to tailor the surface chemistry and nanostructured topography of soft-substrates by mechanical transfer of pre-fabricated, nanometer-thick organic films, impregnated with active agents, onto the substrates.
  • This technology provides unprecedented advantages over several competing existing technologies.
  • technology described in past literature for stamping pre-fabricated polymer-multilayer films onto substrates relevant for the microfabrication of electromechanical systems does not allow their transfer onto soft-substrates with mechanical strength relevant to biological tissues.
  • the present invention opens up the possibilities of engineering surfaces of a whole new vast arena of soft substrates by contact-printing pre- fabricated functionalized polymer- films.
  • Some of such soft-substrates relevant for immediate commercialization of this technology include biological tissues, wound-beds, and implantable biomedical devices like biomedical grade silicone. Furthermore, the study performed during this invention leads to the new observation that mechanical properties of the substrates influence the mechanical transfer of organic films onto them- these new principles of mechanical transfer can be used to selective transfer organic films on substrates with, for example, patterned soft and hard regions.
  • wound-management approaches involve delivering active agents to the wounds in ointments or dressings.
  • the wound-dressings are reservoirs of active agents and require high loading concentrations for the active agents to diffuse through the wound- fluid and reach the wound-bed where activity is required.
  • High concentrations of active agents are cytotoxic, causing tissue toxicity and impaired wound-healing.
  • the present invention allows immobilizing active agents onto the surface of the wound-beds by stamping pre-fabricated nanostructured polymer-multilayers impregnated with active agents.
  • Such immobilization of active agents in polymer-multilayers over wound- bed permits: 1) Precise delivery and minimal loading of active molecules onto the wound- bed, thereby providing efficacious wound treatment without cytotoxic effects and at reduced costs. 2) Prolong bioavailability of the active agents in the wound-bed, circumventing frequent dressings and thus reducing patient pain and overall costs of wound-management. This is particularly significant in the treatment of chronic wounds that take several months to heal. 3) Controlled delivery of bioactive molecules, both spatially and temporally. This allows regulating the distribution of active molecules across the wound-bed and creating their gradients.
  • the present invention provides a polymer multilayer comprising at least one polymer, the polymer multilayer having associated therewith particles selected from the group consisting of nanoscale and microscale particles.
  • the polymer multilayer is from 1 nm to 1000 nm thick and in preferred embodiments, from about 1 to about 250 nm thick.
  • the polymer multilayer has a compliance of from 3 to 500 kPa.
  • the polymer multilayer is disposed on a support.
  • the polymer multilayer is formed on a support.
  • the support is an elastomeric support.
  • the present invention provides methods for modifying a surface comprising contacting a surface with a polymer multilayer as described above under conditions such that said polymer multilayer is transferred to said surface.
  • the surface is a soft surface.
  • the surface has an elastic modulus of from about 1 to about 500 kPa, preferably about 10 to about 100 kPa.
  • the surface is a biological surface.
  • the biological surface comprises proteins, lipids and/or carbohydrates.
  • the biological surface is selected from the group consisting of skin, a wound bed, hair, a tissue surface, and an organ surface.
  • the surface is a biologically compatible surface, or the surface of a biomedical device.
  • the surface is a silicone surface.
  • the present invention provides microsheets comprising at least two layers, the first layer being a nanoscale polymer matrix and the second layer being a sacrificial polymer layer.
  • Exemplary microsheets and methods for making the microsheets are provided in Figures 13, 16 and 17.
  • a nanoscale polymer matrix may be preferably formed on a solid support such as PDMS.
  • the nanoscale polymer matrix may comprise any of the polymers described in detail above. Additional support materials are described in more detail below.
  • a wound active agent is incorporated into the nanoscale polymer matrix during formation of the matrix. It can also be impregnated into the matrix following formation of the matrix to provide a bioactive nanoscale polymer matrix.
  • the wound active agent is preferably incorporated or interspersed within the three dimensional structure of the matrix.
  • Figure 16 provides a depiction of a preferred embodiment of the invention wherein silver ions and nanoparticles are interspersed within the three dimensional structure of a PAH/PAA nanoscale polyelectrolyte multilayer (PEM) matrix.
  • the nanoscale polymer matrix is impregnated with silver nitrate solution to impregnate silver ions; the matrix is then incubated in a solution of a reducing agent to form silver nanoparticles within the matrix.
  • Figure 17 provides a depiction of another preferred embodiment of the invention wherein chlorhexidine, a positively charged antimicrobial agent, is interspersed between negatively charged polyelectrolyte (PAA) layers in a PAH/PAA nanoscale polyelectrolyte multilayer (PEM) matrix.
  • PAM polyelectrolyte
  • a sacrificial polymer layer is then cast on the nanoscale polymer matrix.
  • the sacrificial polymer layer preferably comprises a degradable or dissolvable material as described above.
  • the sacrificial polymer layer comprises polyvinyl alcohol (PVA).
  • the sacrificial polymer layer is made of polyacrylic acid (PAA), polystyrene (PS), polymethyl methacrylate (PMMA), or polyvinylacetate (PVAc).
  • PAA polyacrylic acid
  • PS polystyrene
  • PMMA polymethyl methacrylate
  • PVAc polyvinylacetate
  • the sacrificial polymer layer is preferably cast by dip coating, spin coating or spraying.
  • the microsheet is from about 0.2 cm 2 to about 600 cm 2 .
  • the sacrificial polymer layer has a thickness variation across the entire microsheet of less than 500, 400, 300, 200, 100, 50, 20 or 10% of the average thickness when measured in cross section.
  • the microsheet may be peeled from the solid support to provide a free standing microsheet which can be applied to a surface such as a device or wound tissue as depicted in Figures 13 and 14, respectively.
  • the microsheets of the present invention have excellent mechanical strength even though they are microscopically thin and can be handled by hand or by machines.
  • the microsheets have a Young modulus of from about 0.1 GPa to about 10 GPa.
  • the exposed nanoscale polymer matrix is brought into direct contact with the surface of the device or a wound surface. In the presence of moisture, the sacrificial polymer layer dissolves leaving the nanoscale polymer matrix displayed on or adhered to the surface.
  • the matrices described above are functionalized.
  • the matrices are functionalized with one or more covalent modification agents.
  • the crosslinkers comprise either an azide group or an alkyne group so that suitable click chemistries can be utilized.
  • the at least one covalent modification agent is a homobifunctional cross-linker. In other embodiments, the at least one covalent modification agent is a heterobifunctional cross-linker.
  • the homobifunctional cross-linker is an N-hydroxysuccinimidyl ester (e.g., including, but not limited to, disuccinimidyl ester, dithiobis(succinimidylpropionate), 3,3'-dithiobis(sulfosuccinimidylpropionate), disuccinimidyl suberate,
  • N-hydroxysuccinimidyl ester e.g., including, but not limited to, disuccinimidyl ester, dithiobis(succinimidylpropionate), 3,3'-dithiobis(sulfosuccinimidylpropionate), disuccinimidyl suberate,
  • the homobifunctional cross-linker is at a concentration between 1 nanomolar and 10 millimolar. In some preferred embodiments, the homobifunctional cross-linker is at a concentration between 10 micromolar and 1 millimolar.
  • the at least one covalent modification agent is a heterobifunctional cross-linker (e.g., including, but not limited to, N-succinimidyl 3-(2-pyridyldithio)propionate, succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate, sulfosuccinimidyl 6-(3'-[2- pyridyldithio]-propionamido)hexanoate, succinimidyloxycarbonyl-a-methyl-a-(2- pyridyldithio)toluene, sulfosuccinimidyl-6-[a-methyl-a-(2-pyridyldithio)
  • a heterobifunctional cross-linker e.g., including, but not limited to, N-succinimidyl 3-(2-pyridyldithio)propionate,
  • the heterobifunctional cross-linker is modified with functional groups, rendering it soluble in aqueous solvents for delivery as an aqueous solution.
  • the aqueous solution contains additives (e.g., including, but not limited to, surfactants and block copolymers).
  • additives e.g., including, but not limited to, surfactants and block copolymers.
  • a multiplicity of hetero-bifunctional cross-linkers can be attached to a molecule, polymer or particle to serve as the cross-linking agent.
  • the heterobifunctional cross-linker is dissolved in an organic solvent (e.g., including, but not limited to, dimethyl sulfoxide).
  • the covalent modifier is a photoactivatable crosslinker.
  • Suitable photoactivatable crosslinkers include, but are not limited to, aryl azide N-((2- pyridyldithio)ethyl)-4-azidosalicylamide, 4-azido-2,3,5,6-tetrafluorobenzoic acid, succinimidyl ester, 4-azido-2,3,5,6-tetrafluorobenzoic acid, STP ester, benzophenone maleimide, succinimidyl ester of 4-benzoylbenzoic acid, N-5-azido-2- Nitrobenzoyloxysuccinimide, N-Hydroxysulfosuccinimidyl-4-azidobenzoate, N- hydroxysuccinimidyl-4-azidosalicylic acid, and (4-[p-azidosalicylamido]butylamine).
  • the covalent modification agent may be applied to the matrix by any suitable method.
  • the covalent modification agent is applied using either a pump (including syringes, ink jet printers, and electrojets) or spray, such as an aerosol spray.
  • a pump including syringes, ink jet printers, and electrojets
  • spray such as an aerosol spray.
  • the use of a brush including an air brush is
  • a sponge is utilized.
  • the functionalized matrix displays one or more reactive moieties, for example, azide moieties, succinimidyl moieties, alkyne moieties or any of the other reactive groups of the compounds described above.
  • the matrix is modified by PEGylation with polyethylene glycol. It is contemplated that PEGylation can be used to control interaction of the matrix with the wound bed and to prevent nonspecific adsorption as desired. PEGylation can also be used to control delivery of the wound active agent from the matrix.
  • the matrices comprise one or more wound active agents as described in detail above.
  • the wound active agent or agents are noncovalently incorporated into the matrix.
  • silver containing antimicrobials are incorporated into the functionalized matrix, for example, a polyelectrolyte multilayer as described above.
  • the wound active agent or agents are covalently immobilized on the matrix, for example, via a covalent modification agent.
  • the one or more wound active agents are applied to form a gradient with respect to the wound modifying agent.
  • the gradients present a higher contraction of wound active agent at one or more first desired locations in the wound following application of the wound modifying agent to the wound and a lower concentration of wound active agent at one or second location in the wound following application of the matrix to the wound.
  • the concentrations of the wound active agents are layered in a wound bed in a gradient such that higher concentrations of a particular composition is greater proximal to the wound bed than distal to the wound bed in a vertical fashion. The converse, where concentrations of compositions is greater distal to the wound bed than proximal, is also contemplated.
  • compositions in a wound bed wherein a horizontal gradient is deposited Concentration of compositions in a wound bed wherein a horizontal gradient is deposited is also contemplated. Topographical gradients are also contemplated, wherein compositions are deposited such that the concentrations of compositions in a wound bed or on a biocompatible particle follow the topography of the substrate, for example, a higher concentration of compositions is deposited in the valleys of undulations of an exemplary substrate compared to the peaks of the undulations.
  • the gradient comprises a higher concentration of the wound active agent in the center of the matrix which transitions to a lower concentration of the wound active agent away from the center of the matrix. Accordingly, when the matrix is applied to a wound, the gradient results in a higher concentration of wound active agent in the center of the wound and a lower concentration of wound active agent as one moves to the periphery of the wound. In some embodiments, the gradient comprises a lower concentration of the wound active agent in the center of the matrix which transitions to a higher concentration of the wound active agent away from the center of the matrix. Accordingly, the gradient results in a lower concentration of wound active agent in the center of the wound and a higher concentration of wound active agent as one moves to the periphery of the wound.
  • the gradients of high or low concentration can be any shape, such as circular, square, rectangular, oval, oblong, etc. so that the matrix and gradient can conform to a variety of wound shapes.
  • the gradient may be centered on a longitudinal axis that extends along the length of the wound and can be centered on the wound.
  • the gradient can be circular or oval-shaped for application to open type wounds, burns, sores and ulcers that are roughly circular or oval.
  • the gradients comprise a series of features arranged in a pattern.
  • the gradients can form a series of stripes or high and low concentrations of one or more wound active agents along a longitudinal axis of the matrix.
  • the gradients can form a checkerboard pattern, array, concentric circles, overlapping circles or oval, etc.
  • the matrices are formed on a support material.
  • Suitable support materials include, but not limited to, solid supports formed from polymeric materials, elastomeric materials such PDMS, nylon, Teflon ® , Gortex ® , silk, polyurethane, and silicon, preferably medical grade silicon, PVDF, polyethylene oxide, and water soluble materials and polymers such as polyvinyl alcohol.
  • the polymer(s) used to form the polymer multilayer are different than the polymer(s) forming the support.
  • an additional layer of material such as a water soluble material or polymer, is disposed between the polymer multilayer and the support.
  • the solid support is a wound dressing or biologic wound dressing that is compatible with
  • wound dressings that can be modified by addition of a matrix as described below include, but are not limited to, BiobraneTM, gauze, adhesive tape, bandages such as Band-Aids ® , and other commercially available wound dressings including but not limited to COMPEEL ® ,
  • the support is a silicon wafer, surfaces, such as glass or silicon wafers, that are coated with hydrophobic self assembled monolayer, fabrics, such as nylon fabrics, absorbent material, foam, a transparent thin film, a hydrogel, hydrofibers, hydrocolloids, alginate fibers, silica gel, sodium polyacrylate, potassium polyacrylamides and combinations thereof.
  • the supports comprise (e.g., is coated with or displays) a biological molecule selected from the group consisting of collagen, hyaluronic acid, glycosaminoglycans, keratin, fibronectin, vitronectin, laminin, and combinations or fragments thereof.
  • the matrices described above can be synthesized directly on the support material or transferred to the support material following synthesis, for example by transfer or stamping from a suitable support, such as an elastomeric support.
  • a suitable support such as an elastomeric support.
  • the polymer multilayers are deposited onto a support by adsorption from solution, spraying, or spin coating.
  • the matrices are preferably polymer multilayers, for example, polyelectrolyte multilayers.
  • the matrices preferably comprise one more wound active agents as described above and/or or nanoscale or microscale beads as described above.
  • the wound active agent is one or more of silver nanoparticles, elemental silver, and silver containing compounds such as silver sulfadiazine and related compounds, preferably included in the concentration ranges described above.
  • the present invention provides methods for transferring a polymer multilayer to a desired surface, such as soft surface.
  • soft surfaces include, but are not limited to, skin, a wound bed, a tissue, artificial tissues including artificial skin tissues such as organotypically cultured skin tissues, Apligraf ® , Dermagraft ® , Oasis ® , Transcyte ® , Cryoskin ® and Myskin ® , artificial tissue matrices, gels comprising biomolecules, a wound dressing, and a biologic wound dressing.
  • the desired surface is contacted with a polymer multilayer, e.g., a polymer multilayer supported on a support and pressure is applied to effect transfer of the polymer multilayer from the support to the desired surface.
  • the pressure is from about 10 to about 500 kPa.
  • the transfer is performed in the substantial, or complete, absence of solution. Such dry transfer processes do not involve exposure of biological components of the desired surface to aqueous solutions containing species that may influence the activity of the biological components.
  • the transfer is performed through a gas phase.
  • the transfer is performed in an environment where the humidity is less than 100% of saturation.
  • the transfer is performed in the absence of liquid water.
  • the present invention provides wound dressings comprising a support material having a surface oriented to a wound, wherein the surface oriented to the wound is modified with a matrix material of the present invention.
  • the surface of the support material modified with the matrix material is put into contact with the wound bed.
  • the support is a biologic wound dressing. In some embodiments, the support is a biologic wound dressing.
  • the biologic wound dressing is a type of wound dressing that comprises, e.g., is coated with or incorporates, cells (e.g., keratinocytes or fibroblasts and combinations thereof) and/or one or more biomolecules or fragments of biomolecules that can be placed in contact with the wound surface.
  • the biomolecules may be provided in the form of an artificial tissue matrix omprising one or more biomolecules. Examples of such biomolecules include, but are not limited, to collagen, glycosaminoglycans, hyaluronic acid, laminin, vitronectin, fibronectin, keratin, antimicrobial polypeptides and combinations thereof.
  • suitable biologic wound dressings include, but are not limited to, BIOBRANETM, IntegraTM, Apligraf ® , Dermagraft ® , Oasis ® , Transcyte ® , Cryoskin ® and Myskin ® .
  • the support material is a biosynthetic wound dressing constructed of an elastomeric film (e.g., a silicone film) supported on support material, such as a fabric, preferably a polymeric fabric such as a nylon fabric.
  • the fabric is at least partially imbedded into the film (e.g., BioBraneTM).
  • the elastomeric film is coated with one or more biomaterials, for example collagen, keratin, fibronectin, vitronectin, laminin and combinations thereof. Accordingly, the fabric presents to the wound bed a complex 3-D structure to which a biomaterial (e.g., collagen) has been bound, preferably chemically bound.
  • the surface presented to the wound is further modified with a matrix material as described above.
  • the matrix material is a polyelectrolyte membrane comprising a wound active agent, preferably selected from one or more of silver nanoparticles, elemental silver, and silver containing compounds such as silver sulfadiazine and related compounds, and preferably included in the concentration ranges described above.
  • the matrix further comprises nanoscale or microscale particles. The matrix can be synthesized directly on the collagen modified surface or transferred to the collagen modified surface by stamping as described above.
  • the support material is an adhesive bandage comprising an adhesive portion (such as an adhesive strip) and an absorbent material, preferably treated or coated with a material (i.e., a non-adherent material) to prevent adhesion to the wound or comprising a layer of non-adherent material, such as Teflon ® , on the surface of the absorbent pad that will contact the wound.
  • a material i.e., a non-adherent material
  • the support material is an absorbent pad (e.g., a gauze pad or polymer foam) preferably treated or coated with a material (i.e., a non-adherent material) to prevent adhesion to the wound or comprising a layer of nonadherent material, such as Teflon ® or other suitable material, on the surface of the absorbent pad that will contact the wound.
  • a material i.e., a non-adherent material
  • the non-adherent material or layer is breathable.
  • the wound dressing comprises a gel-forming agent, for example, a hydrocolloid such as sodium carboxymethylcellulose.
  • the absorbent pads or gel-forming agents are affixed to a material that is waterproof and/or breathable.
  • the waterproof and/or breathable material may further comprise an adhesive material for securing the bandage to the skin of a subject.
  • the waterproof and/or breathable material preferably forms the outer surface of the adhesive bandage or pad, i.e., is the surface opposite of the surface comprising the matrix which contacts the wound.
  • adhesive bandages and absorbent pads include, but are not limited to, to adhesive bandages and pads from the Band-Aid ® line of wound dressings, adhesive bandages and pads from the Nexcare ® line of wound dressings, adhesive bandages and non-adhesive pads from the Kendall Curity Tefla ® line of wound dressings, adhesive bandages and pads from the Tegaderm ® line of wound dressings, adhesive bandages and pads from the Steri-Strip ® line of wound dressings, the COMFEEL ® line of wound dressings, adhesive bandages and pads, the Duoderm ® line of wound dressings, adhesive bandages and pads, the TEGADERMTM line of wound dressings, adhesive bandages and pads, the OPSITE ® line of wound dressings, adhesive bandages and pads, adhesive bandages and pads from the AllevynTM line of wound dressings, adhesive bandages and pads from the Duoderm ® line of wound dressings, and adhesive bandages and pads from the Xeroform ® line of wound dressings.
  • the present invention provides methods and systems for producing the articles described above.
  • the polyelectrolyte multilayers are directly deposited on the solid support by any of the methods described in detail above.
  • the polyelectrolyte multilayers are deposited onto a stamp material, such as PDMS, and then transferred to the solid support by a stamping process as described in detail above.
  • the technology relates to a wound dressing comprising a silicone film.
  • Thin silicone film semi-occlusive wound dressings are commonly used on burn and trauma wounds to promote moist wound healing (Thomas S. Vapour-permeable film dressings. Journal of Wound Care. 1996;5:271-4), prevent eschar formation, and facilitate epidermal regeneration at an enhanced rate compared with traditional gauze dressings (Madden et al. Comparison of an occlusive and a semi-occlusive dressing and the effect of the wound exudate upon keratinocyte proliferation. The Journal of Trauma. 1989; 29:924- 31).
  • Examples of conventional wound dressings with a silicone film include Biobrane® (Smith & Nephew, Hull, UK), Integra wound matrix® (Integra Lifesciences, Plainsboro, NJ), and silicone gel films such as Stratamed® (Stratpharma, Switzerland), and Mepitel®
  • Silicone thin films are permeable to water vapor and oxygen (Queen D et al. Evaluation of gaseous transmission ((3 ⁇ 4 and CO 2 ) through burn wound dressings. Burns. 1987; 13 :357-64), but impermeable to water and microbes. They maintain the moisture balance in the wounds and can provide pain relief by preventing dehydration of the wound surface and bathing the exposed nerve endings in physiological wound secretions (Thomas S et al. A study to compare two film dressings used as secondary dressings. Journal of Wound Care. 1997;6:333-6).
  • silicone films Compared to polyurethane thin film dressings with moderate oxygen permeability, e.g., Tegaderm® (3M, St. Paul, MN) and Opsite® (Smith & Nephew), silicone films have high gas permeability. Oxygen transmission rate documented through 66- ⁇ thick
  • Tegaderm® was 2.74 cc/m 2 /day and that through a 250- ⁇ thick medical grade silicone film was >20 cc/m 2 /day (Sirvio L et al. The Effect of Gas Permeability of Film Dressings on Wound Environment and Healing. Journal of Investigative Dermatology. 1989;93:528-31).
  • Tegaderm® has been documented to allow sufficient oxygen transmission for the growth of mammalian cells in tissue culture plates (Perlman D. U.S. Pat. No. 5,858,770), and to promote normal epithelialization in partial-thickness wounds in pigs (Sirvio L et al. The Effect of Gas Permeability of Film Dressings on Wound Environment and Healing. Journal of Investigative Dermatology. 1989;93 :528-31), embodiments of the technology comprising silicone thin films coated with polymeric nanofilms allow an oxygen transmission that is at least similar to that of Tegaderm®, e.g., 2.74 cc/m 2 /day. Some embodiments comprise medical grade silicone films (0.01 inches thick, e.g., 250- ⁇ ) that are available commercially (Bioplexus, Ventura, CA).
  • a matrix as described above is applied to a wound under conditions such that wound healing, as measured by wound contraction, is accelerated.
  • the matrix is functionalized just prior to application to a wound, while in other embodiments, the matrix is provided in a sterile package and is functionalized so that it is ready for application following removal from the sterile packaging.
  • the wound is pretreated or primed with a covalent modification agent that is reactive with the functionalization agent displayed by the functionalized matrix.
  • the wound may be modified as described in detail above with a covalent modification agent displaying a reactive azide group, while the matrix may be modified with a covalent modification agent displaying an alkyne group.
  • the wound may be modified with covalent modification agent A which displays reactive group X and the matrix displays covalent modification agent B which displays reactive group Y, wherein X and Y react with each other to form a covalent bond.
  • the matrices are provided as kits, preferably with the matrix in a sterile package.
  • the matrix in the kit is pre-functionalized, while in other embodiments, the matrix is not functionalized and the kit comprises at least one functionalization agent along with instructions on how to functionalize the matrix.
  • the kits comprise a functionalization agent for functionalizing the wound bed prior to application of the matrix.
  • the matrix providing in the kit comprises at least one wound active agent.
  • the kits comprise a wound active agent and instructions from applying the wound active agent to the matrix prior to application to a wound.
  • a wound modifying agent with one or more wound active agents or matrix, as described above can be applied to all types of wounds. Furthermore, the compositions of the present invention can be applied to all types of wounds. Furthermore, a wound modifying agent with one or more wound active agents can be applied to skin, mucous membranes, body cavities, and to internal surfaces of bones, tissues, etc. that have been damaged. A wound modifying agent with one or more wound active agents can be used on wounds such as cuts, abrasions, ulcers, surgical incision sites, burns, and to treat other types of tissue damage. In some embodiments of the present invention, the compositions and methods described above enhance wound healing. The present invention contemplates that wound healing may be enhanced in a variety of ways.
  • compositions and methods minimize contracture of the wound as to best favor function and cosmesis. In some embodiments, compositions and methods promote wound contracture to best favor function and cosmesis. In some embodiments, the compositions and methods promote vascularization. In some embodiments, the compositions and methods inhibit vascularization. In some embodiments, the compositions and methods promote fibrosis. In some embodiments, the compositions and methods inhibit fibrosis. In some embodiments, the compositions and methods promote epithelial coverage. In some embodiments, the compositions and methods inhibit epithelial coverage. In some embodiments, the compositions and methods of the present invention modulates one or properties of cells in the wound environment or in the immediate vicinity of the wound. The properties that are modulated, e.g., are increased or decreased, include, but are not limited to adhesion, migration, proliferation, differentiation, extracellular matrix secretion, phagocytosis, MMP activity, contraction, and combinations thereof.
  • compositions of the present invention can be covered with a secondary dressing, or bandage, if desired to protect the layer or to provide additional moisture absorption, for example.
  • the wound modifying agent with one or more wound active agents can be reapplied at a later time. It may be desirable to wound modifying agents having different formulations of wound active agents at different stages of wound healing.
  • the immobilization of cytoactive factors and matrices immobilized on a wound bed using, for example, polyelectrolytes are evaluated in vitro and in vivo.
  • in vitro analysis comprising studying the ability of cytoactive factors to proliferate cell growth is evaluated in corneal epithelial cells and human vascular endothelial cells.
  • in vitro analysis comprises the construction of synthetic surfaces that mimic a wound bed, wherein said surfaces are created to comprise surface chemistries such as primary amine groups, carboxylic acids and thiol groups that are representative of the diversity of chemical functionality present in a wound bed.
  • ECM constituents and cytoactive factors are applied to the synthetic surfaces, and immobilization is confirmed by, for example, fluorescently labeled antibodies to the ECMs and cytoactive factors thereby immobilized.
  • Further in vitro analysis includes, but is not limited to, proliferation dose response of the cytoactive factors and EMCs on the synthetic surfaces.
  • the in vitro assays are used to evaluate cytoactive factors that inhibit specific cell growth in a wound bed, thereby allowing for preferential recruitment and growth of those cell types optimal for wound healing and rapid return of tissue function and non-recruitment of antagonistic cell species.
  • assays to evaluate immobilization strategies are performed ex vivo.
  • cutaneous wounds are harvested from mice.
  • a 6 mm surgical skin punch is used to create a cutaneous defect post-mortem, followed by removal of the entire wound bed (e.g., with underlying stromal muscular elements).
  • the ex vivo model system includes linker chemistries and the like, and the immobilization strategies are evaluated, for example, using fluorescently labelled proteins.
  • the ex vivo model system comprises the immobilization of biotinylated BSA.
  • the surface of the wound bed is activated with a NHS ester by exposure to, for example, 1 mM BS 3 .
  • Biotinylated BSA (at, for example, 2 mg/ml) is subsequently added to the activated wound bed and allowed to attach for 2 hours.
  • the biotinylated BSA immobilization is determined by FITC-labeled anti- biotin antibody. As such, once immobilization is verified (via fluorescence detection), evaluation of optimal chemical functionalities is determined for wound bed immobilization.
  • chemical functionalities are determined by replacing BS 3 in the ex vivo model system with heterobifunctional cross-linkers as described herein that react with, for example, carboxylic acids, amines, and thiol groups found in the wound bed.
  • the immobilization of cytoactive agents and extracellular matrix compounds as described herein are evaluated (e.g., using fluorescently labeled antibodies to immobilized compounds). It is contemplated that key parameters to a successful ex vivo evaluation include, but are not limited to, concentration of all
  • in vivo experiments further validate the wound bed healing methods as described herein.
  • the diabetic transgenic mouse db/db are used, as a phenotype of the diabetic mice is impaired wound healing.
  • Polyelectrolytes, cytoactive agents, and extracellular matrices as described herein are applied to the db/db mice for optimization of wound healing.
  • the present invention is not limited to a particular mechanism. Indeed, an understanding of the mechanism is not necessary to practice the present invention. Nonetheless, it is contemplated that optimized wound healing in diabetic mice provides a model system that correlates to wound healing for normal, cutaneous wounds.
  • skin wounds are created in tandem on diabetic mice using a surgical skin punch. After wounding, test compounds are immobilized in one of the wounds, leaving the other as a control (e.g., BSA only). The test compounds are evaluated, for example as described in Example 3, thereby providing further information for useful in vivo
  • compositions for wound bed healing are also obtained by, for example, evaluation of the wound bed for epithelial coverage, extent of formation of granulation tissue, collagen content, inflammation, fibroblast population and vascularization.
  • Test compounds include, but are not limited to, the polyelectrolytes as described herein, extracellular matrix components (e.g., collagen, laminin, MATRIGEL, fibronectin, etc.) and cytoactive agents (e.g., EGF, VEGF, PDGF).
  • extracellular matrix components e.g., collagen, laminin, MATRIGEL, fibronectin, etc.
  • cytoactive agents e.g., EGF, VEGF, PDGF
  • the present invention provides for the development of personalized therapeutic protocols for wound healing.
  • the compositions as described herein for wound healing are adapted for each individual wound, taking into account, for example, environmental factors, incubation times, application dynamics, wound bed structure, associated disease state (e.g., diabetes, etc.) and the like that make each wound bed unique.
  • the present invention provides for the alteration of surface
  • embodiments of the technology provide for the modification of wound-beds using microfilms comprising PEMs loaded with silver-nanoparticles and a dissolvable layer of PVA.
  • the conformal contact of the PEMs to the wound-bed provides for the localized delivery of silver to wounds (see, e.g., Figure 49).
  • Conventional silver dressings rest on top of a wound and have to release large concentrations of silver ions to diffuse through the wound exudate and kill microbes on the wound bed (see, e.g., Figure 49A). Most of the silver ions released are inactivated in the wound exudate.
  • microfilm silver dressings conform around the micro-contours of wound, providing intimate contact of active silver ions with wound bed, requiring up to 100x less silver than conventional dressings to kill microbes on wound-bed (see, e.g., Figure 49B).
  • microfilm dressings reduce loss of silver ions in wound exudate, reducing silver cytotoxicity and tissue staining.
  • embodiments of the technology indicate that PEMs releasing up to 100 times less silver than conventional silver dressings (e.g., Acticoat® dressings with nanocrystalline silver release -100 ⁇ g cm "2 per day) (P. L. Taylor, a L. Ussher, R. E. Burrell, Biomaterials 2005, 26, 7221) effectively reduced microbial colonization in contaminated murine wounds.
  • conventional silver dressings including Acticoat®
  • significantly inhibit re-epithelialization of excisional splinted wounds in mice (A. Burd, C. H. Kwok, S. C. Hung, H. S. Chan, H. Gu, W. K. Lam, L. Huang, Wound Repair. Regen. 2007, 15, 94) embodiments of the technology described herein comprising silver did not inhibit wound re-epithelialization in a similar murine wound-model and did not cause excessive inflammation. Accordingly, the
  • PEMs/PVA microfilms find use, e.g., as a proactive application over clean surgical wounds to prevent microbial infections.
  • conventional silver dressings are not
  • the PEM/PVA microfilm constructs used herein for wound microbial management possess a number of improved and/or novel attributes that are useful in clinical contexts.
  • Embodiments of the microfilm constructs are mechanically strong and translucent, allowing clinicians to handle the films and to see through them, thus providing for easy placement on a wound-bed.
  • conventional silver-dressings are opaque and are typically removed to examine wounds. Accordingly, embodiments of the PEM/PVA microfilms described herein reduce patient pain, nursing time, and costs associated with dressing changes.
  • conventional silver dressings are designed to release large concentrations of silver to replenish silver ions lost to proteins in wound fluid (M. Trop, M. Novak, S. Rodl, B. Hellbom, W. Kroell, W.
  • the embodiments of the technology provided herein are practical for use in a clinical environment with no loss of efficacy of the nanofilm component of the construct. Accordingly, the approach is generalizable, thus providing embodiments applicable to a heterogeneous variety of wounds and, in some embodiments, to simultaneous release of multiple bioactive agents in wound-beds to support different phases of wound healing.
  • the technology contemplates the modification of wound- beds with PEMs comprising multiple bioactive agents.
  • the technology provides significant improvements over conventional technologies in several aspects.
  • some conventional technologies use sacrificial polymer layers for the transfer of polymer nanofilms to wounds (R. Vendamme, S.-Y. Onoue, A. Nakao, T. Kunitake, Nat. Mater. 2006, 5, 494; W. Cheng, M. J. Campolongo, S. J. Tan, D. Luo, Nano Today 2009, 4, 482).
  • some conventional technologies use PEMs comprised of chitosan and sodium alginate, and the transfer the PEMs to wounds.
  • an antibiotic is included to manage microbial burden.
  • conventional technologies use a processes of fabrication comprising (i) formation of a PEM on a substrate and coating of the PEM with a film of PVA; (ii) mechanical removal of the PEM/PVA, inversion of the construct, and replacement attachment of the PEM/PVA constructs onto a substrate with the PEM surface exposed, (iii) deposition of antibiotic (tetracycline, TC) from acetone onto the surface of the PEM and encapsulation of the deposited layer of acetone by a layer of hydrophobic polyvinylacetate. Release of the TC from the construct occurred over 6 hours in a manner that was dependent on the thickness of the polyvinylacetate layer (layers of polyvinylacetate thicker than 200 nm were reported to delaminate during experiments).
  • antibiotic tetracycline
  • embodiments of the techonology provided herein provide a fabrication procedure to prepare PEMs capable of delivering bioactive agents that is novel and provides significant improvement over conventional technologies (T. Fujie, A. Saito, M. Kinoshita, H. Miyazaki, S. Ohtsubo, D. Saitoh, S. Takeoka, Biomaterials 2010, 31, 6269; A. Saito, H. Miyazaki, T. Fujie, S. Ohtsubo, M. Kinoshita, D. Saitoh, S. Takeoka, Acta Biomater. 2012, 8, 2932).
  • the embodiments of the procedure occur on a single surface, and do not require mechanical removal and replacement of the construct during fabrication.
  • embodiments of the technology provide for the controlled release of bioactive agents over 30 days, a period of time that encompasses the time typically involved in wound healing.
  • advantages are provided in the use of broad spectrum antimicrobial agents (e.g., silver) for routine management of microbial burden rather than antibiotics such as TC due to the increasing concerns of antibiotic-resistant bacteria to specific antibiotics.
  • the silver-loaded PEMs provided herein are more effective in reducing bacterial colonization both in vitro (bacterial reduction of 5.8 and 2.7 logio CFU for silver and TC, respectively) and in vivo (bacterial reduction of 2.4 and 1 log 10 CFU for silver and TC, respectively) compared to conventional PEMs.
  • biobrane exemplifies a primary dressing with high infection rates
  • the data collected indicate that wound treatment with silver nanofilms is broadly useful for management of microbial burden in combination with a range of moist wound dressings such as silicon films, collagen scaffolds, hydrogel sheets, hydrofibers, and hydrocolloids.
  • the technology contemplates the use of silver nanofilms in combination with these primary wound dressings to reduce microbial burden in contaminated wounds to provide, e.g., a reduction of microbial colonization in contaminated wounds to expedite wound closure as compared to unmodified wounds.
  • Example 1 Covalent immobilization of a protein to a surface
  • bovine serum albumin was used as the protein in the model system.
  • Bovine serum albumin was biotinylated (BSA used as control) and covalently attached to gamma-amino propyl silanes (GAPS)-treated glass surfaces using the homobifunctional bifunctional cross- linker BS 3 (ImM for 15min.).
  • BS 3 contains an amine-reactive N-hydroxysulfosuccinimide (NHS) ester at each end of an 8-carbon spacer arm.
  • the NHS esters react with primary amines at pH 7-9 to form stable amide bonds, along with release of the N- hydroxysulfosuccinimide leaving group.
  • the biotinylated BSA was labeled with FITC-labeled anti-biotin antibodies and the BSA control was probed using FITC-antigoat antibodies.
  • Skin wounds are created in tandem on diabetic mice using a surgical skin punch. After wounding, one of the wounds is treated by contact with activated 10-micrometer diameter polystyrene beads with surfaces terminated in carboxylic acid groups. The activation of the carboxylic acid groups is achieved by incubation in EDC/NHS solution (200 mM/50 mM) in phosphate buffered saline (PBS) (10 mM phosphate, 120 mM NaCl, 2.7 mM KC1; pH 7.6) for 1 hour at room temperature. Following activation, the beads were pipetted into the wound beads and allowed to incubate within the wound beds for 1 hr.
  • EDC/NHS solution 200 mM/50 mM
  • PBS phosphate buffered saline
  • the wound beds are washed exhaustively with PBS, and then incubated with collagen (10 micromolar in PBS).
  • collagen (10 micromolar in PBS).
  • the remaining wound is used as a control and treated as described above, but without activation of the beads with NHS/EDC.
  • the size of the wound is measured after 2, 4, 6, 8 and 10 days. It is observed that the treated wound decreases in size faster than the control wound.
  • Experiments depositing polyelectrolytes in wound bed explants from mice are performed by sequentially delivering the wound healing agent to the wound beds using pumps. Cutaneous wounds from euthanized mice are harvested. A peristaltic pump (Fischer Scientific) is used to pump the liquid. The excised wounds are sequentially treated by pumping of aqueous solutions (0.5 M NaCl, PBS at pH 7.0) containing polystyrene sulfonate (PSS, lmg/ml) or FITC-labeled poly allylamine hydrochloride (FITC-PAH, 1 mg/ml).
  • aqueous solutions 0.5 M NaCl, PBS at pH 7.0
  • PSS polystyrene sulfonate
  • FITC-PAH FITC-labeled poly allylamine hydrochloride
  • the wounds are treated rinsed with PBS using pumps. After each treatment with FITC-PAH, the intensity of fluorescence is recorded. A measurement of the growth in fluorescence after each treatment cycle with PSS and FITC-PAH demonstrates growth of a multilayered polyelectrolyte film on the wound bed, relative to control treatments.
  • Elastomeric stamps are prepared from PDMS using parts A and B of a kit purchased from Dow-Corning. After curing the stamps in an oven at 100°C for 12 hours, the surface of the PDMS stamp is incubated with aqueous solutions (0.5 M NaCl, PBS at pH 7.0) containing polystyrene sulfonate (PSS, lmg/ml) or FITC-labeled poly allylamine hydrochloride (FITC- PAH, lmg/ml).
  • aqueous solutions 0.5 M NaCl, PBS at pH 7.0
  • PSS polystyrene sulfonate
  • FITC- PAH poly allylamine hydrochloride
  • the PDMS stamp is rinsed with PBS. After 10 layers each of PSS and PAH are deposited onto the stamp, the stamp is mechanically contacted with the cutaneous wounds harvested from euthanized mice. After removal of the stamp from the wound bed, the intensity of fluorescence of the wound bed is recorded. A measurement of the fluorescence relative to control treatments (PBS free of polyelectrolytes is incubated with the stamps) verifies the deposition of the wound modifying agent into the wound bed.
  • Example 7 Delivery of the wound modifying agents to surfaces using inkjet technology
  • aqueous solutions (in PBS) of FITC-labelled collagen are inkjet printed onto gamma-amino propyl silanes (GAPS)-treated glass surfaces that are activated using the homobifunctional bifunctional cross-linker BS 3 (1 mM for 15 minutes).
  • BS 3 contains an amine-reactive N-hydroxysulfosuccinimide (NHS) ester at each end of an 8-carbon spacer arm.
  • NHS esters react with primary amines at pH 7-9 to form stable amide bonds, along with release of the N-hydroxysulfosuccinimide leaving group.
  • the surfaces are exhaustively washed with PBS.
  • the fluorescence intensity of the surface is measurements to indicate attachment of the FITC-labelled collagen to the surface relative to a control experiment in which the activated surface is pre-exposed to BSA (1 mg/ml in PBS for 2 hours), prior to inject printing of the FITC-labelled collagen.
  • Example 8 Delivery of the wound modifying agents using air brushes
  • Skin wounds are created in tandem on diabetic mice using a surgical skin punch. After wounding, one of the wounds is treated by contact with a 1 : 1 mixture of activated 100- nanometer and 1 -micrometer diameter polystyrene beads with surfaces terminated in carboxylic acid groups.
  • the activation of the carboxylic acid groups is achieved by incubation in EDC/NHS solution (200 mM/50 mM) in phosphate buffered saline (PBS) (10 mM phosphate, 120 mM NaCl, 2.7 mM KC1; pH 7.6) for 1 hour at room temperature.
  • PBS phosphate buffered saline
  • the mixture of beads are pipetted into the wound beads and allowed to incubate within the wound beds for 1 hour. After incubation, the wound beds are washed exhaustively with PBS, and then incubated in albumin (10 micromolar in PBS). The remaining wound is used as a control and treated as described above, but without activation of the beads with NHS/EDC. The size of the wound is measured after 2, 4, 6, 8 and 10 days. It is observed that the treated wound decreases in size faster than the control wound.
  • Example 10 Method to covalently modify the wound bed using a combination of polyelectrolytes and covalent cross-linking agents
  • Skin wounds are created in tandem on diabetic mice using a surgical skin punch. After wounding, one of the wounds is treated by contact with activated 1 -micrometer diameter polystyrene beads with surfaces terminated in carboxylic acid groups. The activation of the carboxylic acid groups is achieved by incubation in EDC/NHS solution (200 mM/50 mM) in phosphate buffered saline (PBS) (10 mM phosphate, 120 mM NaCl, 2.7 mM KC1; pH 7.6) for 1 hour at room temperature. Following activation, the beads are pipetted into the wound beds and allowed to incubate within the wound beds for 1 hour.
  • PBS phosphate buffered saline
  • the wound beds are washed exhaustively with PBS, and then incubated with PAH, and then washed again in PBS.
  • the wound bed is sequentially treated with PSS and FITC-labelled PAH (as described above). Between each adsorption step, the wound bed is rinsed with PBS. Fluorescence measurements of the wound bed after each FITC-PAH adsorption step confirm immobilization of the PSS and PAH to the wound bed.
  • Example 11 Method to modify the mechanical compliance of the wound bed
  • the mechanical compliance of the wound bed is modified by depositing
  • polyelectrolytes into the wound bed and cross-linking the polyelectrolyte films.
  • Experiments depositing polyelectrolytes in wound bed explants from mice are performed. Cutaneous wounds from euthanized mice are harvested. The excised wounds are sequentially treated with aqueous solutions (0.5 M NaCl, PBS at pH 7.0) containing polystyrene sulfonate (PSS, 1 mg/ml) and FITC-labeled poly allylamine hydrochloride (FITC-PAH, 1 mg/ml). Between adsorption steps, the wounds are treated and rinsed with PBS.
  • aqueous solutions 0.5 M NaCl, PBS at pH 7.0
  • PSS polystyrene sulfonate
  • FITC-PAH FITC-labeled poly allylamine hydrochloride
  • BS3 (1 mM in PBS) is added to the wound bed and incubated for lhr.
  • the rigidity of the wound bed is noticeably greater than a wound bed treated with polyelectrolytes without the final cross-linking step.
  • the increase in ridigidity is confirmed by Atomic Force Microscopy.
  • the mechanical compliance of the wound bed is altered by controlled application of enzyme(s) capable of degrading constituents of the extracellular matrix.
  • Cutaneous wounds from euthanized mice are harvested. 10 ⁇ concentration of collagenase is applied to the wound and allowed to incubate at room temperature for times ranging from 0 minutes to 1 hour.
  • the wound beds are then rinsed copiously with PBS.
  • Wet Field force microscopy of the wound beds confirms that application of degradative enzymes increases the compliance (decreases rigidity) of the wound beds in a time dependent fashion.
  • Example 13 Nanometer-thick silver-impregnated polymeric films showing selective toxicity towards bacterial growth and that support mammalian cell growth.
  • Polyelectrolyte multilayers electrostatically assembled alternately from such weak polyacids as poly(allylamine hydrochloride) (PAH) and poly(acrylic acid) (PAA) were tuned to impregnate post-assembly with silver nanoparticles to levels where they kill bacteria effectively yet allow adhesion of mammalian cells on the films without measurable cytotoxicity.
  • Silver ions (Ag + ) were incorporated in the films by incubating them with bulk solution of a silver salt (e.g., silver nitrate).
  • Silver loading in the PEMs could be varied from -24.2 ⁇ g/cm 2 to 0.4 ⁇ g/cm 2 .
  • Example 15 Synthesis and use of nanoscale polymer matrices with an accompanying sacrificial polymer layer (microsheet).
  • polymer matrices are assembled as polymer multilayer nanofilms over polydimethylsiloxane (PDMS) sheets; post-assembly, a sacrificial polymer layer of water-soluble polymer polyvinylalcohol (PVA) is casted (by spin coating) over the nanofilms; microsheets are peel ed-off the PDMS sheets; sacrificial cast of microsheets dissolves quickly in drops of water when placed over a device surface; polymer nanofilm is immobilized on the device surface.
  • Polymer nanofilms synthesized in this manner and loaded with silver nanoparticles or chlorhexidine were tested in-vitro and in an in-vivo wound healing model.
  • PEMs Polyelectrolyte multilayers of the oppositely charged polyelectrolytes poly(allylaminehydrochloride) (PAH) (MW 70 kDa; Sigma Aldrich St. Louis, MO) and poly(acrylic acid) (PAA) (MW 60 kDa; Polysciences, Warrington, PA) were assembled on elastomeric poly(dimethylsiloxane) (PDMS) (Dow Chemical, Midland, MI) sheets, or on plasma-cleaned silicon wafers, by 'layer-by-layer' deposition as described in detail elsewhere.
  • PAH poly(allylaminehydrochloride)
  • PAA poly(acrylic acid)
  • PDMS elastomeric poly(dimethylsiloxane)
  • PEMs with the desired number of multilayers were assembled on PDMS sheets using a StratoSequence Robot (nanoStrata Inc, Tallahassee, FL), by sequential incubation in solutions (0.01 M by repeat unit) of PAA (between pH 2.5 and pH 7.5) and PAH (pH 7.5) for 10 minutes each.
  • PAA between pH 2.5 and pH 7.5
  • PAH pH 7.5
  • the formation of the PEMs onto PDMS was initiated by the adsorption of PAH.
  • PDMS sheets were rinsed with DI water 3 times for 1 minute each after immersion in each polyelectrolyte solution. After assembly, the PEMs were dried in vacuum at 60°C for 1 hour. Number of bilayers ( «) fabricated are denoted as (PAH/PAA) worship.
  • Fluorescently labeled PEMs were assembly using fluorescein-5-isothiocynate (FITC) (Ext/Em-492/518)-labeled PAH.
  • the PEMs were nanometer-thick (10-200 nm). Their porous and supramolecular architecture allows them to be impregnated with a range of bioactive agents post-assembly or during assembly.
  • micropartilces or nanoparticles were impregnated during fabrication.
  • PAH(PAA/PAH)io multilayers deposited on PDMS sheets and terminating in a positively charged PAH layer were incubated with a 1 wt% suspension of microspheres for 2 h, and then washed 3 times with water.
  • PSS(PAH/PSS)2 multilayer was deposited over the first layer of silver nanoparticles, followed by deposition of the second layer of silver nanoparticles. Finally, the PEMs were capped with a set of (PAA/PAA)2 multilayer.
  • PAH(PAA/PAH)io(PS-microspheres) PAH/PSS 2 (Ag-NP)PSS(PAH/PSS) 2 (Ag-NP)(PAA/PAH) 2 .
  • PAA (MW 60 kDa) was obtained from Polysciences (Warrington, PA).
  • PAH (MW 70 kDa), Chlorhexidine diacetate (CX) (MW 625 Da) and all other reagents were obtained from Sigma Aldrich (St. Louis, MO).
  • PEMs with desired number of multilayers were assembled on Poly(dimethylsiloxane) (PDMS) sheets, or on plasma-cleaned silicon wafers, using a StratoSequence Robot (nanoStrata Inc, Tallahassee, FL), by sequential incubation in solutions of PAA and PAH (0.01 M by repeat unit) and/or chlorhexidine diacetate (0. ImM) for 10 min each.
  • PDMS Poly(dimethylsiloxane)
  • Polyelectrolytes solutions were adjusted to the desired pH using either 1 M HCL or 1 M NaOH; eg: PAH (adjusted to pH 7.5), PAA (adjusted to pH 5.5) and CX (pH of ⁇ 8.0).
  • PAH adjusted to pH 7.5
  • PAA adjusted to pH 5.5
  • CX pH of ⁇ 8.0
  • PAH/PAA5(CX/PAA) (PAH/PAA)5(CX/PAA) proposition) with incorporation of cationic chlorhexidine molecules between alternating PAH and PAA bilayers.
  • PAH labeled with fluorescein-5-isothiocyanate (FITC) (Ext/Em- 488/510) (cat# F1906, Invitrogen, Carlsbad, CA) was used to prepare fluorescent films.
  • Crimson fluorescent (Ext/Em- 625/645) FluoSpheres ® carboxylate-modified polystyrene (PS) microspheres, 2 ⁇ in diameter (cat# F8816, Invitrogen), or non-fluorescent carboxyl latex microspheres, 2 ⁇ in diameter (cat# C37274, Invitrogen) were used to prepare PEMs containing microspheres.
  • microspheres were washed three times with DI water in Eppendorf tubes by centrifuging for 5 min at 9000g, and re-suspended in fresh DI water by sonication and vortexing before use.
  • PAH/PAA multilayers ending in cationic PAH layer were incubated with a suspension of negatively charged microspheres for 2 h, and then washed 3x with water. Additional layers of polyelectrolytes were assembled subsequently over the microspheres.
  • Concentration of chlorhexidine in aqueous solutions was quantified by measuring their UV absorbance at 255 nm wavelength on a UV-Vis spectrophotometer (Beckman Coulter, Fullerton, CA). Fresh standard calibration curves of CX concentrations in solution were prepared for each experiment, with 0.1 ⁇ g/mL CX used as minimum standard concentration.
  • PVA polymer- polyvinyl alcohol
  • the strain of Staphylococcus aureus subsp. aureus ATCC 25923 was obtained from The American Type Culture Collection (Manassas, VA). Bacteria were grown in Tryptic Soy Broth with Yeast Extract (BD, Franklin Lakes, NJ) overnight at 37°C with shaking (200 rpm) until a cell density of approximately 4xl0 9 CFU/mL was reached, as determined from optical density (600 nm) measured on a UV-vis spectrometer (Beckman Coulter, Fullerton, CA). The bacterial suspensions were centrifuged at 2700 rpm for 10 min and the pellet washed and resuspended in PBS.
  • Manassas, VA The American Type Culture Collection (Manassas, VA). Bacteria were grown in Tryptic Soy Broth with Yeast Extract (BD, Franklin Lakes, NJ) overnight at 37°C with shaking (200 rpm) until a cell density of approximately 4xl0 9 CFU/m
  • test substrates were placed in the wells of 96- well plates and incubated with 100 HBSS (Hank's Buffered Salt Solution) (pH 7.4) containing 10 7 CFU of 5". aureus. Plates were incubated with shaking (200 rpm) at 37°C for 24 h. After incubation, the fluid in each well was collected, the wells rinsed twice with 200 ⁇ ⁇ ice cold PBS, and the fluid and washes from each well pooled and brought to 1 mL in PBS. Serial dilutions of the solutions in PBS were spread onto Trypticase Soy Blood Agar plates (#221261, BD, Franklin Lakes, NJ) and incubated at 37°C. Viable bacterial colonies were counted on agar plates after 24 h incubation. All assays were carried out on at least three different days, with at 3-6 replicates of each test sample in each experiment.
  • HBSS Hormic Acid Solution
  • mice All experimental protocols were approved by the Institutional Animal Care and Use Committee (IACUC) of the University of Wisconsin-Madison. Phenotypically normal male mice (heterozygous for Lepr db , Jackson Laboratories, Inc.) between the ages of 8-12 weeks were used. Mice were housed in groups during a one week acclimation period prior to the study and housed individually thereafter. Throughout the study period, mice were maintained in a temperature-controlled facility with a standard light/dark cycle. All mice were provided with environmental enrichment and food and water ad libitum. Mice were randomly assigned to either control or experimental groups on the day of surgery.
  • IACUC Institutional Animal Care and Use Committee
  • mice were anaesthetized with inhaled isoflurane, administered using an induction chamber.
  • the mice were injected subcutaneously with buprenorphine (0.1 mg/kg) for pain control and the cranial thoracodorsal region was shaved and aseptically prepared for surgery. Wounds were splinted to prevent wound contracture and promote wound closure by epithelialiation. Silicone O- rings (McMaster-Carr®, inner diameter 11 mm, outer diameter 15 mm) were applied to the skin 4 mm caudal to the base of the ears on each side of the dorsal midline and secured with tissue glue (Tissumend II) and six 5-0 interrupted nylon sutures.
  • tissue glue Tissumend II
  • the splints and sutures were monitored daily. Any loss of contact between the splint and skin was repaired with glue. Broken or missing sutures were replaced under anesthesia as described above, and a dose of buprenorphine was administered subcutaneously (0.1 mg/kg) for pain control. Wounds were removed from analysis if two or more sutures were broken or missing within a 24-hour period. Wounds were digitally traced in the photographs and the area calculated using NIH ImageJ software. Wound closure was calculated at each time point as the percentage of the original wound area.
  • a bacterial suspension of 10 6 CFU of S. aureus in 10 ⁇ ⁇ PBS was applied topically to the wound and allowed to absorb for 15 minutes before application of a wound dressing (e.g., Biobrane).
  • a wound dressing e.g., Biobrane
  • all mice were euthanized and the wounds with the attached Biobrane were excised aseptically with a 6 mm biopsy punch. Wounds and Biobrane were homogenized for 15 minutes in 1 mL PBS.
  • Figure 15 provides images of microsheets composed of a sacrificial water-soluble cast of PVA and a nanofilm made with PEMs containing silver-nanoparticles.
  • Panel A provides an image of a microsheet (1" x 1") placed on a glass dish.
  • Panel B provides an image of a polymer nanofilm matrix (1" x 1") floating on a water surface after the dissolution of sacrificial cast of the microsheet in solution.
  • FIG. 18 demonstrates sustained release of silver-ions in PBS from polymer nanofilms assembled as PEMs of PAH and PAA containing 1 1 ⁇ 2.1 ug/cm 2 of silver-nanoparticles.
  • Figure 19 demonstrates sustained release of chlorhexidine (CX) in PBS from polymer nanofilms fabricated as PEMs containing chlorhexidine acetate molecules.
  • FIG. 20 provides images of application of a microsheet as a silver-microfilm wound dressing on excisional wounds in mice.
  • A A 6-mm diameter full-thickness splinted wound on the flank of a mice.
  • B Coverage of wound by a silver impregnated microfilm wound dressing. The sacrificial cast dissolved in moist wound to immobilize silver-nanofilm polymer matrix on the wound surface.
  • Figure 21 provides data showing reduction in the bacterial colonization of excisional wounds in mice on day 3 post-surgery by a microsheet used as silver-microfilm wound dressing containing silver-nanoparticles. All wounds were inoculated with S. aureus on day 0 and covered with IntegraTM bilayer wound dressing, or covered with silver-microfilm wound dressing (microsheet) along with IntegraTM dressing. The bioactive plymer nanofilms expedited wound closure in vivo.
  • Figure 22 provides data demonstrating that silver-microfilm wound dressing
  • FIG. 22A shows representative images of wounds in group A and group B on day 9 post surgery.
  • Figure 22D the plot shows the microbial burden (average ⁇ SEM) of S.
  • Figure 24 shows immobilization of polymer nanofilms by a microsheet on the surface of moist collagen matrix of IntegraTM bilayer wound dressing.
  • A Micrograph of the surface of collagen matrix of IntegraTM wound dressing.
  • B
  • microspheres by a microsheet on the moist collagen matrix of Integra wound dressing are microspheres by a microsheet on the moist collagen matrix of Integra wound dressing.
  • A Micrograph of a microsheet with a polymer nanofilm containing 2 ⁇ size fluorescent microsphers, as assembled on an elastomeric sheet.
  • FIG. 26 shows reduction in bacterial colonization in solutions incubated on the surface of IntegraTM Bilayer wound dressing modified by silver-nanofilms (AgNP) using microsheets with water-soluble sacrificial casts of PVA. Solutions over test dressings were repeatedly inoculated withlO 7 CFU/ml of S. aureus every 24 h.
  • Figure 26 shows reduction in the bacterial colonization of excisional wounds in mice on day 3 post-surgery by IntegraTM Bilayer wound dressing in which collagen matrix surface was modified with silver-microsheets containing silver-nanoparticles (AgNP). All wounds were inoculated with S. aureus on day 0 and covered with either IntegraTM wound dressing, or IntegraTM dressing surface modified with silver-microsheets.
  • Example 16 Fabrication of nanoscale polymer matrix by spray coating.
  • PEMs of PAA and PAH were assembled on PDMS sheets, glass substrates, and silicon wafers, by spray coating polyelectrolytes using a multiarm spraying robot.
  • An automated SPALASTM (Spray Assisted Layer-by-layer Assembly) coating system was employed.
  • Polyelectrolyte solutions, rinse water and air were delivered through four different spray nozzles onto the substrate. Substrates of up to 6" x 10" were coated with PEMs using this method. PEMs fabrication on a PDMS sheet was initiated by first spraying PAH. After that, negatively charged polyelectrolyte solution (PAA) and positively charged PAH.
  • PAA negatively charged polyelectrolyte solution
  • polyelectrolyte solution was sprayed in alternative cycles with intermittent water rinsing and drying cycles.
  • PEMs with (PAH/PAA)2o bilayers were fabricated in an example. PEMs were subsequently impregnated with silver-ions;that were subsequently reduced to silver-nanoparticles in-situ. Silver loading in PEMs was characterized using inductively coupled plasma emission spectroscopy (ICPES) to range from 1 ⁇ g/cm 2 to 21 ⁇ g/cm 2 .
  • ICPES inductively coupled plasma emission spectroscopy
  • the thickness of (PAH/PAA)2o nano films fabricated by spray coating on silicon wafers and characterized using ellipsometry, was in the range of 100-200 nm.
  • Example 17 Mechanical strength of microsheets.
  • Figure 27 provides a stress strain curve showing mechanical strength of a silver- microsheet at 25°C in a Dynamic Strain Sweep test at 0.1 Hz frequency, as measured using a Film and Fiber tool on a Dynamic Mechanical Analyzer (DMA).
  • Elastic Young storage modulus ( ⁇ ') was ⁇ 10 9 Pa and elastic loss modulus (E") was ⁇ 10 8 Pa.
  • Microsheet was made of a PVA cast over nanofilms (PEMs) of (PAH/PAA)2o impregnated with silver- nanoparticles. Rectangular microsheet strips of width 3 mm were used for this tensile testing. Microsheet was clamped on the tension clamp such as to provide 10 mm of specimen length.
  • Example 18 Polymeric multilayer nanofilms with silver nanoparticles reduce microbial burden in contaminated wounds
  • nanofilms were impregnated with silver ions that were subsequently reduced in situ to silver nanoparticles.
  • a dissolvable cast of poly(vinylalcohol) PVA was spin- coated over the PEM to create a PEM/PVA composite that is peeled from the underlying support to create an easily handled microfilm.
  • PAH 65 kDa
  • sodium borohydride sodium borohydride
  • PVA 13-23 kDa, 98% hydrolyzed
  • Sigma Aldrich Sigma Aldrich
  • silver nitrate Alfa Aesar
  • PAA 50 kDa
  • FITC fluorescein-5-isothiocyanate
  • Polished silicon wafers were purchased from Silicon Sense (Nashua, NH). Terminally gamma irradiated human cadaver skin allograft,
  • GammaGraft® was obtained from Promethean LifeSciences Inc, Pittsburgh, PA. All work with GammaGraft was performed under sterile conditions in an air- flow hood.
  • PEMs Poly(dimethylsiloxane) (PDMS) sheets were fabricated by curing Sylgard 184 (10: 1 base to catalyst; Dow Chemical, Midland, MI) on OTS- functionalized silicon wafers or glass slides at 60°C for 24 hours. After 24 hours, PDMS was released from the silicon wafers/glass slides and PEMs were assembled on the side of the PDMS that previously was in contact with the OTS-coated silicon wafer/glass slide. The OTS-coated silicon wafer was used to ensure formation of a smooth surface on each PDMS sheet. Aqueous solutions of polyelectrolytes were adjusted to the desired pH using either 1 M HC1 or 1 M NaOH for layer-by-layer assembly.
  • the PEMs were assembled on PDMS sheet using a StratoSequence IV, a robotic dipping machine, from nanoStrata Inc, Tallahassee, FL.
  • the PDMS sheets were first immersed into a PAH solution (0.01 M) for 10 min followed by three 1 -minute rinses with deionized water (Millipore, 18.2 ⁇ ).
  • the substrates were immersed in PAA solution (0.01 M) for 10 minutes followed by the rinsing steps described above.
  • the adsorption and rinsing steps were repeated until the desired number of multilayers was deposited, as described elsewhere (A. Agarwal, K. M. Guthrie, C. J. Czuprynski, M. J. Schurr, J. F. McAnulty, C. J. Murphy, N. L. Abbott, Adv. Funct. Mater. 2011, 21, 1863).
  • Post fabrication the PEMs were dried in vacuum at 60°C for 1 hour and then stored at ambient conditions.
  • carboxylate-bound Ag + ions within the PEMs were subsequently reduced to form Ag(0) nanoparticies by incubating PEMs in aqueous NaBH 4 (2 mM) solution for 1 minute and again rinsing with water (M. Logar, B. Jancar, D. Suvorov, R. Kostanjsek, Nanotechnology 2007, 18, 325601).
  • the acidic solutions conditions regenerate the carboxylic acid groups within the PEMs. This allows additional Ag + to be loaded into the PEMs. Repeated incubation in Ag + solutions followed by reducing agent solutions can be used to increase the loading of silver in the PEMs.
  • the loading of silver incorporated into the PEMs was determined by extracting the silver from the PEMs (which were punched into circles of 6 mm diameter using a biopsy punch) into 5 mL of 2% nitric acid by incubation for 24 hours.
  • the concentration of Ag + extracted from the PEMs was measured by elemental analysis using an inductively coupled plasma (ICP) emission spectrometer (Perkin Elmer Optima 3000 DV) at the wavelength of 328.068 nm (Z. Shi, K. G. Neoh, S. P. Zhong, L. Y. L. Yung, E. T. Kang, W. Wang, J. Biomed. Mater. Res. A. 2006, 76, 826).
  • the detection limit of the instrument was specified to be ⁇ 0.1 ppb. Details regarding the analytical method can be found elsewhere (A. Agarwal, T. L. Weis, M. J. Schurr, N. G. Faith, C. J. Czuprynski, J. F. McAnulty, C. J. Murphy, N. L. Abbott, Biomaterials 2010, 31, 680).
  • S. aureus ATCC 6538
  • P. aeruginosa ATCC 27853
  • ATCC Manassas, VA
  • Bacteria were grown in Tryptic Soy Broth Yeast Extract (TSBYE) (BD, Franklin Lakes, NJ) overnight at 37°C with shaking at 200 rpm until a cell density of approximately 4 x 10 9 CFU/mL was reached.
  • TBSYE Tryptic Soy Broth Yeast Extract
  • the cell density was calculated from a standard curve for optical density (600 nm) of bacterial suspensions prepared using a UV-Vis spectrometer (Beckman Coulter, Fullerton, CA).
  • the bacterial suspensions were centrifuged at 4000 rpm for 10 minutes and the pellet washed and resuspended in Hank's Balance Salt Solutions (HBSS) buffer.
  • HBSS Hank's Balance Salt Solutions
  • the test samples 1) GammaGraft without PEMs, 2) PEMs without silver on GammaGraft, and 3) PEMs with silver on GammaGraft, were placed at the bottom of the wells of 96-well plates and were incubated with 100 PBS buffer (pH 7.4) containing 10 7 CFU of bacteria. Plates were incubated with shaking (150 rpm) at 37°C for 24 to 48 hours.
  • each well was collected in Eppendorf tubes pre-filled with 900 of ice cold PBS to make a 1 mL suspension of bacteria. To ensure collection of most of the bacteria present in the well, each well was rinsed twice with 200 diluted bacterial solution collected previously. The viable bacterial cells in the washings were determined by a surface spread-plate method (B. Herigstad, M. Hamilton, J. Heersink, J. Microbiol. Methods 2001, 44, 121). Dilutions of the samples were prepared in PBS and 100 ⁇ of each diluted sample was spread onto Trypticase Soy Blood Agar plates (#221261, BD, Franklin Lakes, NJ).
  • CFU colony forming units
  • mice Phenotypically normal male mice (heterozygous for Lepr db , Jackson Laboratories, Inc.) or BALB/c mice, 8-12 weeks old, were used in this study. In order to prevent other mice from disturbing the wounds, mice were housed individually in ventilated cages. All mice were acclimatized for a minimum of one week before the surgery. Throughout the study period, mice were maintained in a temperature-controlled facility with a standard light/dark cycle. All mice were provided with environmental enrichment and food and water ad libitum. Mice were randomly assigned to either control or experimental groups on the day of surgery.
  • mice were anaesthetized with inhaled isoflurane, administered using an induction chamber. After buprenorphine (0.001 mg) delivery to the mice (used for pain control), hair on the left and right thorax immediately behind the shoulder was removed using electric clippers. The area was swabbed with 4% chlorhexidine gluconate surgical scrub alternating with 0.9% sterile saline (3 times each). Subsequently, silicone O-rings
  • mice Following wounding, 8 mm diameter PEM/PVA composite microfilms (held in tweezers) were placed onto the wound-beds. Wounds were covered with secondary dressings, as described in the text. Mice were recovered from anesthesia on a warming pad. Wounds were photographed using a digital camera and body weights of mice were registered on postoperative day 1, and every 2-3 days thereafter until the end of the study. Upon completion of the study, mice were euthanized by intra-peritoneal injection of Beuthanasia®-D (Schering- Plough) solution (0.5 mL/mouse) after induction of anesthesia.
  • Beuthanasia®-D Schering- Plough
  • Wounds were removed from analysis if two or more sutures were broken or missing within a 24-hour period. Wounds were digitally traced in the photographs and the area calculated using NIH ImageJ software. Wound closure was calculated at each time point as the percentage of the original wound area.
  • each wound was inoculated with 10 ⁇ ⁇ of a bacterial suspension containing ⁇ 10 6 CFU of S. aureus. After the bacterial suspension was incubated on the wound for 15 min, the PEM/PVA microfilms (8 mm diameter) were applied to the surgical site and covered with an 8-mm disc of Biobrane® (UDL Labs). PEM/PVA microfilms (with and without silver) and Biobrane were sterilized by UV light for 30 minutes before application to the wounds. Sterile non-adherent padding (Telfa) was placed on top of the Biobrane, and the entire dressing construct was covered with Tegaderm (3M).
  • Tegaderm 3M
  • mice were recovered from anesthesia on a warming pad. After three days, the mice were euthanized.
  • the wounds (including the Biobrane cover) were harvested with a 6-mm biopsy punch, placed into an Eppendorf tube with 1 mL sterile PBS, and homogenized with a bullet blender for 15 minutes.
  • the viable bacterial cells in the homogenate were determined by a surface-spread plate method as described in the in vitro assay.
  • mice On day 7 post-operative, 2, 5 and 5 mice from the group without microfilms, from the group with microfilms without silver, and from the group with microfilms with silver, respectively, were euthanized. On day 14, after operation, 2, 3 and 3 mice from each group, respectively, were euthanized.
  • the entire wound with adjacent normal skin was excised and fixed in 10% buffered formalin.
  • the specimen included the epidermis, dermis and the subcutaneous tissue.
  • Excised wound sites fixed in formalin were processed and embedded in paraffin, and wound sections were stained with hematoxylin and eosin (H&E).
  • the H&E sections were photographed using a mounted digital camera (Olympus DP72, Melville, NY) and images were analyzed using an image analysis software (CellSence Dimension 1.4, Olympus, Melville, NY) for length of re-epithelialization, epithelial gap, amount of fibrovascular proliferation in the dermis, and inflammatory response.
  • PEM/PVA microfilms Fabrication of free standing PEM/PVA microfilms: During the development of embodiments of the technology described herein, layer-by-layer deposition was used to fabricate PEMs consisting of PAH (pH 7.5) and PAA (pH 2.5 and 5.5), starting with deposition of a layer of PAH on a poly(dimethylsiloxane) (PDMS) sheet (see Materials & Methods in Section B for details). Below, PEMs are identified using the notation
  • n is the number of bilayers, where one bilayer comprises or consists of one adsorbed layer of Polyl and one adsorbed layer of Poly2.
  • the layers of such "bilayers" are substantially intermixed in PEMs. Growth of (PAH7.5/PAA2.5 and 5.5)10.5 multilayers (vacuum dried after fabrication) on piranha-cleaned silicon wafers were confirmed by performing measurements of ellipsometric thicknesses ( Figure 29).
  • PVA is a non-toxic biodegradable polymer widely used in fabrication of biomaterials including hydrogels (C. R. Nuttelman, S. M. Henry, K. S. Anseth, Biomaterials 2002, 23, 3617; R. H. Schmedlen, K. S. Masters, J. L. West, Biomaterials 2002, 23, 4325).
  • microfilms 25-50 of 2.5 wt.% PVA solution was pipetted over PEMs supported on PDMS sheets (6-8 mm diameter), wetting all their surface area.
  • the microfilm construct was dried in an oven for 5 minutes at 70°C. After drying, the composite PEM/PVA construct was peeled from the PDMS surface, e.g., using tweezers.
  • the thickness of the PVA microfilm was measured to be 20-40 ⁇ using an electric digital micrometer (Marathon Watch Co., Richmond Hill, Ontario, Canada).
  • the final PEM/PVA microfilm was measured to have an elastic Young's modulus ( ⁇ ') of 1 GPa ( Figure 27).
  • the microfilms were sufficiently robust that they could be easily handled, e.g., by hand or tweezers, and placed on wound surfaces or skin grafts.
  • the effectiveness of the removal of PEMs from the PDMS sheets was quantified using (PAH/PAA 5 . 5 )io.5 nanofilms that were assembled with fluorescein-5-isothiocynate (FITC) (Ext/Em-492/518)-labeled PAH.
  • FITC fluorescein-5-isothiocynate
  • Montage fluorescent micrographs were acquired of a PEM/PVA microfilm before and after peeling from the PDMS substrate ( Figure 30a, Figure 30b, and Figure 30c).
  • the fluorescent micrographs (imaged using 4* objective) were stitched together using MosaicJ, a plugin available in Fiji software, to create a composite image of the polymer film over a large area ( ⁇ 6 mm diameter).
  • the results demonstrate that 99.3 ⁇ 1.1% of the PEM was peeled from the PDMS sheet (quantified using the fluorescent area measured from micrographs using Fiji software, averaged over 23 samples).
  • PEMs were impregnated with silver by the exchange of silver ions with protons of the carboxylic groups of the PAA in the PEMs.
  • the silver ions in the PEMs were subsequently reduced in situ to form silver nanoparticles (see Materials & Methods in Section B for details).
  • the silver loading in each PEM was tailored by controlling: (i) the number of bilayers in the PEM, (ii) the pH of the assembly solution of the weak
  • (iii) the number of silver ion exchange and reduction cycles.
  • PEMs with a single cycle of silver ion exchange and reduction were tested and characterized for short-term (1 to 4 days) silver release profiles and antibacterial efficacy.
  • Constructs identified from the in vitro studies were impregnated with higher silver loadings by using multiple silver ion exchange and reduction cycles to provide long-term (>10 days) release of antibacterial silver in murine wounds.
  • the loading of silver in PEMs of (PAH/PAA)io.5 could be varied systematically from 0.04 ⁇ ⁇ 0.01 to 2.9 ⁇ 0.1 ⁇ g enf 2 by changing the pH of the PAA assembly solution from pH 5.5 to pH 2.5.
  • the PEMs made from (PAH/PAA2.s)5.5 provided intermediate loadings of silver (1.3 ⁇ 0.01 ⁇ g cm 2 ).
  • These PEMs with 3 different loadings of silver were chosen for further in vitro antibacterial testing.
  • the 0.04 ⁇ ⁇ 0.01 ⁇ g cnf 2 loading was chosen as a control because the PEMs were subjected to the same processing conditions as the other two loadings yet contain minimal active agent.
  • Figure 33 shows that the loadings of silver within the PEMs were measured to be invariant during three months of storage.
  • PEM/PVA microfilms with a diameter of 6 mm were peeled from PDMS sheets and were placed onto the moist skin dermis (6 or 8 mm diameter) with the PEMs facing the surface of the tissue.
  • the skin dermis was maintained moist before the placement of the free standing PEM/PVA microfilm using PBS, mimicking moist wounds.
  • PEM/PVA microfilms were held by tweezers (with PEMs side facing the skin dermis) and contacted with the dermis by first placing an edge of the microfilm into contact with the skin dermis and then releasing the microfilm from the tweezers to allow the remainder of the microfilm to adhere to the skin dermis.
  • the PVA cast of each microfilm was observed to dissolve gradually over 10 minutes on the moist dermis and the PEMs were observed to adhere to the dermis.
  • the efficiency of transfer of the PEMs from the PDMS support onto the skin dermis was evaluated using fluorescent microscopy.
  • PEMs with 40.5 multilayers of FITC-PAH were assembled. Fluorescent imaging was performed immediately after the PEMs were transferred onto the skin dermis. Quantification of the transfer efficiency was performed using Fiji software by comparing the projected fluorescent area of the PEMs on the PDMS sheets ( Figure 34a) with that of the PEMs after transfer onto the skin dermis ( Figure 34b), averaged over 13 samples. Repeat experiments confirmed that 99.7 ⁇ 0.5% of the fluorescent area that was projected by the PEMs on the PDMS sheets was transferred onto the skin dermis. The experiments were performed on several different days using different batches of microfilms.
  • the rate of dissolution of the PVA cast within a composite microfilm was studied in excess PBS using a Malachite Green spectroscopic dye (0.01 wt% dye) mixed into the PVA solution used for casting.
  • the 8 mm diameter composite microfilms were incubated in a multiwell plate in 3 mL PBS, and the cumulative concentration of Malachite Green that was released into the PBS was determined at different time points by measuring the absorbance of the solution at 595 nm wavelength, as shown in Figure 35. From these measurements, we concluded that -98% of the PVA cast dissolves within 10 minutes of contact with the PBS.
  • the release profile of silver ions in PBS from modified skin dermis is presented in Figure 34e.
  • the amount of silver released in 24 hours was 0.04 ⁇ ⁇ 0.01, 0.20 ⁇ 0.01, and 0.44 ⁇ 0.04 ⁇ g cm 2 from the dermis modified with the three PEM constructs described above, respectively.
  • the dermis released none, 0.07 ⁇ 0.01, or 0.18 ⁇ 0.03 ⁇ g cm "2 /day of silver, respectively, for the next 2 days.
  • the total amount of silver released, at saturation, over 6 days was 0.04 ⁇ ⁇ 0.01, 0.41 ⁇ 0.01, and 0.80 ⁇ 0.03 ⁇ g cm "2 , respectively.
  • Antibacterial activity of skin dermis modified with composite PEM/PVA microfilms During the development of embodiments of the technology provided herein, experiments were performed using skin dermis (GammaGraft) modified with PEM/PVA microfilms to test for antimicrobial activity against suspensions of either Gram-positive bacteria
  • the wounds were 'splinted' to minimize wound closure by contraction and, thus, allow wound closure primarily by epithelialization as in human dermal healing (R. D. Galiano, J. Michaels, M. Dobryansky, J. P. Levine, G. C. Gurtner, Wound Repair. Regen. 2004, 12, 485).
  • Initial in vivo studies determined the transfer and persistence of PEMs on the wound-bed.
  • Freshly prepared surgical wounds (6 mm diameter) were allowed to exude excess fluid for 5 minutes and then were covered with the PEM/PVA microfilms, with the PEMs facing the wound-bed, as shown in Figure 40a.
  • the edge of the composite microfilm was held firmly in tweezers and one edge was brought into contact with the wound-bed. Release of the microfilm from the tweezers resulted in adherence of the remaining film to the wound-bed.
  • the PVA cast of each microfilm was observed to start dissolving immediately after contact with the moist wound environment.
  • the PEMs were found to adhere conformally to the wound-bed within 10 minutes of dissolution of the PVA cast of the composite microfilms, as shown in Figure 40b.
  • Biobrane® is a transparent biosynthetic dressing widely used in hospitals for the treatment of burn wounds (I. S. Whitaker, S. Prowse, T. S. Potokar, Ann. Plast. Surg. 2008, 60, 333; E. M. Lang, C. a. Eiberg, M. Brandis, G. B. Stark, Ann. Plast. Surg. 2005, 55, 485). It is composed of a silicone membrane with nylon fibers coated with collagen peptides. Biobrane® seals the wounds and promotes tissue growth.
  • a key advantage of Biobrane is that it integrates into wounds and thus circumvents painful dressing changes (R. L. Klein, B. F. Rothmann, R. Marshall, J. Pediatr. Surg. 1984, 19, 846; M. Tavis, J. Thornto, R. Bartlett, J. Roth, E. Woodroof, Burns 1980, 7, 123).
  • the silver loading cycles ended with a final silver ion exchange, such that the PEMs provided an initial burst release of silver ions (bound to carboxylic groups of PAA) that was followed by sustained release of silver ions via dissolution of silver nanoparticles entrapped in the PEMs.
  • a typical silver release profile for these PEMs is presented in Figure 42 As shown, the PEMs provided an initial burst release of 3.1 ⁇ 0.1 ⁇ g cm "2 of silver in the first 24 hours, followed by a release of -1.5 ⁇ g cm "2 silver /day for 4 days, and a release rate of -0.4 ⁇ g cm "2 /day thereafter.
  • the cumulative release of silver over the 30 days period was measured to be 17.2 ⁇ 0.6 ⁇ g cm "2 .
  • wounds that were modified by silver/PEMs using the PEM/PVA composite microfilms had an average of only 6.1 10 3 CFU/cm 2 of S. aureus, e.g., an average of 2.4 logio reduction in bacterial burden of the wounds under Biobrane as compared to unmodified wounds.
  • Figure 45a Images of the representative wounds treated with silver/PEMs are shown in Figure 45a, Figure 45b, and Figure 45c for post-operative day 0, 7 and 14. Similar representative images for the control groups are shown in Figure 46. These images show, qualitatively, that wounds modified with silver/PEMs exhibited similar rates of wound healing as the controls. The epithelial coverage of the wounds was assessed from digital images of wounds, and is presented in Error! Reference source not found. Figure 45d as the percentage of original wound size on post-operative days 3, 7, 10 and 14. The results document that the rate of wound closure in all treatment groups was not significantly different on any particular day of observation (p > 0.05, ANOVA Tukey's test).
  • FIG 47a and Figure 47b Representative histopathological sections of the wounds modified with silver/PEMs are presented in Figure 47a and Figure 47b for day 7 and 14 post-surgery, respectively. Similar representative histopathological images for control wounds are presented in Figure 48. Images at day 7 post-surgery clearly show a migrating re-epithelialization cell layer at the wound edge. In addition, wounds modified with silver/PEMs exhibited re-epithelization similar to that in control wounds. Complete closure by re-epithelialization was observed in images on day 14. The quality of granulation tissue and degree of inflammation in all tissue sections was found not to be significantly different between the three test groups, indicating normal progress of wound healing.
  • Example 19 Use of transition metal gallium as antibiofilm agent in wound dressings A. Summary
  • Biofilms can cause failure of treatment, loss of limbs (e.g. diabetic foot ulcers), or death, and biofilms typically need to be surgically debrided in conventional treatment regimes to allow normal wound healing to progress (Wolcott et al. Regular debridement is the main tool for maintaining a healthy wound bed in most chronic wounds. Journal of Wound Care. 2009; 18:54-6).
  • the process leading to infection and establishment of biofilms begins at the moment of wounding and needs to be prevented at the onset of wound treatment (Kennedy et al. Burns, biofilm and a new appraisal of burn wound sepsis. Burns. 2010;36:49-56). Accordingly, there is an urgent need for improved dressings and formulations that prevent biofilm formation in acute infections and sensitize bacteria in biofilms in chronic wounds to antimicrobials.
  • the transition metal gallium (Ga) inhibits bacterial growth, prevents biofilm formation, and disperses established biofilms (Kaneko et al. The transition metal gallium disrupts Pseudomonas aeruginosa iron metabolism and has antimicrobial and antibiofilm activity. The Journal of Clinical Investigation. 2007; 1 17:877-88; Zhu et al. Pre-treatment with EDTA-gallium prevents the formation of biofilms on surfaces. Experimental and therapeutic medicine. 2013;5: 1001-4; Valappil et al. Effect of novel antibacterial gallium- carboxymethyl cellulose on Pseudomonas aeruginosa. Dalton Transactions. 2013;42: 1778- 86; Halwani et al. Co-encapsulation of gallium with gentamicin in liposomes enhances antimicrobial activity of gentamicin against Pseudomonas aeruginosa. Journal of
  • Ga disrupts iron (Fe) metabolism of bacteria that is essential for the functioning of key enzymes required for bacterial growth (Kaneko et al.
  • the transition metal gallium disrupts Pseudomonas aeruginosa iron metabolism and has antimicrobial and antibiofilm activity.
  • Free Fe levels are already extremely low at wound sites due to multiple host defenses that sequester Fe to deter microbial infections.
  • Ga taken up by bacteria further decreases Fe uptake of bacteria by repressing Fe-responsive transcriptor regulators (Kaneko et al.
  • Ga3+ has an ionic radius nearly identical to that of Fe 3+ , and many biologic systems are unable to distinguish Ga 3+ from Fe 3+ (Chitambar et al. Targeting iron-dependent DNA synthesis with gallium and transferrin-gallium. Pathobiology : journal of immunopathology, molecular and cellular biology. 1991 ;59:3-10). Substitution of Fe with Ga disrupts Fe- dependent processes because unlike Fe 3+ , Ga 3+ cannot be reduced in physiological conditions.
  • Ga 3+ As such, sequential oxidation and reduction steps critical for many Fe-mediated biological functions are inhibited by Ga 3+ , resulting in bacterial cell death (Chitambar et al. Targeting iron-dependent DNA synthesis with gallium and transferrin-gallium. Pathobiology : Journal of Immunopathology, Molecular and Cellular Biology. 1991;59:3-10).
  • studies have shown that Ga is particularly taken up by the nutrient (and, thus, Fe) starved cells in the center of biofilms to which conventional antimicrobials and antibiotics are least effective, making Ga particularly advantageous in biofilm dispersal (Kaneko et al.
  • transition metal gallium disrupts Pseudomonas aeruginosa iron metabolism and has antimicrobial and antibiofilm activity.
  • Ga( Os) 3 to inhibit biofilm formation.
  • Ga was added to cultures of
  • Biofilm growth arising from suspensions of 10 6 CFU/ml . aeruginosa was quantified after 24, 48, and 72 hours by staining biofilms with crystal violet, following methods described previously (Brandenburg et al. Tryptophan Inhibits Biofilm Formation by Pseudomonas aeruginosa. Antimicrobial Agents and Chemotherapy.
  • Example 20 Microfilm dressing with gallium in the sacrificial polymeric cast
  • microfilm dressings that provide 1) a burst release of an antibiofilm agent (e.g., transition metal gallium) in the wounds to inhibit biofilm formation, followed by 2) a sustained prolonged release of a broad spectrum antimicrobial (e.g., silver) that kill bacteria and prevent microbial colonization.
  • an antibiofilm agent e.g., transition metal gallium
  • a broad spectrum antimicrobial e.g., silver
  • microfilm dressings e.g., 100-200 ⁇ thick
  • the top layer comprises a water-soluble polymeric cast and the bottom layer comprises polymer multilayer nanofilms (e.g., 50-200 nm thick) impregnated with bioactive and/or antimicrobial agents.
  • the microfilm dressings comprise silver nanoparticles in the polymeric nanofilms and the antibiofilm transition metal gallium in the soluble polymeric cast (see, e.g., Figure 52).
  • an antibiofilm agent e.g., gallium
  • bactericidal agent e.g., silver
  • PEMs of (PAH/PAA) 2 o were assembled on PDMS sheets by spray coating, as described herein.
  • Post-fabrication PEMs were impregnated with silver nanoparticles by multiple cycles of silver ion exchange and in situ silver ion reduction, as described herein.
  • a film of polyvinyl alcohol (PVA, MW 22 kDa) was applied over the PEMs by spin coating (at 1500 rpm for 10 seconds) a 5% w/v PVA (MW 22 kDa) solution containing gallium nitrate.
  • Ga 3+ loading in the PVA cast over the PEMs was controlled at between 1 to 10 ⁇ g/cm 2 by adjusting the gallium nitrate concentration in the 5% PVA casting solution in water.
  • Ga 3+ loading in the PVA casts was determined by dissolution in 2% nitric acid and subsequent elemental analysis by inductively coupled plasma emission spectroscopy (ICPES) (Valappil et al. Effect of novel antibacterial gallium-carboxymethyl cellulose on Pseudomonas aeruginosa. Dalton Transactions. 2013;42: 1778-86).
  • ICPES inductively coupled plasma emission spectroscopy
  • Example 21 PEMs with gallium inhibits bio film formation
  • Ga 3+ loading in PEMs was determined by extraction in 2% nitric acid and elemental analysis by inductively coupled plasma emission spectroscopy (ICPES) (Valappil et al. Effect of novel antibacterial gallium-carboxymethyl cellulose on Pseudomonas aeruginosa. Dalton Transactions. 2013;42: 1778-86).
  • ICPES inductively coupled plasma emission spectroscopy
  • PEMs releasing 1 ⁇ g/cm 2 of Ga 3+ completely inhibited formation of P. aeruginosa biofilms similarly to the effect of 25 ⁇ Ga( Os)3 in solution (Example 19; Figure 51).
  • Example 22 A silicone film dressing with iianofilm coatings containing silver and gallium
  • the embodiment of the product provided is a breathable (e.g., a highly breathable) silicone film dressing having antimicrobial and antibiofilm agents for sealing wounds, promoting moist wound healing, and soothing nerves to relieve pain.
  • a breathable e.g., a highly breathable
  • silicone film dressing having antimicrobial and antibiofilm agents for sealing wounds, promoting moist wound healing, and soothing nerves to relieve pain.
  • the technology provides for actively preventing
  • gallium sensitizes microbes in wounds to inhibit biofilm formation and disperses bacteria in existing biofilms.
  • the simultaneous release of antimicrobial silver ions would kill bacteria sensitized by gallium.
  • the synergistic effect of silver and gallium provides a technology that uses significantly lower (e.g., non-toxic) concentrations of silver than conventional silver dressings, thus reducing silver cytotoxicity, staining, irritation, and costs, while providing increased patient comfort.
  • the oxygen transmission rate (OTR) of the silicone film dressing was measured on an Oxygen Permeation Analyzer 8001 (Systech Instruments, Johnsburg, IL) according to standard methods (ASTM D 3985) at constant temperature (23 °C) and relative humidity (50% RH) (see, e.g., Altiok et al. Physical, antibacterial and antioxidant properties of chitosan films incorporated with thyme oil for potential wound healing applications. J Mater Sci: Mater Med. 2010;21 :2227-36, incorporated herein by reference in its entirety). Briefly, the silicone film was clamped in a diffusion chamber.
  • Pure oxygen was introduced into the upper half of the chamber (21.33 kPa (160 mm Hg)) while a carrier gas (nitrogen) flowed through the lower half. Molecules of oxygen permeating through the silicone film to the lower chamber were passed to the sensor by the carrier gas, allowing direct measurement of the OTR as cc/m 2 /day.
  • the thickness of the nanocoatings of PEMs on silicone film dressings was controlled (e.g., by controlling the number of bilayers deposited) to provide an OTR of at least 2.74 cc/m 2 /day, which permits mammalian cell growth (see, e.g., U.S. Pat. No. 5,858,770) and allows normal epithelialization in porcine wounds (Sirvio et al. The Effect of Gas Permeability of Film Dressings on Wound Environment and Healing. Journal of Investigative Dermatology. 1989;93:528-31).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Materials Engineering (AREA)
  • Epidemiology (AREA)
  • Hematology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biomedical Technology (AREA)
  • Vascular Medicine (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Medicinal Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Dermatology (AREA)
  • Materials For Medical Uses (AREA)
  • Medicinal Preparation (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2013/068463 2012-11-06 2013-11-05 Methods and compositions for wound healing Ceased WO2014074503A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
EP21203499.5A EP3995158A1 (en) 2012-11-06 2013-11-05 Methods and compositions for wound healing
US14/440,997 US20150283287A1 (en) 2012-11-06 2013-11-05 Methods and compositions for wound healing
EP13853763.4A EP2916876B1 (en) 2012-11-06 2013-11-05 Methods and compositions for wound healing
ES13853763T ES2904352T3 (es) 2012-11-06 2013-11-05 Procedimientos y composiciones para la curación de heridas
JP2015541849A JP6334550B2 (ja) 2012-11-06 2013-11-05 創傷治癒の方法と組成物

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261723111P 2012-11-06 2012-11-06
US61/723,111 2012-11-06

Publications (1)

Publication Number Publication Date
WO2014074503A1 true WO2014074503A1 (en) 2014-05-15

Family

ID=50685106

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/068463 Ceased WO2014074503A1 (en) 2012-11-06 2013-11-05 Methods and compositions for wound healing

Country Status (5)

Country Link
US (1) US20150283287A1 (https=)
EP (2) EP3995158A1 (https=)
JP (3) JP6334550B2 (https=)
ES (1) ES2904352T3 (https=)
WO (1) WO2014074503A1 (https=)

Cited By (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN104069537A (zh) * 2014-07-17 2014-10-01 厦门大学 海藻酸钠-羧甲基纤维素钠-壳聚糖伤口敷料及其制备方法
CN104225668A (zh) * 2014-08-26 2014-12-24 南通大学 分阶段作用抗菌水凝胶敷料及其制备方法
CN104474570A (zh) * 2014-11-25 2015-04-01 苏州市贝克生物科技有限公司 一种医用聚维酮碘敷料及其制备方法
CN104548188A (zh) * 2015-01-27 2015-04-29 王福亮 一种透明质酸-纳米银基敷料及其制备方法
CN104784744A (zh) * 2015-05-09 2015-07-22 南京师范大学 一种人发角蛋白复合伤口敷料的制备方法
CN105251036A (zh) * 2015-09-30 2016-01-20 苏州蔻美新材料有限公司 一种医用止血材料及其制备方法
JP2017036264A (ja) * 2015-08-06 2017-02-16 グライフォルス・ワールドワイド・オペレーションズ・リミテッド 血漿由来免疫グロブリンM(IgM)を含む組成物を用いて感染性疾患を治療するための方法
CN106540238A (zh) * 2016-11-03 2017-03-29 东南大学 一种自组装抗菌脂肽纳米银颗粒及其制备方法
WO2017060489A1 (en) * 2015-10-09 2017-04-13 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for inhibiting or reducing bacterial biofilms
US20180028713A1 (en) * 2016-07-29 2018-02-01 Imbed Biosciences Inc. Methods and compositions for wound healing
CN108969791A (zh) * 2018-08-23 2018-12-11 大连大学 一种负载纳米银的复合伤口敷料及其制备方法
WO2019012069A1 (en) * 2017-07-12 2019-01-17 Smith & Nephew Plc ANTIMICROBIAL OR WOUND CARE MATERIALS, DEVICES AND USES
WO2019245497A3 (en) * 2018-02-12 2020-03-19 Demir Caner A compound for chronic wound treatment
RU2720831C1 (ru) * 2019-05-31 2020-05-13 Государственное бюджетное учреждение здравоохранения "Научно-исследовательский институт - краевая клиническая больница N 1 имени профессора С.В. Очаповского" Министерства здравоохранения Краснодарского края (ГБУЗ "НИИ-ККБ N 1 им. проф. Очаповского" Минздрава Краснодарского края) Способ наложения вакуумной повязки
EP3528627A4 (en) * 2016-10-20 2020-05-27 Bard Access Systems, Inc. ANTIMICROBIAL ALIGNATE-BASED MICROPARTICLES AND RELATED MATERIALS AND METHODS
US10688224B1 (en) 2019-07-03 2020-06-23 King Abdulaziz University Prosthetic implantable antibacterial surgical mesh
CN112807475A (zh) * 2021-01-08 2021-05-18 陈娜 一种高透气性可降解的载药皮肤创伤敷料及其制备方法
CN113181416A (zh) * 2021-04-26 2021-07-30 苏州和塑美科技有限公司 一种易转移的自粘性纳米纤维抗菌敷料及其制备方法
IL270762B (en) * 2019-11-19 2021-10-31 Sion Biotext Medical Ltd Wound dressing comprising a combination of hydrogel and honey, method of preparation and uses thereof
WO2022012703A1 (en) * 2020-07-13 2022-01-20 Tomas Bata University In Zlin A reaction two-component hydrogel for multifunctional wound dressing and method of its preparation
CN113999410A (zh) * 2021-09-13 2022-02-01 西北大学 一种用于烧烫伤创面修复的新型双交联抗菌水凝胶的制备方法
CN115518195A (zh) * 2022-09-15 2022-12-27 广东省科学院生物与医学工程研究所 一种长效抗菌复合微球及其制备方法和应用
WO2023004124A3 (en) * 2021-07-23 2023-04-13 Visus Therapeutics, Inc. Histatin combinations and methods for treating or inhibiting cell loss
WO2023161818A1 (en) * 2022-02-23 2023-08-31 Ccrest Laboratories Inc. Metal(loid)-based compositions and uses thereof against bacterial biofilms
US11793832B2 (en) 2018-08-16 2023-10-24 Nicholas L. Abbott Methods and compositions for wound healing
US11801262B2 (en) 2016-12-05 2023-10-31 Thioredoxin Systems Ab Antibiotic compositions
CN118340932A (zh) * 2024-02-28 2024-07-16 广西医科大学第一附属医院 蛋白偶联微球制备方法及其应用
EP4326309A4 (en) * 2021-04-20 2025-04-09 Vijay Krishna Raghunathan Growth factor conjugates
US12458607B2 (en) 2018-12-11 2025-11-04 Myospots Australia Pty Ltd Adhesive pad

Families Citing this family (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101801521B (zh) 2007-05-14 2015-06-17 纽约州立大学研究基金会 生物膜中细菌细胞内的生理学分散响应诱导
EP3574909B1 (en) 2008-01-30 2026-03-04 Imbed Biosciences, Inc. Polyelectrolyte multilayer comprising silver for wound healing
US11730760B2 (en) 2011-04-01 2023-08-22 The Bioregentech Institute, Inc. Laser assisted wound healing protocol and system
US11389663B2 (en) * 2011-04-01 2022-07-19 Bioregentech, Inc. Laser assisted wound healing protocol and system
US11745026B2 (en) 2011-04-01 2023-09-05 The Bioregentech Institute, Inc. Laser assisted wound healing protocol and system
DK2964329T3 (da) 2013-03-08 2020-03-16 Univ California Polyphosphat-funktionaliserede uorganiske nanopartikler som hæmostatiske sammensætninger og anvendelsesfremgangsmåder
WO2016054174A1 (en) * 2014-10-02 2016-04-07 S. Jackson, Inc. Method of in vivo monitoring of the condition of an internal surgical repair
US9420783B2 (en) * 2014-10-21 2016-08-23 Eastman Kodak Company Making imprinted particle structure
US10632534B2 (en) * 2015-02-26 2020-04-28 Purdue Research Foundation Processes for producing and treating thin-films composed of nanomaterials
US11571490B2 (en) * 2015-06-29 2023-02-07 3M Innovative Properties Company Anti-microbial articles and methods of using same
IL260038B (en) * 2016-01-04 2022-07-01 Univ Leland Stanford Junior Gene therapy for dystrophic blistering of the skin using genetically modified autologous keratinocytes
WO2017132770A1 (en) * 2016-02-04 2017-08-10 O.R. Science Inc. Wound dressings and methods
CN105582576B (zh) * 2016-02-23 2018-08-17 武汉大复生物科技有限公司 提高内皮祖细胞外泌体释放并促进骨缺损修复的生物材料、制备方法及用途
CN105624833B (zh) * 2016-03-03 2017-11-14 青岛大学 磁性海藻纤维的制备方法
US20210275440A1 (en) * 2016-09-29 2021-09-09 The University Of Memphis Research Foundation Microbead compositions and methods for delivering an agent
US11654293B2 (en) 2016-11-10 2023-05-23 The Bioregentech Institute, Inc. Laser assisted wound healing protocol and system
WO2018218096A1 (en) * 2017-05-26 2018-11-29 Musc Foundation For Research Development Multi-layered system for wound healing along with methods of its formation and use
US20180353174A1 (en) * 2017-06-13 2018-12-13 Ethicon Llc Surgical Stapler with Controlled Healing
US11058804B2 (en) 2017-06-13 2021-07-13 Ethicon Llc Surgical fastener device for the prevention of ECM degradation
US10939911B2 (en) 2017-06-13 2021-03-09 Ethicon Llc Surgical stapler with end effector coating
GB201711179D0 (en) 2017-07-12 2017-08-23 Smith & Nephew Wound care materials, devices and uses
GB201711181D0 (en) 2017-07-12 2017-08-23 Smith & Nephew Polymer foam material, device and use
WO2019094387A1 (en) 2017-11-08 2019-05-16 The Regents Of The University Of Colorado, A Body Corporate Hydrogel drug delivery systems for the treatment of pediatric growth plate injuries
US11541105B2 (en) 2018-06-01 2023-01-03 The Research Foundation For The State University Of New York Compositions and methods for disrupting biofilm formation and maintenance
US11998654B2 (en) 2018-07-12 2024-06-04 Bard Shannon Limited Securing implants and medical devices
US12514711B2 (en) * 2018-09-27 2026-01-06 Exosseus Llc Method of producing a custom-fit orthopedic immobilization device
US11564848B2 (en) * 2018-09-27 2023-01-31 Exosseus Llc Method of producing a custom-fit orthopedic immobilization device
CN109395068A (zh) * 2018-11-26 2019-03-01 浙江舒是生物科技有限公司 一种难愈创口专用消毒液
WO2020157633A2 (en) * 2019-01-28 2020-08-06 Core Scientific Creations Ltd. Wound dressing compositions and methods
RU2706425C1 (ru) * 2019-02-18 2019-11-19 Андрей Александрович Волков Раневое покрытие
CN109772053B (zh) * 2019-03-12 2021-05-14 苏州西部世界机器人有限公司 一种触感仿真硅胶皮肤
KR102803665B1 (ko) * 2019-05-08 2025-05-02 머스큘로스켈레탈 트랜스플랜트 파운데이션 조직 유도된 다공질 매트릭스 및 그의 제조 및 사용 방법
US20220339187A1 (en) * 2019-06-21 2022-10-27 The University Of Melbourne Antimicrobial peptide-selenium nanoparticles
US20210046163A1 (en) * 2019-08-12 2021-02-18 Bioregentech, Inc. Therapeutic systems, devices, and compositions with wound healing and tissue regenerative properties, uses thereof, and corresponding methods
US20210170072A1 (en) * 2019-12-05 2021-06-10 Cornell University Atmosphere-breathing refillable biphasic device for cell replacement therapy
CN111228302A (zh) * 2020-02-27 2020-06-05 青岛科技大学 一种抗菌水凝胶及其制备方法和应用
JP2021166698A (ja) * 2020-04-09 2021-10-21 凸版印刷株式会社 薄型フィルム、および、転写シート
CN111658826B (zh) * 2020-06-15 2022-04-01 深圳兰度生物材料有限公司 抗菌胶原膜及其制备方法
WO2021257508A1 (en) * 2020-06-16 2021-12-23 Advanced Dressing, LLC Controlled oxygen dressing
ES3056172T3 (en) * 2020-06-17 2026-02-18 Otsuka Pharma Factory Inc Encapsulated pancreatic islet
CN112871578B (zh) * 2021-01-19 2022-07-22 北京亚宝生物药业有限公司 一种贴剂制备装置及制备方法
CN115613219B (zh) * 2021-07-12 2025-08-15 苏州博创同康生物工程有限公司 一种多功能医用材料及其制备方法和应用
KR102527411B1 (ko) * 2022-02-08 2023-04-28 영남이공대학교 산학협력단 습윤 밴드용 조성물, 상기 습윤밴드 및 이의 제조방법
KR102442848B1 (ko) * 2022-05-13 2022-09-15 주식회사 티앤엘 지혈부직포
CN114984301B (zh) * 2022-05-30 2023-03-17 浙江大学 一种促进创面无瘢痕愈合的抗菌敷料及其制备方法
US20240358884A1 (en) * 2023-04-28 2024-10-31 Youngstown State University Ferrocene-containing polyelectrolyte complex and wound dressing
WO2025245594A1 (pt) * 2024-05-27 2025-12-04 Nanowear Ltda Curativo à base de nanopartículas metálicas
CN121041457A (zh) * 2025-09-04 2025-12-02 中国烟草总公司湖南省公司 一种烟草提取物创面愈合凝胶的制备方法
CN120827632B (zh) * 2025-09-16 2026-01-06 东北大学 压电抗菌超分子自凝胶止血粉末及其制备方法和应用

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040214326A1 (en) * 2001-06-13 2004-10-28 Cousins Brian G Biomaterial substrates
US20050249791A1 (en) * 2004-05-07 2005-11-10 3M Innovative Properties Company Antimicrobial articles
US20090263468A1 (en) * 2008-01-30 2009-10-22 Mcanulty Jonathan F Methods and compositions for wound healing
US20110189287A1 (en) * 2008-01-30 2011-08-04 Abbott Nicholas L Methods and compositions for wound healing

Family Cites Families (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5268178A (en) 1989-09-25 1993-12-07 The Board Of Regents, The University Of Texas System Biodegradable antibiotic implants and methods of their use in treating and preventing infections
DE69033606T2 (de) * 1990-01-12 2001-04-26 New York Society For The Relief Of The Ruptured And Crippled, Maintaining The Hospital For Special Surgery Verfahren zur verbesserung der wundheilung und gewebeerneuerung
US5686116A (en) * 1990-01-12 1997-11-11 New York Society For The Relief Of The Ruptured And Crippled, Maintaining The Hospital For Special Surgery Methods of enhancing repair, healing and augmentation of bone implants
FR2685346B1 (fr) 1991-12-18 1994-02-11 Cis Bio International Procede de preparation d'arn double-brin, et ses applications.
US5512131A (en) 1993-10-04 1996-04-30 President And Fellows Of Harvard College Formation of microstamped patterns on surfaces and derivative articles
US6015880A (en) 1994-03-16 2000-01-18 California Institute Of Technology Method and substrate for performing multiple sequential reactions on a matrix
US5807522A (en) 1994-06-17 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods for fabricating microarrays of biological samples
WO1996029629A2 (en) 1995-03-01 1996-09-26 President And Fellows Of Harvard College Microcontact printing on surfaces and derivative articles
US5834121A (en) 1996-01-16 1998-11-10 Solid Phase Sciences Corp. Composite magnetic beads
US5731152A (en) 1996-05-13 1998-03-24 Motorola, Inc. Methods and systems for biological reagent placement
IL131978A0 (en) 1997-03-20 2001-03-19 Univ Washington Solvent for biopolymer synthesis solvent microdots and methods of use
US5858770A (en) 1997-09-30 1999-01-12 Brandeis University Cell culture plate with oxygen and carbon dioxide-permeable waterproof sealing membrane
US6368079B2 (en) 1998-12-23 2002-04-09 Battelle Pulmonary Therapeutics, Inc. Piezoelectric micropump
US6869858B2 (en) 1999-01-25 2005-03-22 Taiwan Semiconductor Manufacturing Company, Ltd. Shallow trench isolation planarized by wet etchback and chemical mechanical polishing
EP1183303B1 (de) 1999-05-10 2005-01-12 Basf Aktiengesellschaft Biologisch abbaubare polyesterschaumstoffpartikel
US6935727B2 (en) 2001-12-18 2005-08-30 Agilent Technologies, Inc. Pulse jet print head assembly having multiple reservoirs and methods for use in the manufacture of biopolymeric arrays
WO2004080502A1 (ja) * 2003-03-10 2004-09-23 Kawasumi Laboratories, Inc. 癒着防止材
AU2004296178B2 (en) 2003-12-04 2011-03-24 The United States Of America As Represented By The Department Of Veterans Affairs Gallium inhibits biofilm formation
WO2005058199A1 (en) * 2003-12-16 2005-06-30 Avery Dennison Corporation Electrostatically self-assembled antimicrobial coating for medical applications
KR100706251B1 (ko) * 2005-07-14 2007-04-12 삼성전자주식회사 반도체 제조 장치 및 냉매 순환 방법
WO2010083589A1 (en) * 2009-01-23 2010-07-29 Kane Biotech Inc. Biofilm-removing antimicrobial compositions and uses thereof
US20120010636A1 (en) * 2009-02-11 2012-01-12 Nanyang Technological University Multi-layered surgical prosthesis
US8652509B2 (en) * 2009-11-02 2014-02-18 Moshe Rogosnitzky Method of wound hemostasis using liquid gallium nitrate

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040214326A1 (en) * 2001-06-13 2004-10-28 Cousins Brian G Biomaterial substrates
US20050249791A1 (en) * 2004-05-07 2005-11-10 3M Innovative Properties Company Antimicrobial articles
US20090263468A1 (en) * 2008-01-30 2009-10-22 Mcanulty Jonathan F Methods and compositions for wound healing
US20110189287A1 (en) * 2008-01-30 2011-08-04 Abbott Nicholas L Methods and compositions for wound healing

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
AGARWAL ET AL.: "Surfaces modified with nanometer-thick silver-impregnated polymeric films that kill bacteria but support growth of mammalian cells", BIOMATERIALS, vol. 31, no. 4, February 2010 (2010-02-01), pages 680 - 690, XP026762077 *
See also references of EP2916876A4 *

Cited By (48)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN104069537A (zh) * 2014-07-17 2014-10-01 厦门大学 海藻酸钠-羧甲基纤维素钠-壳聚糖伤口敷料及其制备方法
CN104225668A (zh) * 2014-08-26 2014-12-24 南通大学 分阶段作用抗菌水凝胶敷料及其制备方法
CN104474570A (zh) * 2014-11-25 2015-04-01 苏州市贝克生物科技有限公司 一种医用聚维酮碘敷料及其制备方法
CN104548188A (zh) * 2015-01-27 2015-04-29 王福亮 一种透明质酸-纳米银基敷料及其制备方法
CN104784744A (zh) * 2015-05-09 2015-07-22 南京师范大学 一种人发角蛋白复合伤口敷料的制备方法
US11208471B2 (en) 2015-08-06 2021-12-28 Grifols Worldwide Operations Limited Method for treating infectious diseases using a composition comprising plasma-derived immunoglobulin M (IgM)
JP2017036264A (ja) * 2015-08-06 2017-02-16 グライフォルス・ワールドワイド・オペレーションズ・リミテッド 血漿由来免疫グロブリンM(IgM)を含む組成物を用いて感染性疾患を治療するための方法
CN105251036A (zh) * 2015-09-30 2016-01-20 苏州蔻美新材料有限公司 一种医用止血材料及其制备方法
WO2017060489A1 (en) * 2015-10-09 2017-04-13 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for inhibiting or reducing bacterial biofilms
KR20240025050A (ko) * 2016-07-29 2024-02-26 임베드 바이오사이언시스 아이엔씨. 상처 치유를 위한 방법 및 조성물
US20180028713A1 (en) * 2016-07-29 2018-02-01 Imbed Biosciences Inc. Methods and compositions for wound healing
KR102637746B1 (ko) 2016-07-29 2024-02-16 임베드 바이오사이언시스 아이엔씨. 상처 치유를 위한 방법 및 조성물
CN109843343A (zh) * 2016-07-29 2019-06-04 因贝德生物科学公司 用于伤口愈合的方法和组合物
US11554194B2 (en) * 2016-07-29 2023-01-17 Imbed Biosciences Inc. Methods and compositions for wound healing
US12409247B2 (en) * 2016-07-29 2025-09-09 Imbed Biosciences Inc. Methods and compositions for wound healing
US20240009342A1 (en) * 2016-07-29 2024-01-11 Imbed Biosciences Inc. Methods and compositions for wound healing
KR102899445B1 (ko) 2016-07-29 2025-12-15 임베드 바이오사이언시스 아이엔씨. 상처 치유를 위한 방법 및 조성물
KR20230008234A (ko) * 2016-07-29 2023-01-13 임베드 바이오사이언시스 아이엔씨. 상처 치유를 위한 방법 및 조성물
EP3528627A4 (en) * 2016-10-20 2020-05-27 Bard Access Systems, Inc. ANTIMICROBIAL ALIGNATE-BASED MICROPARTICLES AND RELATED MATERIALS AND METHODS
CN106540238A (zh) * 2016-11-03 2017-03-29 东南大学 一种自组装抗菌脂肽纳米银颗粒及其制备方法
CN106540238B (zh) * 2016-11-03 2021-02-26 东南大学 一种自组装抗菌脂肽纳米银颗粒及其制备方法
US11801262B2 (en) 2016-12-05 2023-10-31 Thioredoxin Systems Ab Antibiotic compositions
US11730852B2 (en) 2017-07-12 2023-08-22 Smith & Nephew Plc Antimicrobial or wound care materials, devices and uses
US12064523B2 (en) 2017-07-12 2024-08-20 Smith & Nephew Plc Antimicrobial or wound care materials, devices and uses
EP4353271A1 (en) * 2017-07-12 2024-04-17 Smith & Nephew plc Antimicrobial or wound care materials, devices and uses
CN110891617A (zh) * 2017-07-12 2020-03-17 史密夫及内修公开有限公司 抗微生物或伤口护理材料、装置和用途
WO2019012069A1 (en) * 2017-07-12 2019-01-17 Smith & Nephew Plc ANTIMICROBIAL OR WOUND CARE MATERIALS, DEVICES AND USES
WO2019245497A3 (en) * 2018-02-12 2020-03-19 Demir Caner A compound for chronic wound treatment
US12168026B2 (en) 2018-08-16 2024-12-17 Nicholas L. Abbott Methods and compositions for wound healing
US11793832B2 (en) 2018-08-16 2023-10-24 Nicholas L. Abbott Methods and compositions for wound healing
CN108969791A (zh) * 2018-08-23 2018-12-11 大连大学 一种负载纳米银的复合伤口敷料及其制备方法
US12458607B2 (en) 2018-12-11 2025-11-04 Myospots Australia Pty Ltd Adhesive pad
RU2720831C1 (ru) * 2019-05-31 2020-05-13 Государственное бюджетное учреждение здравоохранения "Научно-исследовательский институт - краевая клиническая больница N 1 имени профессора С.В. Очаповского" Министерства здравоохранения Краснодарского края (ГБУЗ "НИИ-ККБ N 1 им. проф. Очаповского" Минздрава Краснодарского края) Способ наложения вакуумной повязки
US10894113B1 (en) 2019-07-03 2021-01-19 King Abdulaziz University Prosthetic implantable antibacterial surgical mesh
US10688224B1 (en) 2019-07-03 2020-06-23 King Abdulaziz University Prosthetic implantable antibacterial surgical mesh
US12343238B2 (en) 2019-11-19 2025-07-01 Sion Biotext Medical Ltd. Wound dressing comprising a combination of hydrogel and honey, method of preparation and uses thereof
IL270762B (en) * 2019-11-19 2021-10-31 Sion Biotext Medical Ltd Wound dressing comprising a combination of hydrogel and honey, method of preparation and uses thereof
WO2022012703A1 (en) * 2020-07-13 2022-01-20 Tomas Bata University In Zlin A reaction two-component hydrogel for multifunctional wound dressing and method of its preparation
CN112807475B (zh) * 2021-01-08 2022-11-04 湘雅生物医药(湖州)有限公司 一种高透气性可降解的载药皮肤创伤敷料及其制备方法
CN112807475A (zh) * 2021-01-08 2021-05-18 陈娜 一种高透气性可降解的载药皮肤创伤敷料及其制备方法
EP4326309A4 (en) * 2021-04-20 2025-04-09 Vijay Krishna Raghunathan Growth factor conjugates
CN113181416A (zh) * 2021-04-26 2021-07-30 苏州和塑美科技有限公司 一种易转移的自粘性纳米纤维抗菌敷料及其制备方法
WO2023004124A3 (en) * 2021-07-23 2023-04-13 Visus Therapeutics, Inc. Histatin combinations and methods for treating or inhibiting cell loss
CN113999410B (zh) * 2021-09-13 2024-01-19 西北大学 一种用于烧烫伤创面修复的双交联抗菌水凝胶的制备方法
CN113999410A (zh) * 2021-09-13 2022-02-01 西北大学 一种用于烧烫伤创面修复的新型双交联抗菌水凝胶的制备方法
WO2023161818A1 (en) * 2022-02-23 2023-08-31 Ccrest Laboratories Inc. Metal(loid)-based compositions and uses thereof against bacterial biofilms
CN115518195A (zh) * 2022-09-15 2022-12-27 广东省科学院生物与医学工程研究所 一种长效抗菌复合微球及其制备方法和应用
CN118340932A (zh) * 2024-02-28 2024-07-16 广西医科大学第一附属医院 蛋白偶联微球制备方法及其应用

Also Published As

Publication number Publication date
EP2916876B1 (en) 2021-10-20
JP2018127490A (ja) 2018-08-16
EP3995158A1 (en) 2022-05-11
EP2916876A1 (en) 2015-09-16
JP6334550B2 (ja) 2018-05-30
JP2015536725A (ja) 2015-12-24
JP2020143125A (ja) 2020-09-10
US20150283287A1 (en) 2015-10-08
EP2916876A4 (en) 2016-09-07
JP7586654B2 (ja) 2024-11-19
ES2904352T3 (es) 2022-04-04
JP6929817B2 (ja) 2021-09-01

Similar Documents

Publication Publication Date Title
JP7586654B2 (ja) 創傷治癒の方法と組成物
US9174839B2 (en) Methods and compositions for wound healing
US12409247B2 (en) Methods and compositions for wound healing
US20210186891A1 (en) Methods and compositions for wound healing
US20250205278A1 (en) Methods and compositions for wound healing
HK40074104A (en) Methods and compositions for wound healing
HK40020060A (en) Methods and compositions for wound healing

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13853763

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 14440997

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2015541849

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2013853763

Country of ref document: EP